NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F057885

Metagenome / Metatranscriptome Family F057885

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F057885
Family Type Metagenome / Metatranscriptome
Number of Sequences 135
Average Sequence Length 39 residues
Representative Sequence MANPANSTVQNLLPVQAYFNLDGSFNTFIGQGQPFYAT
Number of Associated Samples 108
Number of Associated Scaffolds 135

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 79.26 %
% of genes near scaffold ends (potentially truncated) 99.26 %
% of genes from short scaffolds (< 2000 bps) 82.96 %
Associated GOLD sequencing projects 100
AlphaFold2 3D model prediction Yes
3D model pTM-score0.26

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (48.148 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater
(35.556 % of family members)
Environment Ontology (ENVO) Unclassified
(77.778 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(85.926 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 15.15%    Coil/Unstructured: 84.85%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.26
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 135 Family Scaffolds
PF11651P22_CoatProtein 19.26
PF16510P22_portal 0.74
PF07969Amidohydro_3 0.74



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms62.96 %
UnclassifiedrootN/A37.04 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000268|M3P_10205814Not Available577Open in IMG/M
3300000439|TBL_comb48_EPIDRAFT_1071834All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1093Open in IMG/M
3300000553|TBL_comb47_HYPODRAFT_10101278All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1417Open in IMG/M
3300001838|RCM33_1072038All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage591Open in IMG/M
3300001850|RCM37_1127621All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae867Open in IMG/M
3300002307|JGI24890J29729_1006620All Organisms → cellular organisms → Bacteria → Proteobacteria3500Open in IMG/M
3300003813|Ga0007879_1003350All Organisms → cellular organisms → Bacteria → Proteobacteria2431Open in IMG/M
3300003827|Ga0007880_1003753All Organisms → cellular organisms → Bacteria1810Open in IMG/M
3300003852|Ga0031655_10125106All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1016Open in IMG/M
3300003852|Ga0031655_10373377All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage530Open in IMG/M
3300004461|Ga0066223_1115168Not Available621Open in IMG/M
3300004687|Ga0065174_1087911All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage579Open in IMG/M
3300004694|Ga0065170_1028401All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage748Open in IMG/M
3300004774|Ga0007794_10219105Not Available566Open in IMG/M
3300004777|Ga0007827_10109083Not Available621Open in IMG/M
3300006072|Ga0007881_1136323All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage602Open in IMG/M
3300006100|Ga0007806_1032930Not Available1034Open in IMG/M
3300006103|Ga0007813_1020604All Organisms → cellular organisms → Bacteria → Proteobacteria1553Open in IMG/M
3300006103|Ga0007813_1033228Not Available1134Open in IMG/M
3300006103|Ga0007813_1054928All Organisms → cellular organisms → Bacteria → Proteobacteria816Open in IMG/M
3300006103|Ga0007813_1082610Not Available628Open in IMG/M
3300006104|Ga0007882_10194478All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage693Open in IMG/M
3300006106|Ga0007833_1060571All Organisms → cellular organisms → Bacteria → Proteobacteria686Open in IMG/M
3300006109|Ga0007870_1072183All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage669Open in IMG/M
3300006109|Ga0007870_1100279All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage565Open in IMG/M
3300006114|Ga0007815_1031369Not Available1178Open in IMG/M
3300006118|Ga0007859_1011393All Organisms → cellular organisms → Bacteria2026Open in IMG/M
3300006118|Ga0007859_1012809All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1898Open in IMG/M
3300006118|Ga0007859_1109991Not Available546Open in IMG/M
3300006122|Ga0007837_1058882Not Available650Open in IMG/M
3300006124|Ga0007873_1025740Not Available980Open in IMG/M
3300006128|Ga0007828_1003170All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria3642Open in IMG/M
3300007992|Ga0105748_10212814All Organisms → cellular organisms → Bacteria → Proteobacteria806Open in IMG/M
3300008110|Ga0114343_1076280All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1216Open in IMG/M
3300008113|Ga0114346_1044257All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2256Open in IMG/M
