NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F057781

Metagenome / Metatranscriptome Family F057781

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F057781
Family Type Metagenome / Metatranscriptome
Number of Sequences 136
Average Sequence Length 63 residues
Representative Sequence MKLPDLQMLAHWLDPALVATLETRRRKKKEWHRRRKLATLQTLWLMLAVSLDTQRSSLHEIL
Number of Associated Samples 114
Number of Associated Scaffolds 136

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 94.85 %
% of genes near scaffold ends (potentially truncated) 95.59 %
% of genes from short scaffolds (< 2000 bps) 97.06 %
Associated GOLD sequencing projects 112
AlphaFold2 3D model prediction Yes
3D model pTM-score0.49

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (94.853 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil
(12.500 % of family members)
Environment Ontology (ENVO) Unclassified
(19.853 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(30.147 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 60.00%    β-sheet: 0.00%    Coil/Unstructured: 40.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.49
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 136 Family Scaffolds
PF01609DDE_Tnp_1 2.94
PF02604PhdYeFM_antitox 0.74
PF06831H2TH 0.74
PF04014MazE_antitoxin 0.74
PF13426PAS_9 0.74
PF05066HARE-HTH 0.74
PF01797Y1_Tnp 0.74
PF09723Zn-ribbon_8 0.74
PF03358FMN_red 0.74
PF01039Carboxyl_trans 0.74
PF13683rve_3 0.74

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 136 Family Scaffolds
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 2.94
COG3293TransposaseMobilome: prophages, transposons [X] 2.94
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 2.94
COG5421TransposaseMobilome: prophages, transposons [X] 2.94
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 2.94
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 2.94
COG0266Formamidopyrimidine-DNA glycosylaseReplication, recombination and repair [L] 0.74
COG0777Acetyl-CoA carboxylase beta subunitLipid transport and metabolism [I] 0.74
COG0825Acetyl-CoA carboxylase alpha subunitLipid transport and metabolism [I] 0.74
COG1943REP element-mobilizing transposase RayTMobilome: prophages, transposons [X] 0.74
COG2161Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM familyDefense mechanisms [V] 0.74
COG3343DNA-directed RNA polymerase, delta subunitTranscription [K] 0.74
COG4118Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressorDefense mechanisms [V] 0.74
COG4799Acetyl-CoA carboxylase, carboxyltransferase componentLipid transport and metabolism [I] 0.74


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.85 %
UnclassifiedrootN/A5.15 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2140918023|ConsensusfromContig45493All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont935Open in IMG/M
3300000094|WSSedA1TDRAFT_c035371All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont587Open in IMG/M
3300001213|JGIcombinedJ13530_100043022All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont722Open in IMG/M
3300001213|JGIcombinedJ13530_103173740All Organisms → cellular organisms → Bacteria694Open in IMG/M
3300001213|JGIcombinedJ13530_105922865All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont805Open in IMG/M
3300003994|Ga0055435_10108009All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont742Open in IMG/M
3300004006|Ga0055453_10145074All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont725Open in IMG/M
3300004006|Ga0055453_10319152All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont501Open in IMG/M
3300004008|Ga0055446_10213160All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont578Open in IMG/M
3300004009|Ga0055437_10180162All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont669Open in IMG/M
3300004021|Ga0055449_10208757All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont665Open in IMG/M
3300004077|Ga0055523_10101726All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont671Open in IMG/M
3300004078|Ga0055513_10121237All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300004155|Ga0066600_10349479Not Available687Open in IMG/M
3300004778|Ga0062383_10344585All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont724Open in IMG/M
3300004782|Ga0062382_10330123All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont703Open in IMG/M
3300005204|Ga0068997_10042494All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont849Open in IMG/M
3300005216|Ga0068994_10022878All Organisms → cellular organisms → Bacteria1286Open in IMG/M
3300005601|Ga0070722_10179056All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont864Open in IMG/M
3300005833|Ga0074472_10487161All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont854Open in IMG/M
3300005919|Ga0075114_10036907All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont1988Open in IMG/M
3300006224|Ga0079037_100319469All Organisms → cellular organisms → Bacteria1446Open in IMG/M
3300008416|Ga0115362_100037151All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont824Open in IMG/M
3300009060|Ga0102962_1101939All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont807Open in IMG/M
3300009078|Ga0105106_10453317All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont924Open in IMG/M
3300009078|Ga0105106_10596650All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont792Open in IMG/M
3300009082|Ga0105099_10890540All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont561Open in IMG/M
