| Basic Information | |
|---|---|
| Family ID | F057885 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 135 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MANPANSTVQNLLPVQAYFNLDGSFNTFIGQGQPFYAT |
| Number of Associated Samples | 108 |
| Number of Associated Scaffolds | 135 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 79.26 % |
| % of genes near scaffold ends (potentially truncated) | 99.26 % |
| % of genes from short scaffolds (< 2000 bps) | 82.96 % |
| Associated GOLD sequencing projects | 100 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.26 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (48.148 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater (35.556 % of family members) |
| Environment Ontology (ENVO) | Unclassified (77.778 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (85.926 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 15.15% Coil/Unstructured: 84.85% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.26 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 135 Family Scaffolds |
|---|---|---|
| PF11651 | P22_CoatProtein | 19.26 |
| PF16510 | P22_portal | 0.74 |
| PF07969 | Amidohydro_3 | 0.74 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 62.96 % |
| Unclassified | root | N/A | 37.04 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000268|M3P_10205814 | Not Available | 577 | Open in IMG/M |
| 3300000439|TBL_comb48_EPIDRAFT_1071834 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1093 | Open in IMG/M |
| 3300000553|TBL_comb47_HYPODRAFT_10101278 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1417 | Open in IMG/M |
| 3300001838|RCM33_1072038 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 591 | Open in IMG/M |
| 3300001850|RCM37_1127621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 867 | Open in IMG/M |
| 3300002307|JGI24890J29729_1006620 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3500 | Open in IMG/M |
| 3300003813|Ga0007879_1003350 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2431 | Open in IMG/M |
| 3300003827|Ga0007880_1003753 | All Organisms → cellular organisms → Bacteria | 1810 | Open in IMG/M |
| 3300003852|Ga0031655_10125106 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1016 | Open in IMG/M |
| 3300003852|Ga0031655_10373377 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 530 | Open in IMG/M |
| 3300004461|Ga0066223_1115168 | Not Available | 621 | Open in IMG/M |
| 3300004687|Ga0065174_1087911 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 579 | Open in IMG/M |
| 3300004694|Ga0065170_1028401 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 748 | Open in IMG/M |
| 3300004774|Ga0007794_10219105 | Not Available | 566 | Open in IMG/M |
| 3300004777|Ga0007827_10109083 | Not Available | 621 | Open in IMG/M |
| 3300006072|Ga0007881_1136323 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 602 | Open in IMG/M |
| 3300006100|Ga0007806_1032930 | Not Available | 1034 | Open in IMG/M |
| 3300006103|Ga0007813_1020604 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1553 | Open in IMG/M |
| 3300006103|Ga0007813_1033228 | Not Available | 1134 | Open in IMG/M |
| 3300006103|Ga0007813_1054928 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 816 | Open in IMG/M |
| 3300006103|Ga0007813_1082610 | Not Available | 628 | Open in IMG/M |
| 3300006104|Ga0007882_10194478 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 693 | Open in IMG/M |
| 3300006106|Ga0007833_1060571 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 686 | Open in IMG/M |
| 3300006109|Ga0007870_1072183 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 669 | Open in IMG/M |
| 3300006109|Ga0007870_1100279 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 565 | Open in IMG/M |
| 3300006114|Ga0007815_1031369 | Not Available | 1178 | Open in IMG/M |
| 3300006118|Ga0007859_1011393 | All Organisms → cellular organisms → Bacteria | 2026 | Open in IMG/M |
| 3300006118|Ga0007859_1012809 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1898 | Open in IMG/M |
| 3300006118|Ga0007859_1109991 | Not Available | 546 | Open in IMG/M |
| 3300006122|Ga0007837_1058882 | Not Available | 650 | Open in IMG/M |
| 3300006124|Ga0007873_1025740 | Not Available | 980 | Open in IMG/M |
| 3300006128|Ga0007828_1003170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3642 | Open in IMG/M |
| 3300007992|Ga0105748_10212814 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 806 | Open in IMG/M |
| 3300008110|Ga0114343_1076280 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1216 | Open in IMG/M |
| 3300008113|Ga0114346_1044257 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2256 | Open in IMG/M |