3300009154|Ga0114963_10423093All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage719Open in IMG/M
3300009154|Ga0114963_10554249Not Available606Open in IMG/M
3300009159|Ga0114978_10826485All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage521Open in IMG/M
3300009160|Ga0114981_10039702All Organisms → cellular organisms → Bacteria → Proteobacteria2666Open in IMG/M
3300009160|Ga0114981_10115453All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1487Open in IMG/M
3300009160|Ga0114981_10427018All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage712Open in IMG/M
3300009163|Ga0114970_10017574All Organisms → Viruses → Predicted Viral4880Open in IMG/M
3300009164|Ga0114975_10084067All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1850Open in IMG/M
3300009164|Ga0114975_10425107Not Available722Open in IMG/M
3300009164|Ga0114975_10634583Not Available568Open in IMG/M
3300009175|Ga0073936_10769824All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage525Open in IMG/M
3300009180|Ga0114979_10545995Not Available666Open in IMG/M
3300009183|Ga0114974_10427714Not Available754Open in IMG/M
3300009184|Ga0114976_10383655All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage738Open in IMG/M
3300009185|Ga0114971_10012137Not Available5684Open in IMG/M
3300009502|Ga0114951_10524590All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage575Open in IMG/M
3300010157|Ga0114964_10241276All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage862Open in IMG/M
3300012697|Ga0157578_1088258Not Available902Open in IMG/M
3300012701|Ga0157562_1184130Not Available3649Open in IMG/M
3300013093|Ga0164296_1278723All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage629Open in IMG/M
3300013093|Ga0164296_1320346All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage579Open in IMG/M
3300013094|Ga0164297_10327922All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage584Open in IMG/M
3300017754|Ga0181344_1158842Not Available644Open in IMG/M
3300017766|Ga0181343_1168047All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage607Open in IMG/M
3300020048|Ga0207193_1540192All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage774Open in IMG/M
3300020686|Ga0214194_106040Not Available1124Open in IMG/M
3300020723|Ga0214249_1013836Not Available1517Open in IMG/M
3300020723|Ga0214249_1045670All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage621Open in IMG/M
3300020726|Ga0214220_1001828Not Available4962Open in IMG/M
3300020727|Ga0214246_1001215Not Available6346Open in IMG/M
3300020727|Ga0214246_1001711Not Available5235Open in IMG/M
3300020731|Ga0214170_1038965All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage730Open in IMG/M
3300020733|Ga0214172_1012177All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1584Open in IMG/M
3300020735|Ga0214219_1013564All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1483Open in IMG/M
3300021071|Ga0194058_10152277All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage764Open in IMG/M
3300021120|Ga0214188_115231All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage700Open in IMG/M
3300021121|Ga0214173_100576Not Available5433Open in IMG/M
3300021126|Ga0214187_1028705All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage596Open in IMG/M
3300021127|Ga0214193_1012801All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1100Open in IMG/M
3300021131|Ga0214206_1009774All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1393Open in IMG/M
3300021137|Ga0214165_1103614Not Available542Open in IMG/M
3300021138|Ga0214164_1032797Not Available1281Open in IMG/M
3300021600|Ga0194059_1026967All Organisms → cellular organisms → Bacteria → Proteobacteria1972Open in IMG/M
3300021600|Ga0194059_1185681Not Available629Open in IMG/M
3300021952|Ga0213921_1021384All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1086Open in IMG/M
3300021962|Ga0222713_10481619All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage746Open in IMG/M
3300022156|Ga0213934_1000811All Organisms → cellular organisms → Bacteria3583Open in IMG/M
3300022555|Ga0212088_10563580All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage713Open in IMG/M
3300022555|Ga0212088_10682174All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage615Open in IMG/M
3300022747|Ga0228703_1070135All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage882Open in IMG/M
3300023311|Ga0256681_10132840All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage882Open in IMG/M
3300023311|Ga0256681_11041747All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage583Open in IMG/M