3300009091|Ga0102851_10915394All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont947Open in IMG/M
3300009091|Ga0102851_11938559All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont666Open in IMG/M
3300009091|Ga0102851_12083374All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont644Open in IMG/M
3300009111|Ga0115026_11547851All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont553Open in IMG/M
3300009131|Ga0115027_10506511All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont870Open in IMG/M
3300009131|Ga0115027_11009111All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont652Open in IMG/M
3300009171|Ga0105101_10136433All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont1189Open in IMG/M
3300009179|Ga0115028_10163203All Organisms → cellular organisms → Bacteria1366Open in IMG/M
3300009179|Ga0115028_11946082All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont517Open in IMG/M
3300009179|Ga0115028_11987347All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont512Open in IMG/M
3300009506|Ga0118657_11455681All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont811Open in IMG/M
3300009521|Ga0116222_1342654All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300009641|Ga0116120_1111773All Organisms → cellular organisms → Bacteria896Open in IMG/M
3300010341|Ga0074045_10367233All Organisms → cellular organisms → Bacteria937Open in IMG/M
3300010413|Ga0136851_10810035All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont917Open in IMG/M
3300012931|Ga0153915_11653809All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont749Open in IMG/M
3300012964|Ga0153916_11347415All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont791Open in IMG/M
(restricted) 3300013138|Ga0172371_10799454All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont624Open in IMG/M
3300014151|Ga0181539_1169229All Organisms → cellular organisms → Bacteria858Open in IMG/M
3300014200|Ga0181526_10358567All Organisms → cellular organisms → Bacteria927Open in IMG/M
3300014264|Ga0075308_1005842All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont2080Open in IMG/M
3300014320|Ga0075342_1098659All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont759Open in IMG/M
3300014492|Ga0182013_10275946All Organisms → cellular organisms → Bacteria957Open in IMG/M
3300014498|Ga0182019_11160983All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont566Open in IMG/M
3300017925|Ga0187856_1240260All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont642Open in IMG/M
3300017940|Ga0187853_10398466All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont609Open in IMG/M
3300017948|Ga0187847_10364530All Organisms → cellular organisms → Bacteria792Open in IMG/M
3300017972|Ga0187781_11285649All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300017988|Ga0181520_10575348All Organisms → cellular organisms → Bacteria785Open in IMG/M
3300018003|Ga0187876_1217007All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont636Open in IMG/M
3300018025|Ga0187885_10299530All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont728Open in IMG/M
3300018062|Ga0187784_11464373All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300018068|Ga0184636_1112129All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont940Open in IMG/M
3300018070|Ga0184631_10370061All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont593Open in IMG/M
3300018086|Ga0187769_10719371All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300019721|Ga0194011_1017483All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont743Open in IMG/M
3300019749|Ga0193983_1091285All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont506Open in IMG/M
3300020222|Ga0194125_10778935All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont548Open in IMG/M
3300022217|Ga0224514_10313087All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont574Open in IMG/M
3300022218|Ga0224502_10192092All Organisms → cellular organisms → Bacteria784Open in IMG/M
3300022389|Ga0210318_1088891All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont618Open in IMG/M
3300022391|Ga0210374_1041043All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont823Open in IMG/M
3300023101|Ga0224557_1138148All Organisms → cellular organisms → Bacteria919Open in IMG/M
3300024056|Ga0124853_1060593All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont751Open in IMG/M
3300024056|Ga0124853_1323415Not Available2499Open in IMG/M
(restricted) 3300024333|Ga0233422_10370090All Organisms → cellular organisms → Bacteria561Open in IMG/M
(restricted) 3300024529|Ga0255044_10211976All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont766Open in IMG/M
3300025409|Ga0208321_1043686All Organisms → cellular organisms → Bacteria696Open in IMG/M
3300025448|Ga0208037_1065061All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300025453|Ga0208455_1084689All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300025480|Ga0208688_1078269All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300025895|Ga0209567_10056871All Organisms → cellular organisms → Bacteria1809Open in IMG/M
3300025984|Ga0210082_1076683All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont566Open in IMG/M
3300026106|Ga0209927_1054634All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont535Open in IMG/M
3300026350|Ga0256823_1021421All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300026872|Ga0207785_1010605All Organisms → cellular organisms → Bacteria834Open in IMG/M