| 3300009154|Ga0114963_10423093 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 719 | Open in IMG/M |
| 3300009154|Ga0114963_10554249 | Not Available | 606 | Open in IMG/M |
| 3300009159|Ga0114978_10826485 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
| 3300009160|Ga0114981_10039702 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2666 | Open in IMG/M |
| 3300009160|Ga0114981_10115453 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1487 | Open in IMG/M |
| 3300009160|Ga0114981_10427018 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 712 | Open in IMG/M |
| 3300009163|Ga0114970_10017574 | All Organisms → Viruses → Predicted Viral | 4880 | Open in IMG/M |
| 3300009164|Ga0114975_10084067 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1850 | Open in IMG/M |
| 3300009164|Ga0114975_10425107 | Not Available | 722 | Open in IMG/M |
| 3300009164|Ga0114975_10634583 | Not Available | 568 | Open in IMG/M |
| 3300009175|Ga0073936_10769824 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 525 | Open in IMG/M |
| 3300009180|Ga0114979_10545995 | Not Available | 666 | Open in IMG/M |
| 3300009183|Ga0114974_10427714 | Not Available | 754 | Open in IMG/M |
| 3300009184|Ga0114976_10383655 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 738 | Open in IMG/M |
| 3300009185|Ga0114971_10012137 | Not Available | 5684 | Open in IMG/M |
| 3300009502|Ga0114951_10524590 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 575 | Open in IMG/M |
| 3300010157|Ga0114964_10241276 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 862 | Open in IMG/M |
| 3300012697|Ga0157578_1088258 | Not Available | 902 | Open in IMG/M |
| 3300012701|Ga0157562_1184130 | Not Available | 3649 | Open in IMG/M |
| 3300013093|Ga0164296_1278723 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 629 | Open in IMG/M |
| 3300013093|Ga0164296_1320346 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 579 | Open in IMG/M |
| 3300013094|Ga0164297_10327922 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 584 | Open in IMG/M |
| 3300017754|Ga0181344_1158842 | Not Available | 644 | Open in IMG/M |
| 3300017766|Ga0181343_1168047 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 607 | Open in IMG/M |
| 3300020048|Ga0207193_1540192 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 774 | Open in IMG/M |
| 3300020686|Ga0214194_106040 | Not Available | 1124 | Open in IMG/M |
| 3300020723|Ga0214249_1013836 | Not Available | 1517 | Open in IMG/M |
| 3300020723|Ga0214249_1045670 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 621 | Open in IMG/M |
| 3300020726|Ga0214220_1001828 | Not Available | 4962 | Open in IMG/M |
| 3300020727|Ga0214246_1001215 | Not Available | 6346 | Open in IMG/M |
| 3300020727|Ga0214246_1001711 | Not Available | 5235 | Open in IMG/M |
| 3300020731|Ga0214170_1038965 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 730 | Open in IMG/M |
| 3300020733|Ga0214172_1012177 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1584 | Open in IMG/M |
| 3300020735|Ga0214219_1013564 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1483 | Open in IMG/M |
| 3300021071|Ga0194058_10152277 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 764 | Open in IMG/M |
| 3300021120|Ga0214188_115231 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 700 | Open in IMG/M |
| 3300021121|Ga0214173_100576 | Not Available | 5433 | Open in IMG/M |
| 3300021126|Ga0214187_1028705 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 596 | Open in IMG/M |
| 3300021127|Ga0214193_1012801 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1100 | Open in IMG/M |
| 3300021131|Ga0214206_1009774 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1393 | Open in IMG/M |
| 3300021137|Ga0214165_1103614 | Not Available | 542 | Open in IMG/M |
| 3300021138|Ga0214164_1032797 | Not Available | 1281 | Open in IMG/M |
| 3300021600|Ga0194059_1026967 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1972 | Open in IMG/M |
| 3300021600|Ga0194059_1185681 | Not Available | 629 | Open in IMG/M |
| 3300021952|Ga0213921_1021384 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1086 | Open in IMG/M |
| 3300021962|Ga0222713_10481619 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 746 | Open in IMG/M |
| 3300022156|Ga0213934_1000811 | All Organisms → cellular organisms → Bacteria | 3583 | Open in IMG/M |
| 3300022555|Ga0212088_10563580 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 713 | Open in IMG/M |
| 3300022555|Ga0212088_10682174 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 615 | Open in IMG/M |