3300024552|Ga0256345_1045901All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage856Open in IMG/M
3300024559|Ga0255284_1070916Not Available741Open in IMG/M
3300025346|Ga0208737_1002797Not Available936Open in IMG/M
3300025346|Ga0208737_1004878All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage708Open in IMG/M
3300025367|Ga0208108_1031299Not Available579Open in IMG/M
3300025369|Ga0208382_1038121All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage575Open in IMG/M
3300025372|Ga0207957_1008654All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1457Open in IMG/M
3300025375|Ga0208259_1039566Not Available660Open in IMG/M
3300025379|Ga0208738_1006263All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae2172Open in IMG/M
3300025382|Ga0208256_1027669All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage825Open in IMG/M
3300025382|Ga0208256_1031927All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage755Open in IMG/M
3300025387|Ga0207959_1011378All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1576Open in IMG/M
3300025387|Ga0207959_1050374Not Available628Open in IMG/M
3300025388|Ga0208503_1036237Not Available550Open in IMG/M
3300025392|Ga0208380_1004142Not Available2880Open in IMG/M
3300025400|Ga0208387_1002242All Organisms → Viruses → Predicted Viral4636Open in IMG/M
3300025400|Ga0208387_1007128All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2329Open in IMG/M
3300025407|Ga0208378_1048717All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage688Open in IMG/M
3300025417|Ga0208616_1020679Not Available1031Open in IMG/M
3300025421|Ga0207958_1018945Not Available1151Open in IMG/M
3300025421|Ga0207958_1034620All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage774Open in IMG/M
3300025426|Ga0208739_1062162All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage594Open in IMG/M
3300025430|Ga0208622_1087810Not Available509Open in IMG/M
3300025450|Ga0208744_1029671Not Available1138Open in IMG/M
3300025455|Ga0208376_1011561All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2027Open in IMG/M
3300025467|Ga0208260_1009458Not Available2229Open in IMG/M
3300025648|Ga0208507_1104505Not Available832Open in IMG/M
3300027708|Ga0209188_1045432All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1983Open in IMG/M
3300027734|Ga0209087_1313462All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage554Open in IMG/M
3300027747|Ga0209189_1042138All Organisms → cellular organisms → Bacteria → Proteobacteria2266Open in IMG/M
3300027747|Ga0209189_1222046Not Available768Open in IMG/M
3300027764|Ga0209134_10302706Not Available543Open in IMG/M
3300027777|Ga0209829_10243081All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage761Open in IMG/M
3300027896|Ga0209777_10231886All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1463Open in IMG/M
3300027896|Ga0209777_10981524All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage579Open in IMG/M
3300027902|Ga0209048_10361743Not Available1003Open in IMG/M
3300027917|Ga0209536_102852985Not Available561Open in IMG/M
3300028025|Ga0247723_1083484All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102836Open in IMG/M
3300028392|Ga0304729_1145103All Organisms → cellular organisms → Bacteria → Proteobacteria769Open in IMG/M
3300028394|Ga0304730_1299232Not Available555Open in IMG/M
3300031813|Ga0316217_10060221Not Available1937Open in IMG/M
3300031884|Ga0316220_1150912All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage837Open in IMG/M
3300032117|Ga0316218_1231619All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage648Open in IMG/M
3300032561|Ga0316222_1103653All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1130Open in IMG/M
3300032561|Ga0316222_1318978Not Available504Open in IMG/M
3300032605|Ga0316232_1216064Not Available761Open in IMG/M
3300032665|Ga0316221_1004790All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage9999Open in IMG/M
3300032665|Ga0316221_1021705All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3084Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater35.56%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake16.30%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater11.85%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater7.41%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment3.70%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater3.70%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake2.22%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater2.22%