3300027792|Ga0209287_10283368All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont635Open in IMG/M
(restricted) 3300027881|Ga0255055_10467607All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont678Open in IMG/M
3300027885|Ga0209450_11053191All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont574Open in IMG/M
3300027887|Ga0208980_10371665All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont826Open in IMG/M
3300027888|Ga0209635_10964950All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont593Open in IMG/M
3300027900|Ga0209253_10405772Not Available1034Open in IMG/M
3300027902|Ga0209048_10871992All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont583Open in IMG/M
3300028599|Ga0265309_10594144All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont744Open in IMG/M
3300030613|Ga0299915_10805312All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont585Open in IMG/M
3300030613|Ga0299915_10808374All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont583Open in IMG/M
3300030613|Ga0299915_10836133All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont571Open in IMG/M
3300031552|Ga0315542_1249210All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont615Open in IMG/M
(restricted) 3300031898|Ga0315312_1125741All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont777Open in IMG/M
3300032046|Ga0315289_11273470All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont584Open in IMG/M
3300032061|Ga0315540_10251691All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont746Open in IMG/M
3300032156|Ga0315295_10427747All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont1347Open in IMG/M
3300032163|Ga0315281_10578505Not Available1184Open in IMG/M
3300032163|Ga0315281_11692990All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont614Open in IMG/M
3300032164|Ga0315283_10645300Not Available1144Open in IMG/M
3300032164|Ga0315283_12231427All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont538Open in IMG/M
3300032173|Ga0315268_11202010All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont767Open in IMG/M
3300032177|Ga0315276_12548360All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont511Open in IMG/M
3300032260|Ga0316192_10117606Not Available1860Open in IMG/M
3300032262|Ga0316194_10483443All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont781Open in IMG/M
3300032263|Ga0316195_10588213All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont594Open in IMG/M
3300032401|Ga0315275_12217949All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont574Open in IMG/M
3300032401|Ga0315275_12350706All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont554Open in IMG/M
3300032401|Ga0315275_12596229All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont522Open in IMG/M
3300032516|Ga0315273_11830896All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont729Open in IMG/M
3300032892|Ga0335081_12491492All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300032897|Ga0335071_11488929Not Available621Open in IMG/M
3300033402|Ga0326728_10577427All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont884Open in IMG/M
3300033408|Ga0316605_11300772All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont703Open in IMG/M
3300033413|Ga0316603_11804975All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont579Open in IMG/M
3300033414|Ga0316619_10943188All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont748Open in IMG/M
3300033414|Ga0316619_11576098All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont590Open in IMG/M
3300033414|Ga0316619_11948626All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont534Open in IMG/M
3300033433|Ga0326726_11525951All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont650Open in IMG/M
3300033433|Ga0326726_12041625All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont558Open in IMG/M
3300033480|Ga0316620_10027912All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria3522Open in IMG/M
3300033481|Ga0316600_10663436All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont731Open in IMG/M
3300033482|Ga0316627_101467216All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont688Open in IMG/M
3300033488|Ga0316621_10456386All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont884Open in IMG/M
3300033488|Ga0316621_11280183All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont556Open in IMG/M
3300033489|Ga0299912_10539257All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont932Open in IMG/M
3300033513|Ga0316628_101518412All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont892Open in IMG/M
3300033513|Ga0316628_101660044All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont851Open in IMG/M
3300033521|Ga0316616_100002818All Organisms → cellular organisms → Bacteria → Proteobacteria8013Open in IMG/M
3300033521|Ga0316616_104232260All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont540Open in IMG/M
3300033557|Ga0316617_100602019All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont1020Open in IMG/M
3300034090|Ga0326723_0563373All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont526Open in IMG/M
3300034091|Ga0326724_0378609All Organisms → cellular organisms → Bacteria758Open in IMG/M