| 3300022747|Ga0228703_1070135 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 882 | Open in IMG/M |
| 3300023311|Ga0256681_10132840 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 882 | Open in IMG/M |
| 3300023311|Ga0256681_11041747 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 583 | Open in IMG/M |
| 3300024552|Ga0256345_1045901 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 856 | Open in IMG/M |
| 3300024559|Ga0255284_1070916 | Not Available | 741 | Open in IMG/M |
| 3300025346|Ga0208737_1002797 | Not Available | 936 | Open in IMG/M |
| 3300025346|Ga0208737_1004878 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 708 | Open in IMG/M |
| 3300025367|Ga0208108_1031299 | Not Available | 579 | Open in IMG/M |
| 3300025369|Ga0208382_1038121 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 575 | Open in IMG/M |
| 3300025372|Ga0207957_1008654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1457 | Open in IMG/M |
| 3300025375|Ga0208259_1039566 | Not Available | 660 | Open in IMG/M |
| 3300025379|Ga0208738_1006263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 2172 | Open in IMG/M |
| 3300025382|Ga0208256_1027669 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 825 | Open in IMG/M |
| 3300025382|Ga0208256_1031927 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 755 | Open in IMG/M |
| 3300025387|Ga0207959_1011378 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1576 | Open in IMG/M |
| 3300025387|Ga0207959_1050374 | Not Available | 628 | Open in IMG/M |
| 3300025388|Ga0208503_1036237 | Not Available | 550 | Open in IMG/M |
| 3300025392|Ga0208380_1004142 | Not Available | 2880 | Open in IMG/M |
| 3300025400|Ga0208387_1002242 | All Organisms → Viruses → Predicted Viral | 4636 | Open in IMG/M |
| 3300025400|Ga0208387_1007128 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2329 | Open in IMG/M |
| 3300025407|Ga0208378_1048717 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 688 | Open in IMG/M |
| 3300025417|Ga0208616_1020679 | Not Available | 1031 | Open in IMG/M |
| 3300025421|Ga0207958_1018945 | Not Available | 1151 | Open in IMG/M |
| 3300025421|Ga0207958_1034620 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 774 | Open in IMG/M |
| 3300025426|Ga0208739_1062162 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 594 | Open in IMG/M |
| 3300025430|Ga0208622_1087810 | Not Available | 509 | Open in IMG/M |
| 3300025450|Ga0208744_1029671 | Not Available | 1138 | Open in IMG/M |
| 3300025455|Ga0208376_1011561 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2027 | Open in IMG/M |
| 3300025467|Ga0208260_1009458 | Not Available | 2229 | Open in IMG/M |
| 3300025648|Ga0208507_1104505 | Not Available | 832 | Open in IMG/M |
| 3300027708|Ga0209188_1045432 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1983 | Open in IMG/M |
| 3300027734|Ga0209087_1313462 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 554 | Open in IMG/M |
| 3300027747|Ga0209189_1042138 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2266 | Open in IMG/M |
| 3300027747|Ga0209189_1222046 | Not Available | 768 | Open in IMG/M |
| 3300027764|Ga0209134_10302706 | Not Available | 543 | Open in IMG/M |
| 3300027777|Ga0209829_10243081 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 761 | Open in IMG/M |
| 3300027896|Ga0209777_10231886 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1463 | Open in IMG/M |
| 3300027896|Ga0209777_10981524 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 579 | Open in IMG/M |
| 3300027902|Ga0209048_10361743 | Not Available | 1003 | Open in IMG/M |
| 3300027917|Ga0209536_102852985 | Not Available | 561 | Open in IMG/M |
| 3300028025|Ga0247723_1083484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 836 | Open in IMG/M |
| 3300028392|Ga0304729_1145103 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 769 | Open in IMG/M |
| 3300028394|Ga0304730_1299232 | Not Available | 555 | Open in IMG/M |
| 3300031813|Ga0316217_10060221 | Not Available | 1937 | Open in IMG/M |
| 3300031884|Ga0316220_1150912 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 837 | Open in IMG/M |
| 3300032117|Ga0316218_1231619 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 648 | Open in IMG/M |
| 3300032561|Ga0316222_1103653 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1130 | Open in IMG/M |
| 3300032561|Ga0316222_1318978 | Not Available | 504 | Open in IMG/M |
| 3300032605|Ga0316232_1216064 | Not Available | 761 | Open in IMG/M |
| 3300032665|Ga0316221_1004790 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9999 | Open in IMG/M |