Freshwater Lake HypolimnionEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion2.22%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater2.22%
FreshwaterEnvironmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater2.22%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton1.48%
Marine PlanktonEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton1.48%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater1.48%
LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic0.74%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment0.74%
LoticEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Lotic0.74%
Marine SedimentEnvironmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment0.74%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.74%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.74%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.74%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment0.74%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000268Lotic microbial communities from Mississippi River at two locations in the state of Minnesota, sample from River Site 1, Mississippi Headwaters ver2EnvironmentalOpen in IMG/M
3300000439Trout Bog Lake June 7 2007 Epilimnion (Trout Bog Lake Combined Assembly 48 Epilimnion Samples, Aug 2012 Assem)EnvironmentalOpen in IMG/M
3300000553Trout Bog Lake May 28 2007 Hypolimnion (Trout Bog Lake Combined Assembly 47 Hypolimnion Samples, Aug 2012 Assem)EnvironmentalOpen in IMG/M
3300001838Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM33, ROCA_DNA217_0.2um_bLM_C_2aEnvironmentalOpen in IMG/M
3300001850Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM37, ROCA_DNA234_0.2um_Ob_C_2aEnvironmentalOpen in IMG/M
3300002307Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-C2 co-culture F-D7EnvironmentalOpen in IMG/M
3300003813Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH15Jun09EnvironmentalOpen in IMG/M
3300003827Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH29Jun09EnvironmentalOpen in IMG/M
3300003852Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HBEnvironmentalOpen in IMG/M
3300004461Marine viral communities from Newfoundland, Canada BC-2EnvironmentalOpen in IMG/M
3300004687Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Jul08 (version 2)EnvironmentalOpen in IMG/M
3300004694Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE17Sep08 (version 2)EnvironmentalOpen in IMG/M
3300004774Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA5MEnvironmentalOpen in IMG/M
3300004777Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Jul07EnvironmentalOpen in IMG/M
3300006072Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09EnvironmentalOpen in IMG/M
3300006100Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09EnvironmentalOpen in IMG/M
3300006103Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Jun09EnvironmentalOpen in IMG/M
3300006104Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09.1EnvironmentalOpen in IMG/M
3300006106Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Jul07EnvironmentalOpen in IMG/M
3300006109Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH04Jul08EnvironmentalOpen in IMG/M
3300006114Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug09EnvironmentalOpen in IMG/M
3300006118Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul07EnvironmentalOpen in IMG/M
3300006122Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE31Jul07EnvironmentalOpen in IMG/M
3300006124Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH26May08EnvironmentalOpen in IMG/M
3300006128Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Oct07EnvironmentalOpen in IMG/M
3300007992Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2umEnvironmentalOpen in IMG/M
3300008110Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NAEnvironmentalOpen in IMG/M
3300008113Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NAEnvironmentalOpen in IMG/M
3300009154Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaGEnvironmentalOpen in IMG/M
3300009159Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaGEnvironmentalOpen in IMG/M
3300009160Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaGEnvironmentalOpen in IMG/M
3300009163Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaGEnvironmentalOpen in IMG/M
3300009164Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaGEnvironmentalOpen in IMG/M
3300009175Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaGEnvironmentalOpen in IMG/M
3300009180Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaGEnvironmentalOpen in IMG/M