3300034782|Ga0373573_0187170All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont638Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil12.50%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment9.56%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands8.09%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland4.41%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands4.41%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment3.68%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland3.68%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland3.68%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland3.68%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil3.68%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment2.21%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog2.21%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.21%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.21%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment1.47%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.47%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment1.47%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands1.47%
SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Sediment1.47%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine1.47%
Salt Marsh SedimentEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment1.47%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment1.47%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.47%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.47%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.47%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.74%
SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment0.74%
FreshwaterEnvironmental → Aquatic → Freshwater → Pond → Sediment → Freshwater0.74%
Marine SedimentEnvironmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment0.74%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.74%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment0.74%
Worm BurrowEnvironmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow0.74%
SedimentEnvironmental → Aquatic → Marine → Wetlands → Sediment → Sediment0.74%
Mangrove SedimentEnvironmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment0.74%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.74%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.74%
SedimentEnvironmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment0.74%
Saline LakeEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake0.74%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.74%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment0.74%
Mangrove SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment0.74%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.74%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.74%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.74%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.74%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.74%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.74%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2140918023Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3EnvironmentalOpen in IMG/M
3300000094Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site A1 TuleEnvironmentalOpen in IMG/M
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300003994Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300004006Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragA_D2EnvironmentalOpen in IMG/M
3300004008Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_CordB_D2EnvironmentalOpen in IMG/M
3300004009Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2EnvironmentalOpen in IMG/M
3300004021Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWB_D1EnvironmentalOpen in IMG/M
3300004077Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_ThreeSqC_D2EnvironmentalOpen in IMG/M
3300004078Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleB_D2EnvironmentalOpen in IMG/M
3300004155Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11EnvironmentalOpen in IMG/M
3300004778Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3FreshEnvironmentalOpen in IMG/M
3300004782Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2FreshEnvironmentalOpen in IMG/M
3300005204Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D2EnvironmentalOpen in IMG/M
3300005216Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLA_D2EnvironmentalOpen in IMG/M
3300005601Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1EnvironmentalOpen in IMG/M
3300005833Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBKEnvironmentalOpen in IMG/M
3300005919Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKMEnvironmentalOpen in IMG/M
3300006224Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaGEnvironmentalOpen in IMG/M
3300008416Sea floor sediment microbial communities from Gulf of Mexico Methane Seep - MPC12BEnvironmentalOpen in IMG/M
3300009060Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_D2_MGEnvironmentalOpen in IMG/M
3300009078Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009082Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015EnvironmentalOpen in IMG/M
3300009091Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300009111Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1EnvironmentalOpen in IMG/M
3300009131Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1EnvironmentalOpen in IMG/M
3300009171Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009179Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1EnvironmentalOpen in IMG/M