| 3300032665|Ga0316221_1021705 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3084 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 35.56% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 16.30% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 11.85% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 7.41% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 3.70% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.70% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 2.22% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 2.22% |
| Freshwater Lake Hypolimnion | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion | 2.22% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.22% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 2.22% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.48% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 1.48% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.48% |
| Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 0.74% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.74% |
| Lotic | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Lotic | 0.74% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.74% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.74% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.74% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.74% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.74% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000268 | Lotic microbial communities from Mississippi River at two locations in the state of Minnesota, sample from River Site 1, Mississippi Headwaters ver2 | Environmental | Open in IMG/M |
| 3300000439 | Trout Bog Lake June 7 2007 Epilimnion (Trout Bog Lake Combined Assembly 48 Epilimnion Samples, Aug 2012 Assem) | Environmental | Open in IMG/M |
| 3300000553 | Trout Bog Lake May 28 2007 Hypolimnion (Trout Bog Lake Combined Assembly 47 Hypolimnion Samples, Aug 2012 Assem) | Environmental | Open in IMG/M |
| 3300001838 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM33, ROCA_DNA217_0.2um_bLM_C_2a | Environmental | Open in IMG/M |
| 3300001850 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM37, ROCA_DNA234_0.2um_Ob_C_2a | Environmental | Open in IMG/M |
| 3300002307 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-C2 co-culture F-D7 | Environmental | Open in IMG/M |
| 3300003813 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH15Jun09 | Environmental | Open in IMG/M |
| 3300003827 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH29Jun09 | Environmental | Open in IMG/M |
| 3300003852 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB | Environmental | Open in IMG/M |
| 3300004461 | Marine viral communities from Newfoundland, Canada BC-2 | Environmental | Open in IMG/M |
| 3300004687 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Jul08 (version 2) | Environmental | Open in IMG/M |
| 3300004694 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE17Sep08 (version 2) | Environmental | Open in IMG/M |
| 3300004774 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA5M | Environmental | Open in IMG/M |
| 3300004777 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Jul07 | Environmental | Open in IMG/M |
| 3300006072 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09 | Environmental | Open in IMG/M |
| 3300006100 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 | Environmental | Open in IMG/M |
| 3300006103 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Jun09 | Environmental | Open in IMG/M |
| 3300006104 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09.1 | Environmental | Open in IMG/M |
| 3300006106 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Jul07 | Environmental | Open in IMG/M |
| 3300006109 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH04Jul08 | Environmental | Open in IMG/M |
| 3300006114 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug09 | Environmental | Open in IMG/M |
| 3300006118 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul07 | Environmental | Open in IMG/M |
| 3300006122 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE31Jul07 | Environmental | Open in IMG/M |
| 3300006124 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH26May08 | Environmental | Open in IMG/M |
| 3300006128 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Oct07 | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009175 | Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
| 3300009502 | Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300012697 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES082 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012701 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES061 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013093 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES057 metaG | Environmental | Open in IMG/M |