3300009183Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaGEnvironmentalOpen in IMG/M
3300009184Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaGEnvironmentalOpen in IMG/M
3300009185Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaGEnvironmentalOpen in IMG/M
3300009502Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaGEnvironmentalOpen in IMG/M
3300010157Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaGEnvironmentalOpen in IMG/M
3300012697Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES082 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012701Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES061 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013093Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES057 metaGEnvironmentalOpen in IMG/M
3300013094Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES058 metaGEnvironmentalOpen in IMG/M
3300017754Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.DEnvironmentalOpen in IMG/M
3300017766Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.DEnvironmentalOpen in IMG/M
3300020048Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915EnvironmentalOpen in IMG/M
3300020686Freshwater microbial communities from Trout Bog Lake, WI - 12AUG2008 epilimnionEnvironmentalOpen in IMG/M
3300020723Freshwater microbial communities from Trout Bog Lake, WI - 23JUN2009 hypolimnionEnvironmentalOpen in IMG/M
3300020726Freshwater microbial communities from Trout Bog Lake, WI - 31JUL2007 hypolimnionEnvironmentalOpen in IMG/M
3300020727Freshwater microbial communities from Trout Bog Lake, WI - 29MAY2009 hypolimnionEnvironmentalOpen in IMG/M
3300020731Freshwater microbial communities from Trout Bog Lake, WI - 27JUN2007 epilimnionEnvironmentalOpen in IMG/M
3300020733Freshwater microbial communities from Trout Bog Lake, WI - 12JUL2007 epilimnionEnvironmentalOpen in IMG/M
3300020735Freshwater microbial communities from Trout Bog Lake, WI - 25JUL2007 hypolimnionEnvironmentalOpen in IMG/M
3300021071Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L442-17mEnvironmentalOpen in IMG/M
3300021120Freshwater microbial communities from Trout Bog Lake, WI - 01JUL2008 epilimnionEnvironmentalOpen in IMG/M
3300021121Freshwater microbial communities from Trout Bog Lake, WI - 25JUL2007 epilimnionEnvironmentalOpen in IMG/M
3300021126Freshwater microbial communities from Trout Bog Lake, WI - 24JUN2008 epilimnionEnvironmentalOpen in IMG/M
3300021127Freshwater microbial communities from Trout Bog Lake, WI - 05AUG2008 epilimnionEnvironmentalOpen in IMG/M
3300021131Freshwater microbial communities from Trout Bog Lake, WI - 07JUL2009 epilimnionEnvironmentalOpen in IMG/M
3300021137Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 hypolimnionEnvironmentalOpen in IMG/M
3300021138Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnionEnvironmentalOpen in IMG/M
3300021600Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L626-11mEnvironmentalOpen in IMG/M
3300021952Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17 MGEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300022156Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022555Alinen_combined assemblyEnvironmentalOpen in IMG/M
3300022747Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MGEnvironmentalOpen in IMG/M
3300023311Combined Assembly of Gp0281739, Gp0281740, Gp0281741EnvironmentalOpen in IMG/M
3300024552Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024559Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025346Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE06Aug07 (SPAdes)EnvironmentalOpen in IMG/M
3300025367Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE22May08 (SPAdes)EnvironmentalOpen in IMG/M
3300025369Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE28Sep08 (SPAdes)EnvironmentalOpen in IMG/M
3300025372Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jun07 (SPAdes)EnvironmentalOpen in IMG/M
3300025375Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH22May08 (SPAdes)EnvironmentalOpen in IMG/M
3300025379Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE21Jul09 (SPAdes)EnvironmentalOpen in IMG/M
3300025382Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH22Jun08 (SPAdes)EnvironmentalOpen in IMG/M
3300025387Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH20Aug07 (SPAdes)EnvironmentalOpen in IMG/M
3300025388Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE31Jul07 (SPAdes)EnvironmentalOpen in IMG/M
3300025392Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jun07 (SPAdes)EnvironmentalOpen in IMG/M