3300009506Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8EnvironmentalOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009641Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150EnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010413Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_9EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012964Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaGEnvironmentalOpen in IMG/M
3300013138 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_12mEnvironmentalOpen in IMG/M
3300014151Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014264Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D2_rdEnvironmentalOpen in IMG/M
3300014320Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1EnvironmentalOpen in IMG/M
3300014492Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaGEnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300017925Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300018003Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40EnvironmentalOpen in IMG/M
3300018025Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018068Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b2EnvironmentalOpen in IMG/M
3300018070Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b1EnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300019721Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLC_7-8_MGEnvironmentalOpen in IMG/M
3300019749Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BLT_4-5_MGEnvironmentalOpen in IMG/M
3300020222Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015034 Kigoma Deep Cast 250mEnvironmentalOpen in IMG/M
3300022217Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_24EnvironmentalOpen in IMG/M
3300022218Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_13EnvironmentalOpen in IMG/M
3300022389Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.24 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022391Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.765 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023101Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14EnvironmentalOpen in IMG/M
3300024056Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300024333 (restricted)Freshwater microbial communities from Lake Matano, South Sulawesi, Indonesia - Watercolumn_Matano_2014_110_MGEnvironmentalOpen in IMG/M
3300024529 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_21EnvironmentalOpen in IMG/M
3300025409Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025448Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025453Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025480Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025895Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_12 (SPAdes)EnvironmentalOpen in IMG/M
3300025984Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_ThreeSqA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026106Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_D1_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026350Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 PU6EnvironmentalOpen in IMG/M
3300026872Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 74 (SPAdes)EnvironmentalOpen in IMG/M
3300027792Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027881 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_27EnvironmentalOpen in IMG/M
3300027885Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes)EnvironmentalOpen in IMG/M
3300027887Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 BulkEnvironmentalOpen in IMG/M
3300027888Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-30_32 (SPAdes)EnvironmentalOpen in IMG/M
3300027900Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes)EnvironmentalOpen in IMG/M
3300027902Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes)EnvironmentalOpen in IMG/M
3300028599Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160524 (Illumina Assembly)EnvironmentalOpen in IMG/M
3300030613Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT92D227EnvironmentalOpen in IMG/M
3300031552Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-20EnvironmentalOpen in IMG/M
3300031898 (restricted)Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP7EnvironmentalOpen in IMG/M
3300032046Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40EnvironmentalOpen in IMG/M
3300032061Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-10EnvironmentalOpen in IMG/M
3300032156Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0EnvironmentalOpen in IMG/M
3300032163Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0EnvironmentalOpen in IMG/M
3300032164Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0EnvironmentalOpen in IMG/M
3300032173Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_topEnvironmentalOpen in IMG/M
3300032177Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0EnvironmentalOpen in IMG/M
3300032260Coastal sediment microbial communities from Maine, United States - Merrow Island worm burrowEnvironmentalOpen in IMG/M
3300032262Coastal sediment microbial communities from Maine, United States - Cross River sediment 1EnvironmentalOpen in IMG/M
3300032263Coastal sediment microbial communities from Maine, United States - Phippsburg sediment 1EnvironmentalOpen in IMG/M
3300032401Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0EnvironmentalOpen in IMG/M