| 3300013094 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES058 metaG | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020686 | Freshwater microbial communities from Trout Bog Lake, WI - 12AUG2008 epilimnion | Environmental | Open in IMG/M |
| 3300020723 | Freshwater microbial communities from Trout Bog Lake, WI - 23JUN2009 hypolimnion | Environmental | Open in IMG/M |
| 3300020726 | Freshwater microbial communities from Trout Bog Lake, WI - 31JUL2007 hypolimnion | Environmental | Open in IMG/M |
| 3300020727 | Freshwater microbial communities from Trout Bog Lake, WI - 29MAY2009 hypolimnion | Environmental | Open in IMG/M |
| 3300020731 | Freshwater microbial communities from Trout Bog Lake, WI - 27JUN2007 epilimnion | Environmental | Open in IMG/M |
| 3300020733 | Freshwater microbial communities from Trout Bog Lake, WI - 12JUL2007 epilimnion | Environmental | Open in IMG/M |
| 3300020735 | Freshwater microbial communities from Trout Bog Lake, WI - 25JUL2007 hypolimnion | Environmental | Open in IMG/M |
| 3300021071 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L442-17m | Environmental | Open in IMG/M |
| 3300021120 | Freshwater microbial communities from Trout Bog Lake, WI - 01JUL2008 epilimnion | Environmental | Open in IMG/M |
| 3300021121 | Freshwater microbial communities from Trout Bog Lake, WI - 25JUL2007 epilimnion | Environmental | Open in IMG/M |
| 3300021126 | Freshwater microbial communities from Trout Bog Lake, WI - 24JUN2008 epilimnion | Environmental | Open in IMG/M |
| 3300021127 | Freshwater microbial communities from Trout Bog Lake, WI - 05AUG2008 epilimnion | Environmental | Open in IMG/M |
| 3300021131 | Freshwater microbial communities from Trout Bog Lake, WI - 07JUL2009 epilimnion | Environmental | Open in IMG/M |
| 3300021137 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 hypolimnion | Environmental | Open in IMG/M |
| 3300021138 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnion | Environmental | Open in IMG/M |
| 3300021600 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L626-11m | Environmental | Open in IMG/M |
| 3300021952 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17 MG | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022156 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022555 | Alinen_combined assembly | Environmental | Open in IMG/M |
| 3300022747 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MG | Environmental | Open in IMG/M |
| 3300023311 | Combined Assembly of Gp0281739, Gp0281740, Gp0281741 | Environmental | Open in IMG/M |
| 3300024552 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024559 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025346 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE06Aug07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025367 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE22May08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025369 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE28Sep08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025372 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jun07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025375 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH22May08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025379 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE21Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025382 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH22Jun08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025387 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH20Aug07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025388 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE31Jul07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025392 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jun07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025400 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025407 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE24Aug09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025417 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Oct07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025421 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025426 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025430 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025450 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025455 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA2.5M (SPAdes) | Environmental | Open in IMG/M |