3300025400Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul09 (SPAdes)EnvironmentalOpen in IMG/M
3300025407Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE24Aug09 (SPAdes)EnvironmentalOpen in IMG/M
3300025417Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Oct07 (SPAdes)EnvironmentalOpen in IMG/M
3300025421Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul07 (SPAdes)EnvironmentalOpen in IMG/M
3300025426Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jul09 (SPAdes)EnvironmentalOpen in IMG/M
3300025430Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Jul09 (SPAdes)EnvironmentalOpen in IMG/M
3300025450Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09 (SPAdes)EnvironmentalOpen in IMG/M
3300025455Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA2.5M (SPAdes)EnvironmentalOpen in IMG/M
3300025467Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Aug09 (SPAdes)EnvironmentalOpen in IMG/M
3300025648Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09.1 (SPAdes)EnvironmentalOpen in IMG/M
3300027708Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027734Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027747Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027764Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027777Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027896Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes)EnvironmentalOpen in IMG/M
3300027902Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes)EnvironmentalOpen in IMG/M
3300027917Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes)EnvironmentalOpen in IMG/M
3300028025Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FCEnvironmentalOpen in IMG/M
3300028392Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2)EnvironmentalOpen in IMG/M
3300028394Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2)EnvironmentalOpen in IMG/M
3300031813Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - 1anoAEnvironmentalOpen in IMG/M
3300031884Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18005EnvironmentalOpen in IMG/M
3300032117Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18003EnvironmentalOpen in IMG/M
3300032561Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18011EnvironmentalOpen in IMG/M
3300032605Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18025_13EnvironmentalOpen in IMG/M
3300032665Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18007EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
M3P_1020581423300000268LoticMTNPADSSVQNLLPVQAYFNADGSFNTFIGQGQPFYATAN
TBL_comb48_EPIDRAFT_107183443300000439FreshwaterMASPANSIVQNLLPVQAYFNVDKSFNTFIGQGIPFYATTN
TBL_comb47_HYPODRAFT_1010127813300000553FreshwaterMTTPSNSAVQNLLPVQAYFNVDGSFNTFIGQGKPFYATSN
RCM33_107203823300001838Marine PlanktonMANTANSTVQNLLPVQAYFDTSGNFQTFIGQGEPFY
RCM37_112762113300001850Marine PlanktonMANPAQTNYQNLLPVRAYFALDGTFQTFIGQGQPFY
JGI24890J29729_100662073300002307LenticMTNPSNSAVQNLLPVQAYFNVDGSFNTFIGQGLPFYATANP
Ga0007879_100335053300003813FreshwaterMAGPAKTIDQNILPVQAYFDVYGNFQTFIGQGQAFTVPINP
Ga0007880_100375313300003827FreshwaterMSAPALTSDQNILPVQAYFNLDGSFNTFIGQGHPFVVSATESI
Ga0031655_1012510623300003852Freshwater Lake SedimentMGAPNSTVDQNLLPVQAYFDVYGNFQTFIGQNKAFYATMHN*
Ga0031655_1037337723300003852Freshwater Lake SedimentMSSINDSVTQNLLPVQAYFNLDGSFNTFIGQNMPFYATTNPVQSG
Ga0066223_111516833300004461MarineMTGPNLTVDQNLLPVQAYFSVDGTFQTFIGQGQPFTATIN
Ga0065174_108791113300004687FreshwaterMATGPALTQDQNILPVQAYFNLDGTFNTFIGQGVPFTVPV
Ga0065170_102840113300004694FreshwaterMANINDSVTQNLLPVQAYFNLDGTFNTFIGQNMPFYATINP
Ga0007794_1021910523300004774FreshwaterMADPAKTVDQNILPVQALFNLDNSFNTFIGQNQPFYATVNPLQSGLT
Ga0007827_1010908313300004777FreshwaterMSAPNLTSDQNLLPVQAYFNLDGSFNTFIGQGQPFYATLN
Ga0007881_113632323300006072FreshwaterMANINDSVTQNLLPVQAYFNLDGTFNTFIGQNMPFYA
Ga0007806_103293043300006100FreshwaterMNAPASTVDQNILPVQAYFDVFGNFQTFLGQGRPFYATFNPVQ
Ga0007813_102060413300006103FreshwaterMAGINDSVTQNLLPVQAYFNLDGTFNTFIGQNMPFYASINPV
Ga0007813_103322843300006103FreshwaterMADPAKVNDQNILPVQALFNLDNSFNTFIGQGQPFYATV
Ga0007813_105492813300006103FreshwaterMAVNDSVTQNLLPVQAYFDLQGNFQTFIGQNQPFYA
Ga0007813_108261033300006103FreshwaterMSAPALTSDQNILPVQAYFNLDGSFNTFIGQGHPFV
Ga0007882_1019447813300006104FreshwaterMAGPSSTVDQNLLPVQAYFDVYGNFQTIIGQGQPFYASIN
Ga0007833_106057113300006106FreshwaterMTAPALTSDQNLLPVQAYFDVFGKFQTFIGQGQPFYATVNPS
Ga0007870_107218313300006109FreshwaterMVGPSSTVDQNILPVQAYFNLDGSFNTFIGQGQPF
Ga0007870_110027923300006109FreshwaterMTTPSNSAVQNLLPVQAYFNLDGSFNTFIGQGVPFYATANPVQSGL