| 3300025467 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Aug09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025648 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027747 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027777 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
| 3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028392 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300031813 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - 1anoA | Environmental | Open in IMG/M |
| 3300031884 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18005 | Environmental | Open in IMG/M |
| 3300032117 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18003 | Environmental | Open in IMG/M |
| 3300032561 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18011 | Environmental | Open in IMG/M |
| 3300032605 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18025_13 | Environmental | Open in IMG/M |
| 3300032665 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18007 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| M3P_102058142 | 3300000268 | Lotic | MTNPADSSVQNLLPVQAYFNADGSFNTFIGQGQPFYATAN |
| TBL_comb48_EPIDRAFT_10718344 | 3300000439 | Freshwater | MASPANSIVQNLLPVQAYFNVDKSFNTFIGQGIPFYATTN |
| TBL_comb47_HYPODRAFT_101012781 | 3300000553 | Freshwater | MTTPSNSAVQNLLPVQAYFNVDGSFNTFIGQGKPFYATSN |
| RCM33_10720382 | 3300001838 | Marine Plankton | MANTANSTVQNLLPVQAYFDTSGNFQTFIGQGEPFY |
| RCM37_11276211 | 3300001850 | Marine Plankton | MANPAQTNYQNLLPVRAYFALDGTFQTFIGQGQPFY |
| JGI24890J29729_10066207 | 3300002307 | Lentic | MTNPSNSAVQNLLPVQAYFNVDGSFNTFIGQGLPFYATANP |
| Ga0007879_10033505 | 3300003813 | Freshwater | MAGPAKTIDQNILPVQAYFDVYGNFQTFIGQGQAFTVPINP |
| Ga0007880_10037531 | 3300003827 | Freshwater | MSAPALTSDQNILPVQAYFNLDGSFNTFIGQGHPFVVSATESI |
| Ga0031655_101251062 | 3300003852 | Freshwater Lake Sediment | MGAPNSTVDQNLLPVQAYFDVYGNFQTFIGQNKAFYATMHN* |
| Ga0031655_103733772 | 3300003852 | Freshwater Lake Sediment | MSSINDSVTQNLLPVQAYFNLDGSFNTFIGQNMPFYATTNPVQSG |
| Ga0066223_11151683 | 3300004461 | Marine | MTGPNLTVDQNLLPVQAYFSVDGTFQTFIGQGQPFTATIN |
| Ga0065174_10879111 | 3300004687 | Freshwater | MATGPALTQDQNILPVQAYFNLDGTFNTFIGQGVPFTVPV |
| Ga0065170_10284011 | 3300004694 | Freshwater | MANINDSVTQNLLPVQAYFNLDGTFNTFIGQNMPFYATINP |
| Ga0007794_102191052 | 3300004774 | Freshwater | MADPAKTVDQNILPVQALFNLDNSFNTFIGQNQPFYATVNPLQSGLT |
| Ga0007827_101090831 | 3300004777 | Freshwater | MSAPNLTSDQNLLPVQAYFNLDGSFNTFIGQGQPFYATLN |
| Ga0007881_11363232 | 3300006072 | Freshwater | MANINDSVTQNLLPVQAYFNLDGTFNTFIGQNMPFYA |
| Ga0007806_10329304 | 3300006100 | Freshwater | MNAPASTVDQNILPVQAYFDVFGNFQTFLGQGRPFYATFNPVQ |
| Ga0007813_10206041 | 3300006103 | Freshwater | MAGINDSVTQNLLPVQAYFNLDGTFNTFIGQNMPFYASINPV |
| Ga0007813_10332284 | 3300006103 | Freshwater | MADPAKVNDQNILPVQALFNLDNSFNTFIGQGQPFYATV |
| Ga0007813_10549281 | 3300006103 | Freshwater | MAVNDSVTQNLLPVQAYFDLQGNFQTFIGQNQPFYA |
| Ga0007813_10826103 | 3300006103 | Freshwater | MSAPALTSDQNILPVQAYFNLDGSFNTFIGQGHPFV |
| Ga0007882_101944781 | 3300006104 | Freshwater | MAGPSSTVDQNLLPVQAYFDVYGNFQTIIGQGQPFYASIN |
| Ga0007833_10605711 | 3300006106 | Freshwater | MTAPALTSDQNLLPVQAYFDVFGKFQTFIGQGQPFYATVNPS |
| Ga0007870_10721831 | 3300006109 | Freshwater | MVGPSSTVDQNILPVQAYFNLDGSFNTFIGQGQPF |
| Ga0007870_11002792 | 3300006109 | Freshwater | MTTPSNSAVQNLLPVQAYFNLDGSFNTFIGQGVPFYATANPVQSGL |
| Ga0007815_10313691 | 3300006114 | Freshwater | MNAPASTVDQNILPVQAYFDVFGNFQTFLGQGRPF |
| Ga0007859_10113936 | 3300006118 | Freshwater | MAVPSSTVDQNILPVQAYFNLDGSFNTFIGQGQPFVVSATESI |
| Ga0007859_10128095 | 3300006118 | Freshwater | MVGPSSTVDQNILPVQAYFNLDGSFNTFIGQGQPFV |
| Ga0007859_11099911 | 3300006118 | Freshwater | MADPALTQDQNLLPVQAYFNLDGSFNTFIGQGQPFYATANPV |
| Ga0007837_10588822 | 3300006122 | Freshwater | MAIGPVLTQDQNLLPVQAYFDLQGNFQTFIGQNKPF |
| Ga0007873_10257403 | 3300006124 | Freshwater | MAGPSSTVDQNILPVQAYFNLDGSFNTFIGQGHPFVVSATE |
| Ga0007828_10031701 | 3300006128 | Freshwater | MSDPAKTIDQNILPVQALFNLDNTFNTFIGQGQPFYATLNPVQS |
| Ga0105748_102128143 | 3300007992 | Estuary Water | MANPPVTSVQNLLPVQAYFDVYGTFQTFIGQGVPFYATTNPSQSG |
| Ga0114343_10762804 | 3300008110 | Freshwater, Plankton | MTSPAQSTIQNLLPVQAYFDLQDNFVTFIGQNKPF |
| Ga0114346_10442575 | 3300008113 | Freshwater, Plankton | MSDPAQSIEQNILPVQALFNVDKTFNTFIGQGQPFYAIPNP |
| Ga0114963_104230931 | 3300009154 | Freshwater Lake | MANPANSVLQNLLPVQAYFAVDGTFQTFIGQGVPFY |
| Ga0114963_105542493 | 3300009154 | Freshwater Lake | MSDPAKTIDQNILPVQALFNLDNTFQTFIGQGQPF |