Ga0007815_103136913300006114FreshwaterMNAPASTVDQNILPVQAYFDVFGNFQTFLGQGRPF
Ga0007859_101139363300006118FreshwaterMAVPSSTVDQNILPVQAYFNLDGSFNTFIGQGQPFVVSATESI
Ga0007859_101280953300006118FreshwaterMVGPSSTVDQNILPVQAYFNLDGSFNTFIGQGQPFV
Ga0007859_110999113300006118FreshwaterMADPALTQDQNLLPVQAYFNLDGSFNTFIGQGQPFYATANPV
Ga0007837_105888223300006122FreshwaterMAIGPVLTQDQNLLPVQAYFDLQGNFQTFIGQNKPF
Ga0007873_102574033300006124FreshwaterMAGPSSTVDQNILPVQAYFNLDGSFNTFIGQGHPFVVSATE
Ga0007828_100317013300006128FreshwaterMSDPAKTIDQNILPVQALFNLDNTFNTFIGQGQPFYATLNPVQS
Ga0105748_1021281433300007992Estuary WaterMANPPVTSVQNLLPVQAYFDVYGTFQTFIGQGVPFYATTNPSQSG
Ga0114343_107628043300008110Freshwater, PlanktonMTSPAQSTIQNLLPVQAYFDLQDNFVTFIGQNKPF
Ga0114346_104425753300008113Freshwater, PlanktonMSDPAQSIEQNILPVQALFNVDKTFNTFIGQGQPFYAIPNP
Ga0114963_1042309313300009154Freshwater LakeMANPANSVLQNLLPVQAYFAVDGTFQTFIGQGVPFY
Ga0114963_1055424933300009154Freshwater LakeMSDPAKTIDQNILPVQALFNLDNTFQTFIGQGQPF
Ga0114978_1082648523300009159Freshwater LakeMTNPADSSVQNLLPVQAYFNADGSFNTFIGQGQPFYATANPSQSGL
Ga0114981_1003970263300009160Freshwater LakeMTNPADSSVQNLLPVQAYFNADGSFNTFIGQGQPFYATA
Ga0114981_1011545353300009160Freshwater LakeMSDPAKTIDQNILPVQALFNLDNTFNTFIGQGQPFTAAISPNQSGL
Ga0114981_1042701813300009160Freshwater LakeMTSPSNSDVQNLLPVQAYFAVDGTFQTFIGQGQPFYATISPSQSG
Ga0114970_1001757413300009163Freshwater LakeMTSPSNSDVQNLLPVQAYFSVDGAFQTFIGQGQPFY
Ga0114975_1008406753300009164Freshwater LakeMADPATTVDQNILPVQALFNLDNTFNTFIGQGQPFYATLNPSQSGL
Ga0114975_1042510713300009164Freshwater LakeMANPANSVLQNLLPVQAYFSVDGTFQTFIGQGQPFYATVD
Ga0114975_1063458313300009164Freshwater LakeMTDPAKTIDQNILPVQAYFNLDGTFQTFIGQGQPF
Ga0073936_1076982423300009175Freshwater Lake HypolimnionMAGPSSTVDQNLLPVQAYFDVYGNFQTFIGQGQPFYA
Ga0114979_1054599513300009180Freshwater LakeMANPANSDVQNLLPVQALFNLDNTFNTFIGQGQPF
Ga0114974_1042771423300009183Freshwater LakeMADPATTVDQNILPVQALFNLDNTFNTFIGQGQPFYAT
Ga0114976_1038365513300009184Freshwater LakeMANPANSTVQNLLPVQAYFNLDGSFNTFIGQGQPFYAT
Ga0114971_1001213773300009185Freshwater LakeMTSPAQSAVQNLLPVQAYFDAQDNFVTFIGQNKPFYA
Ga0114951_1052459013300009502FreshwaterMTGPSSTVDQNLLPVQAYFDVYGNFQTFIGQGKAFYA
Ga0114964_1024127613300010157Freshwater LakeMANPANSVLQNLLPVQAYFAVDGTFQTFIGQGVPFYATLNPSQS
Ga0157578_108825813300012697FreshwaterMSNPALTTDQNLLPVQAYFNVDGSFNTFIGQGQPFYATANPIQ
Ga0157562_118413063300012701FreshwaterMSNPALTTDQNLLPVQAYFNVDGSFNTFIGQGQPFYATANP
Ga0164296_127872323300013093FreshwaterMATGPALTQDQNLLPVQAYFNLDGSFNTFIGQGQPFYASI
Ga0164296_132034623300013093FreshwaterMAIGPALTQDQNLLPVQAYFNVDGSFNTFIGQGKPFY
Ga0164297_1032792223300013094FreshwaterMAIGPALTQDQNLLPVQAYFNVDGSFNTFIGQGKPFYATTN
Ga0181344_115884213300017754Freshwater LakeMADPAESENQNLLPVQAYFDVDGEFQTFIGQGQPFYATV
Ga0181343_116804713300017766Freshwater LakeMTSPAQSTIQNLLPVQAYFDLQDNFVTFIGQNKPFSATID
Ga0207193_154019213300020048Freshwater Lake SedimentMANPANSLVQNLLPVQAYFSVDGVFQTFIGQGQPFT
Ga0214194_10604043300020686FreshwaterMSSPALTSDQNILPVQAYFNLDGSFNTFIGQGQPF
Ga0214249_101383613300020723FreshwaterMTTPSNSAVQNLLPVQAYFNVDGSFNTFIGQGKPFYAT
Ga0214249_104567023300020723FreshwaterMANINDSVTQNLLPVQAYFNLDGTFNTFIGQNMPFYATI
Ga0214220_100182893300020726FreshwaterMAGPSSTVDQNILPVQALFDVNNNFQTFIGQGQPFTVPISGTI
Ga0214246_100121513300020727FreshwaterMTTPSNSAVQNLLPVQAYFNVDGSFNTFIGQGKPFYATSNP
Ga0214246_1001711103300020727FreshwaterMAGPSSTVDQNLLPVQAYFDVYGNFQTFIGQGQPF
Ga0214170_103896513300020731FreshwaterMAGPSSTVDQNLLPVQAYFDVYGNFQTFIGQGQPFLAT
Ga0214172_101217753300020733FreshwaterMAGPSSTVDQNILPVQALFDVNNNFQTFIGQGQPFTVPIS
Ga0214219_101356413300020735FreshwaterMTSPSNSAVQNLLPVQAYFNADGSFNTFIGQGKPFYATSNPVQSGLT
Ga0194058_1015227733300021071Anoxic Zone FreshwaterMSDPAKTVDQNILPVQALFNLDNSFNTFIGQGQPFSATINPNQSGLH
Ga0214188_11523113300021120FreshwaterMAGPSSTIDQNLLPVQAYFDVYGNFQTFIGQGQPFY
Ga0214173_10057683300021121FreshwaterMSAPALTSDQNILPVQAYFNLDGSFNTFIGQGQPFYATLNPVQSGLT
Ga0214187_102870513300021126FreshwaterMTTPSNSAVQNLLPVQAYFDVFGNFQTFIGQGKSFYATA
Ga0214193_101280113300021127FreshwaterMTTPSNSAVQNLLPVQAYFNVDGSFNTFIGQGKPFYATS
Ga0214206_100977443300021131FreshwaterMGAPNSTVDQNLLPVQAYFDVYGNFQTFIGQGKPFYA
Ga0214165_110361423300021137FreshwaterMANPALTVDQNLLPVQAYFNVDGSFSTFIGQGQPFSVPG
Ga0214164_103279713300021138FreshwaterMSAPALTSDQNILPVQAYFNLDGSFNTFIGQGQPFY
Ga0194059_102696753300021600Anoxic Zone FreshwaterMADPAKTVEQNILPVQALFNLDNTFNTFIGQGQPFYATLNPSQSG
Ga0194059_118568133300021600Anoxic Zone FreshwaterMTDPAKTIDQNILPVQAYFNLDGTFQTFIGQGQPFT
Ga0213921_102138433300021952FreshwaterMTSPAQSSVQNLLPVQAYFDAQDNFVTFIGQNKPFYAT