| Ga0114978_108264852 | 3300009159 | Freshwater Lake | MTNPADSSVQNLLPVQAYFNADGSFNTFIGQGQPFYATANPSQSGL |
| Ga0114981_100397026 | 3300009160 | Freshwater Lake | MTNPADSSVQNLLPVQAYFNADGSFNTFIGQGQPFYATA |
| Ga0114981_101154535 | 3300009160 | Freshwater Lake | MSDPAKTIDQNILPVQALFNLDNTFNTFIGQGQPFTAAISPNQSGL |
| Ga0114981_104270181 | 3300009160 | Freshwater Lake | MTSPSNSDVQNLLPVQAYFAVDGTFQTFIGQGQPFYATISPSQSG |
| Ga0114970_100175741 | 3300009163 | Freshwater Lake | MTSPSNSDVQNLLPVQAYFSVDGAFQTFIGQGQPFY |
| Ga0114975_100840675 | 3300009164 | Freshwater Lake | MADPATTVDQNILPVQALFNLDNTFNTFIGQGQPFYATLNPSQSGL |
| Ga0114975_104251071 | 3300009164 | Freshwater Lake | MANPANSVLQNLLPVQAYFSVDGTFQTFIGQGQPFYATVD |
| Ga0114975_106345831 | 3300009164 | Freshwater Lake | MTDPAKTIDQNILPVQAYFNLDGTFQTFIGQGQPF |
| Ga0073936_107698242 | 3300009175 | Freshwater Lake Hypolimnion | MAGPSSTVDQNLLPVQAYFDVYGNFQTFIGQGQPFYA |
| Ga0114979_105459951 | 3300009180 | Freshwater Lake | MANPANSDVQNLLPVQALFNLDNTFNTFIGQGQPF |
| Ga0114974_104277142 | 3300009183 | Freshwater Lake | MADPATTVDQNILPVQALFNLDNTFNTFIGQGQPFYAT |
| Ga0114976_103836551 | 3300009184 | Freshwater Lake | MANPANSTVQNLLPVQAYFNLDGSFNTFIGQGQPFYAT |
| Ga0114971_100121377 | 3300009185 | Freshwater Lake | MTSPAQSAVQNLLPVQAYFDAQDNFVTFIGQNKPFYA |
| Ga0114951_105245901 | 3300009502 | Freshwater | MTGPSSTVDQNLLPVQAYFDVYGNFQTFIGQGKAFYA |
| Ga0114964_102412761 | 3300010157 | Freshwater Lake | MANPANSVLQNLLPVQAYFAVDGTFQTFIGQGVPFYATLNPSQS |
| Ga0157578_10882581 | 3300012697 | Freshwater | MSNPALTTDQNLLPVQAYFNVDGSFNTFIGQGQPFYATANPIQ |
| Ga0157562_11841306 | 3300012701 | Freshwater | MSNPALTTDQNLLPVQAYFNVDGSFNTFIGQGQPFYATANP |
| Ga0164296_12787232 | 3300013093 | Freshwater | MATGPALTQDQNLLPVQAYFNLDGSFNTFIGQGQPFYASI |
| Ga0164296_13203462 | 3300013093 | Freshwater | MAIGPALTQDQNLLPVQAYFNVDGSFNTFIGQGKPFY |
| Ga0164297_103279222 | 3300013094 | Freshwater | MAIGPALTQDQNLLPVQAYFNVDGSFNTFIGQGKPFYATTN |
| Ga0181344_11588421 | 3300017754 | Freshwater Lake | MADPAESENQNLLPVQAYFDVDGEFQTFIGQGQPFYATV |
| Ga0181343_11680471 | 3300017766 | Freshwater Lake | MTSPAQSTIQNLLPVQAYFDLQDNFVTFIGQNKPFSATID |
| Ga0207193_15401921 | 3300020048 | Freshwater Lake Sediment | MANPANSLVQNLLPVQAYFSVDGVFQTFIGQGQPFT |
| Ga0214194_1060404 | 3300020686 | Freshwater | MSSPALTSDQNILPVQAYFNLDGSFNTFIGQGQPF |
| Ga0214249_10138361 | 3300020723 | Freshwater | MTTPSNSAVQNLLPVQAYFNVDGSFNTFIGQGKPFYAT |
| Ga0214249_10456702 | 3300020723 | Freshwater | MANINDSVTQNLLPVQAYFNLDGTFNTFIGQNMPFYATI |
| Ga0214220_10018289 | 3300020726 | Freshwater | MAGPSSTVDQNILPVQALFDVNNNFQTFIGQGQPFTVPISGTI |
| Ga0214246_10012151 | 3300020727 | Freshwater | MTTPSNSAVQNLLPVQAYFNVDGSFNTFIGQGKPFYATSNP |
| Ga0214246_100171110 | 3300020727 | Freshwater | MAGPSSTVDQNLLPVQAYFDVYGNFQTFIGQGQPF |
| Ga0214170_10389651 | 3300020731 | Freshwater | MAGPSSTVDQNLLPVQAYFDVYGNFQTFIGQGQPFLAT |
| Ga0214172_10121775 | 3300020733 | Freshwater | MAGPSSTVDQNILPVQALFDVNNNFQTFIGQGQPFTVPIS |
| Ga0214219_10135641 | 3300020735 | Freshwater | MTSPSNSAVQNLLPVQAYFNADGSFNTFIGQGKPFYATSNPVQSGLT |
| Ga0194058_101522773 | 3300021071 | Anoxic Zone Freshwater | MSDPAKTVDQNILPVQALFNLDNSFNTFIGQGQPFSATINPNQSGLH |
| Ga0214188_1152311 | 3300021120 | Freshwater | MAGPSSTIDQNLLPVQAYFDVYGNFQTFIGQGQPFY |
| Ga0214173_1005768 | 3300021121 | Freshwater | MSAPALTSDQNILPVQAYFNLDGSFNTFIGQGQPFYATLNPVQSGLT |
| Ga0214187_10287051 | 3300021126 | Freshwater | MTTPSNSAVQNLLPVQAYFDVFGNFQTFIGQGKSFYATA |
| Ga0214193_10128011 | 3300021127 | Freshwater | MTTPSNSAVQNLLPVQAYFNVDGSFNTFIGQGKPFYATS |
| Ga0214206_10097744 | 3300021131 | Freshwater | MGAPNSTVDQNLLPVQAYFDVYGNFQTFIGQGKPFYA |
| Ga0214165_11036142 | 3300021137 | Freshwater | MANPALTVDQNLLPVQAYFNVDGSFSTFIGQGQPFSVPG |
| Ga0214164_10327971 | 3300021138 | Freshwater | MSAPALTSDQNILPVQAYFNLDGSFNTFIGQGQPFY |
| Ga0194059_10269675 | 3300021600 | Anoxic Zone Freshwater | MADPAKTVEQNILPVQALFNLDNTFNTFIGQGQPFYATLNPSQSG |
| Ga0194059_11856813 | 3300021600 | Anoxic Zone Freshwater | MTDPAKTIDQNILPVQAYFNLDGTFQTFIGQGQPFT |
| Ga0213921_10213843 | 3300021952 | Freshwater | MTSPAQSSVQNLLPVQAYFDAQDNFVTFIGQNKPFYAT |
| Ga0222713_104816191 | 3300021962 | Estuarine Water | MSDPAKTIDQNILPVQALFNLDNTFNTFIGQGQPFSATISPD |
| Ga0213934_10008111 | 3300022156 | Freshwater | MADPAQSSDQNLLPVQAYFAVDGTFQTFIGQGQPFYATVN |
| Ga0212088_105635803 | 3300022555 | Freshwater Lake Hypolimnion | MAVPSSTVDQNILPVQAYFNLDGSFNTFIGQGQPFV |
| Ga0212088_106821741 | 3300022555 | Freshwater Lake Hypolimnion | MTTPSNSAVQNLLPVQAYFNVDGSFNTFIGQGVPFYA |
| Ga0228703_10701351 | 3300022747 | Freshwater | MSDPAQTIDQNILPVQALFNLDNTFNTFIGQGQPFTATIS |
| Ga0256681_101328401 | 3300023311 | Freshwater | MANPSNSVVQNLLPVQAYFAVDGTFQTFIGQGLPFYATVNP |