Ga0222713_1048161913300021962Estuarine WaterMSDPAKTIDQNILPVQALFNLDNTFNTFIGQGQPFSATISPD
Ga0213934_100081113300022156FreshwaterMADPAQSSDQNLLPVQAYFAVDGTFQTFIGQGQPFYATVN
Ga0212088_1056358033300022555Freshwater Lake HypolimnionMAVPSSTVDQNILPVQAYFNLDGSFNTFIGQGQPFV
Ga0212088_1068217413300022555Freshwater Lake HypolimnionMTTPSNSAVQNLLPVQAYFNVDGSFNTFIGQGVPFYA
Ga0228703_107013513300022747FreshwaterMSDPAQTIDQNILPVQALFNLDNTFNTFIGQGQPFTATIS
Ga0256681_1013284013300023311FreshwaterMANPSNSVVQNLLPVQAYFAVDGTFQTFIGQGLPFYATVNP
Ga0256681_1104174723300023311FreshwaterMSSINDSVTQNLLPVQAYFNLDGSFNTFIGQNMPFYATTNPV
Ga0256345_104590113300024552FreshwaterMADPSSVSDQNLLPVQAYFAVDGTFQTFIGQGQPFYATVNP
Ga0255284_107091613300024559FreshwaterMANPAQSNYQNLLPVQAYFALDGTFQTFIGQGQPFY
Ga0208737_100279733300025346FreshwaterMAVNDSVTQNLLPVQAYFDLQGNFQTFIGQNQPFYATVN
Ga0208737_100487833300025346FreshwaterMSAPNLTTDQNLLPVQAYFDVNGNFQTFIGQGQPFYAT
Ga0208108_103129933300025367FreshwaterMPGPALTVDQNILPVQAYFNLDGTFNTFIGQGQPFVITATESI
Ga0208382_103812123300025369FreshwaterMSSINDSVTQNLLPVQAYFNLDGSFNTFIGQNMPF
Ga0207957_100865453300025372FreshwaterMADPAKVNDQNILPVQALFNLDNSFNTFIGQGQPFY
Ga0208259_103956633300025375FreshwaterMTIPATTVDQNILPVQAYFNLDGSFNTFIGQGQPFI
Ga0208738_100626313300025379FreshwaterMNAPASTVDQNILPVQAYFDVFGNFQTFLGQGRPFYATF
Ga0208256_102766933300025382FreshwaterMTTPSNSAVQNLLPVQAYFNVDGSFNTFIGQGKPFYATSNPVQS
Ga0208256_103192733300025382FreshwaterMAGPSSTVDQNLLPVQAYFDVYGNFQTFIGQGQPFY
Ga0207959_101137813300025387FreshwaterMANPANSTVQNLLPVQAYFDVNGNFQTFIGQGKAFTAT
Ga0207959_105037413300025387FreshwaterMSDPAKTIDQNILPVQALFNLDNTFNTFIGQGQPFYATL
Ga0208503_103623713300025388FreshwaterMSAPALTSDQNILPVQAYFNLDGSFNTFIGQGKPFYATL
Ga0208380_100414213300025392FreshwaterMSDPAKTSNQNVLPVQAFFNLDGTFNTLLGQGQPF
Ga0208387_100224273300025400FreshwaterMAGPNDTVNQNILPVQALFNLDNTFNTFIGQGQPFYATINPIQSGLT
Ga0208387_100712813300025400FreshwaterMAGPAKTIDQNILPIQAYFDVYGNFQTFIGQGQAF
Ga0208378_104871733300025407FreshwaterMAGPSSTVDQNLLPVQAYFDVYGNFQTFIGQGQPFYAS
Ga0208616_102067913300025417FreshwaterMAYPAKVNDQNILPVQALFNLDNSFNTFIGQGQPFYATVNPQQ
Ga0207958_101894543300025421FreshwaterMSAPNLTSDQNLLPVQAYFDVFGNFQTFIGQGQPFY
Ga0207958_103462033300025421FreshwaterMAGPSSTVDQNLLPVQAYFDVYGNFQTFIGQGQPFYATLNPV
Ga0208739_106216213300025426FreshwaterMAGPSSTVDQNLLPVQAYFDVYGNFQTFIGQGQPFYASVNPIQ
Ga0208622_108781013300025430FreshwaterMSAPALTSDQNILPVQAYFNLDGSFNTFIGQGHPF
Ga0208744_102967143300025450FreshwaterMSDPAKTIDQNILPVQALFNLDNTFNTFIGQGQPFY
Ga0208376_101156163300025455FreshwaterMAGPSSTVDQNLLPVQAYFDVYGNFQTFIGQGQPFFATFNPN
Ga0208260_100945813300025467FreshwaterMTSPSNSAIQNLLPVQAYFNLDGSFNTFIGQGKPFYATAN
Ga0208507_110450533300025648FreshwaterMADPAKVNDQNILPVQALFNLDNSFNTFIGQGQPFYATVNPQQSGL
Ga0209188_104543253300027708Freshwater LakeMANPANSVIQNLLPVQAYFTVDGTFQTFIGQGQPFYAS
Ga0209087_131346233300027734Freshwater LakeMANPANSTVQNLLPVQAYFNLDGSFNTFIGQGQPFYATA
Ga0209189_104213813300027747Freshwater LakeMSDPAKTIDQNILPVQALFNLDNTFQTFIGQGQPFTATI
Ga0209189_122204613300027747Freshwater LakeMANPANSVIQNLLPVQAYFTVDGTFQTFIGQGLPFYASVNPS
Ga0209134_1030270623300027764Freshwater LakeMADPAKTVDQNILPVQALFNLDNTFNTFIGQGQPFI
Ga0209829_1024308133300027777Freshwater LakeMTNPSNSAVQNLLPVQAYFNLDGSFNTFVGQGTPFYATANPVQSGL
Ga0209777_1023188613300027896Freshwater Lake SedimentMGAPNKTVDQNLLPVQAYFDVYGNFQTFIGQGKPFLATISP
Ga0209777_1098152413300027896Freshwater Lake SedimentMSSINDSVTQNLLPVQAYFNLDGSFNTFIGQNMPFYATTNPVQS
Ga0209048_1036174343300027902Freshwater Lake SedimentMADPAKVLDQNLLPVQAYFAVDGTFQTFIGQGQPFYATVNPYQSG
Ga0209536_10285298523300027917Marine SedimentMSDPAEASVQNLLPVQAYFGLDGSFQTFIGQGQPFYAT
Ga0247723_108348413300028025Deep Subsurface SedimentMADPATTVDQNILPVQALFNLDNTFNTFIGQGQPFFATLNPSQSGLN
Ga0304729_114510313300028392Freshwater LakeMADPAKTVEQNILPVQALFNLDNTFNTFIGQGQPFYATLNPS
Ga0304730_129923213300028394Freshwater LakeMADPASTVDQNLLPVQAYFNLDGSFSTFIGQSQPFYATT
Ga0316217_1006022153300031813FreshwaterMTTPSNSAVQNLLPVQAYFNVDGSFNTFIGQGKPFYA
Ga0316220_115091213300031884FreshwaterMTSPSNSAIQNLLPVQAYFNLDGSFNTFIGQGKPFYATTNPVQS
Ga0316218_123161913300032117FreshwaterMAGPSSTVDQNLLPVQAYFDVYGNFQTFIGQGQPFYAKVNPIQ
Ga0316222_110365343300032561FreshwaterMAGPSSTVDQNLLPVQAYFDVYGNFQTFIGQGQPFYASINP
Ga0316222_131897813300032561FreshwaterMSDPAKTIDQNILPVQALFNLDNSFNTFIGQGQPFYATV
Ga0316232_121606433300032605FreshwaterMANPSLTVDQNLLPVQAYFNLDGSFNTFIGQNQPFYA
Ga0316221_100479013300032665FreshwaterMTSPSNSAVQNLLPVQAYFNLDGTFNTFIGQGKPFYATANP
Ga0316221_102170513300032665FreshwaterMAGPSSTVDQNLLPVQAYFDVYGNFQTFIGQGQPFFA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.