| Ga0256681_110417472 | 3300023311 | Freshwater | MSSINDSVTQNLLPVQAYFNLDGSFNTFIGQNMPFYATTNPV |
| Ga0256345_10459011 | 3300024552 | Freshwater | MADPSSVSDQNLLPVQAYFAVDGTFQTFIGQGQPFYATVNP |
| Ga0255284_10709161 | 3300024559 | Freshwater | MANPAQSNYQNLLPVQAYFALDGTFQTFIGQGQPFY |
| Ga0208737_10027973 | 3300025346 | Freshwater | MAVNDSVTQNLLPVQAYFDLQGNFQTFIGQNQPFYATVN |
| Ga0208737_10048783 | 3300025346 | Freshwater | MSAPNLTTDQNLLPVQAYFDVNGNFQTFIGQGQPFYAT |
| Ga0208108_10312993 | 3300025367 | Freshwater | MPGPALTVDQNILPVQAYFNLDGTFNTFIGQGQPFVITATESI |
| Ga0208382_10381212 | 3300025369 | Freshwater | MSSINDSVTQNLLPVQAYFNLDGSFNTFIGQNMPF |
| Ga0207957_10086545 | 3300025372 | Freshwater | MADPAKVNDQNILPVQALFNLDNSFNTFIGQGQPFY |
| Ga0208259_10395663 | 3300025375 | Freshwater | MTIPATTVDQNILPVQAYFNLDGSFNTFIGQGQPFI |
| Ga0208738_10062631 | 3300025379 | Freshwater | MNAPASTVDQNILPVQAYFDVFGNFQTFLGQGRPFYATF |
| Ga0208256_10276693 | 3300025382 | Freshwater | MTTPSNSAVQNLLPVQAYFNVDGSFNTFIGQGKPFYATSNPVQS |
| Ga0208256_10319273 | 3300025382 | Freshwater | MAGPSSTVDQNLLPVQAYFDVYGNFQTFIGQGQPFY |
| Ga0207959_10113781 | 3300025387 | Freshwater | MANPANSTVQNLLPVQAYFDVNGNFQTFIGQGKAFTAT |
| Ga0207959_10503741 | 3300025387 | Freshwater | MSDPAKTIDQNILPVQALFNLDNTFNTFIGQGQPFYATL |
| Ga0208503_10362371 | 3300025388 | Freshwater | MSAPALTSDQNILPVQAYFNLDGSFNTFIGQGKPFYATL |
| Ga0208380_10041421 | 3300025392 | Freshwater | MSDPAKTSNQNVLPVQAFFNLDGTFNTLLGQGQPF |
| Ga0208387_10022427 | 3300025400 | Freshwater | MAGPNDTVNQNILPVQALFNLDNTFNTFIGQGQPFYATINPIQSGLT |
| Ga0208387_10071281 | 3300025400 | Freshwater | MAGPAKTIDQNILPIQAYFDVYGNFQTFIGQGQAF |
| Ga0208378_10487173 | 3300025407 | Freshwater | MAGPSSTVDQNLLPVQAYFDVYGNFQTFIGQGQPFYAS |
| Ga0208616_10206791 | 3300025417 | Freshwater | MAYPAKVNDQNILPVQALFNLDNSFNTFIGQGQPFYATVNPQQ |
| Ga0207958_10189454 | 3300025421 | Freshwater | MSAPNLTSDQNLLPVQAYFDVFGNFQTFIGQGQPFY |
| Ga0207958_10346203 | 3300025421 | Freshwater | MAGPSSTVDQNLLPVQAYFDVYGNFQTFIGQGQPFYATLNPV |
| Ga0208739_10621621 | 3300025426 | Freshwater | MAGPSSTVDQNLLPVQAYFDVYGNFQTFIGQGQPFYASVNPIQ |
| Ga0208622_10878101 | 3300025430 | Freshwater | MSAPALTSDQNILPVQAYFNLDGSFNTFIGQGHPF |
| Ga0208744_10296714 | 3300025450 | Freshwater | MSDPAKTIDQNILPVQALFNLDNTFNTFIGQGQPFY |
| Ga0208376_10115616 | 3300025455 | Freshwater | MAGPSSTVDQNLLPVQAYFDVYGNFQTFIGQGQPFFATFNPN |
| Ga0208260_10094581 | 3300025467 | Freshwater | MTSPSNSAIQNLLPVQAYFNLDGSFNTFIGQGKPFYATAN |
| Ga0208507_11045053 | 3300025648 | Freshwater | MADPAKVNDQNILPVQALFNLDNSFNTFIGQGQPFYATVNPQQSGL |
| Ga0209188_10454325 | 3300027708 | Freshwater Lake | MANPANSVIQNLLPVQAYFTVDGTFQTFIGQGQPFYAS |
| Ga0209087_13134623 | 3300027734 | Freshwater Lake | MANPANSTVQNLLPVQAYFNLDGSFNTFIGQGQPFYATA |
| Ga0209189_10421381 | 3300027747 | Freshwater Lake | MSDPAKTIDQNILPVQALFNLDNTFQTFIGQGQPFTATI |
| Ga0209189_12220461 | 3300027747 | Freshwater Lake | MANPANSVIQNLLPVQAYFTVDGTFQTFIGQGLPFYASVNPS |
| Ga0209134_103027062 | 3300027764 | Freshwater Lake | MADPAKTVDQNILPVQALFNLDNTFNTFIGQGQPFI |
| Ga0209829_102430813 | 3300027777 | Freshwater Lake | MTNPSNSAVQNLLPVQAYFNLDGSFNTFVGQGTPFYATANPVQSGL |
| Ga0209777_102318861 | 3300027896 | Freshwater Lake Sediment | MGAPNKTVDQNLLPVQAYFDVYGNFQTFIGQGKPFLATISP |
| Ga0209777_109815241 | 3300027896 | Freshwater Lake Sediment | MSSINDSVTQNLLPVQAYFNLDGSFNTFIGQNMPFYATTNPVQS |
| Ga0209048_103617434 | 3300027902 | Freshwater Lake Sediment | MADPAKVLDQNLLPVQAYFAVDGTFQTFIGQGQPFYATVNPYQSG |
| Ga0209536_1028529852 | 3300027917 | Marine Sediment | MSDPAEASVQNLLPVQAYFGLDGSFQTFIGQGQPFYAT |
| Ga0247723_10834841 | 3300028025 | Deep Subsurface Sediment | MADPATTVDQNILPVQALFNLDNTFNTFIGQGQPFFATLNPSQSGLN |
| Ga0304729_11451031 | 3300028392 | Freshwater Lake | MADPAKTVEQNILPVQALFNLDNTFNTFIGQGQPFYATLNPS |
| Ga0304730_12992321 | 3300028394 | Freshwater Lake | MADPASTVDQNLLPVQAYFNLDGSFSTFIGQSQPFYATT |
| Ga0316217_100602215 | 3300031813 | Freshwater | MTTPSNSAVQNLLPVQAYFNVDGSFNTFIGQGKPFYA |
| Ga0316220_11509121 | 3300031884 | Freshwater | MTSPSNSAIQNLLPVQAYFNLDGSFNTFIGQGKPFYATTNPVQS |
| Ga0316218_12316191 | 3300032117 | Freshwater | MAGPSSTVDQNLLPVQAYFDVYGNFQTFIGQGQPFYAKVNPIQ |
| Ga0316222_11036534 | 3300032561 | Freshwater | MAGPSSTVDQNLLPVQAYFDVYGNFQTFIGQGQPFYASINP |
| Ga0316222_13189781 | 3300032561 | Freshwater | MSDPAKTIDQNILPVQALFNLDNSFNTFIGQGQPFYATV |
| Ga0316232_12160643 | 3300032605 | Freshwater | MANPSLTVDQNLLPVQAYFNLDGSFNTFIGQNQPFYA |
| Ga0316221_10047901 | 3300032665 | Freshwater | MTSPSNSAVQNLLPVQAYFNLDGTFNTFIGQGKPFYATANP |
| Ga0316221_10217051 | 3300032665 | Freshwater | MAGPSSTVDQNLLPVQAYFDVYGNFQTFIGQGQPFFA |
| ⦗Top⦘ |