3300032516Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033408Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCTEnvironmentalOpen in IMG/M
3300033413Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCTEnvironmentalOpen in IMG/M
3300033414Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_BEnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033480Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_BEnvironmentalOpen in IMG/M
3300033481Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CTEnvironmentalOpen in IMG/M
3300033482Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_CEnvironmentalOpen in IMG/M
3300033488Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_CEnvironmentalOpen in IMG/M
3300033489Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214EnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M
3300033521Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_BEnvironmentalOpen in IMG/M
3300033557Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_BEnvironmentalOpen in IMG/M
3300034090Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00NEnvironmentalOpen in IMG/M
3300034091Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00NEnvironmentalOpen in IMG/M
3300034782Sediment microbial communities from coastal wetland in Texas, United States - D0606M02EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
B3_GZBA_C_003833202140918023SoilMPKPDLQLLTQWLDPALVSILEAKRRLKNEWHRHRKLATLETLWLMLAVSLDTHQSSLYEILRLATGTLDIQWSIS
WSSedA1TDRAFT_03537113300000094WetlandMSKPDLRLLTQWLDPALVSRLEDRRHLKNEWRRHRKLATLETLWLMLAVSLD
JGIcombinedJ13530_10004302223300001213WetlandMSQPDLKLLAQWLDPALVTELENRRRLKNEWRRHRKLGTLEMLWLMLAVSLD
JGIcombinedJ13530_10317374023300001213WetlandMKKPDLQLLAKWLDPAIVEALDIRRRLKKEWRRSRKLGTLEMLWLMLAVSLDTARSSLHEILRLAT
JGIcombinedJ13530_10592286523300001213WetlandMRKPDLRMLAQWLDPVLVAMIESRRRLNNEWHRHRKLATLETLWLMLAVSLDT
Ga0055435_1010800913300003994Natural And Restored WetlandsMLTPDLRLLTQWLDPALVSGLEGRRRVNKEWHRRRKLATLETLWLMLAVSLDTHRSS
Ga0055453_1014507413300004006Natural And Restored WetlandsMKQPDLRMLAHWLDPALVTTLETRRRLKKEWHRRRKLPTLQTLWLMLAVSLDTQRS
Ga0055453_1031915223300004006Natural And Restored WetlandsMKKPDLSMLAQWIDPVLVTTLETLRYLKNEWHRRRKLSTLETLWLMLAVSLDTQRS
Ga0055446_1021316013300004008Natural And Restored WetlandsMKKPDLQLLTQWLDPVTVAALETRRRKKKEFHRRRKLATLQTVWLMLAV
Ga0055437_1018016213300004009Natural And Restored WetlandsMLNPDLRLLTQWLDPVLVSGLEGRRRAKKEWHRRRKLATLETLWLMLAVSLDTH
Ga0055449_1020875723300004021Natural And Restored WetlandsMKLPDLQMLAHWLDPALVAAVETRRREKKEWHRCRKLATLQTLWLMLAVSLD
Ga0055523_1010172623300004077Natural And Restored WetlandsMKQPDLRMLAHWLDPALVTTLETRRRLKKEWHRRRKLPTLQTLWL
Ga0055513_1012123723300004078Natural And Restored WetlandsMSRPELPHITRWIDSTLVALLEQRRWEKKEWRRRRKLGTLQILWLMLAVSLDTQRSSLHEILSLATAQLNIQW
Ga0066600_1034947913300004155FreshwaterMKQPDLQMLAQWLDTALVKELETRRRLKNEWRRHRKLATLETLWLM
Ga0062383_1034458523300004778Wetland SedimentMKKLDLRMLAQWLDPVFVAMLETRRRRNHEWHRRRKLATLETLWLMLAVSLDTQRASLYEILRLATAQLGVQ
Ga0062382_1033012323300004782Wetland SedimentMKKLDLRMLAQWLDPVFVAMLETRRRRNHEWHRRRKLATLETLWLMLAVSLDTQRASLYEILRFATAQLGVQWSI
Ga0068997_1004249413300005204Natural And Restored WetlandsMAKPELPHIARWIDSTLVALLEQRRWEKKEWRRRRKLGTLQTLWLMLAVSLDTQRASLHEILSLAAAQLNIPWFVSVAAFCKA
Ga0068994_1002287853300005216Natural And Restored WetlandsMKQPDLRMLAHWLDPALVTTLETRRRLKKEWHRRRKLPTLQTLWLMLAVSLD
Ga0070722_1017905613300005601Marine SedimentMKLPDLQMLAHWLDPALVATLETRRRRKKEWQRRRKLVTLQTLWLMLAVSLDTQRSS
Ga0074472_1048716133300005833Sediment (Intertidal)MKKLDLRMLAQWLDPVFVAMLETRRRRNHEWHRRRKLATLETLWLMLAVSLDTQRASRYEILRF
Ga0075114_1003690713300005919Saline LakeMQQPDLRMLAHWIDPALVAALENRRRLNKEWHRHRKLATLQTLWLMLAVSLDTQRSSLHEILRLSTG
Ga0079037_10031946913300006224Freshwater WetlandsMLKPDLRLLAQWLDPALVSVLESRRRLKKEWQRHRKLATLETLWLMLAVSLDTHRSSLYEILRLATGQLAIQWSI
Ga0115362_10003715123300008416SedimentMKXPDLXMLAXWLDPALVATLETRRRKKKEWXRRRKLATLQTLWLMXAVSLDTQRSSLHEILRLATGQLGIQFSVSVAAFCK
Ga0102962_110193923300009060SoilMKLPDLQMLAHWLDPALVAALETRRRKKNEWHRRRKLATLQTLWLMLAVSLNTQ
Ga0105106_1045331713300009078Freshwater SedimentMTQPDLQLLSQWLDPTLVAAVEDRRRFKKEWHRRRKLATLQTLWLMLAVS
Ga0105106_1059665023300009078Freshwater SedimentMLKPDLRLLAQWLDPALVSGLEARRRLKKEWQRRRKLATLETLWLMLAVSLDTH
Ga0105099_1089054023300009082Freshwater SedimentMLKPDLRLLAQWLDPALVSVLEDRRRRKKEWQRRRKLATLETLWLMLAVSLDTHRAGLYEILRLATGQLAIPWSISVAAFCKGRRRFSPGHSHVVVRCAGRT
Ga0102851_1091539413300009091Freshwater WetlandsMLKPDLRLLAQWLDPALVSVLESRRRLKKEWQRHRKLATLETLWLMLAVSLDTHRSS
Ga0102851_1193855913300009091Freshwater WetlandsMRKPDLRMLAQWLDPVFVAMLETRRRRNHEWHRRRKLATLETLWLMLAVSLDTQRASLY
Ga0102851_1208337423300009091Freshwater WetlandsMLKPDLRLLAQWLDPTLVSVLENRRRLKKEWQRRRKLATLETLCLMLAVSLDTHRASLYEILRLATGQLAI
Ga0115026_1154785113300009111WetlandMLAQWLDPVFVAMLETRRRRNHEWHRRRKLATLETLWLMLAVSLDTQRASLY
Ga0115027_1050651113300009131WetlandMTKPDLRTLAQWIDPIIVTMLEDRRRLNKEWHRRRKLATLETLWLMLAVSLDTHRSSLYEILRL
Ga0115027_1100911113300009131WetlandMTKPDLRMLTQWLDPIVVAMLENRRRLNHEWQRHRKLATLETLWLMPAVSLDTQRASLYEILRLATAQLGVQW
Ga0105101_1013643313300009171Freshwater SedimentMPRPDLQLLSRWLEPTLVNELENRRRLKREWHRRRKLTTLETLWLMLAVSLDTQRSSLY*
Ga0115028_1016320333300009179WetlandMKKLDLQMLAQWLDPVFVAMLETRRRRNHEWHRRRKLATLETLWLM
Ga0115028_1194608213300009179WetlandMLTQWLDPIVVAMLENRRRLNHEWQRHRKLATLETLWLMLAVSLDTQRASLYEILRLA
Ga0115028_1198734723300009179WetlandMLAQWLDPVFVAMLETRRRRNHEWHRRRKLATLETLWLMLAVSLDTQ
Ga0118657_1145568113300009506Mangrove SedimentMKKPDLQMLAQWLGPAMVAALETRRLLKKEFHRHRKLATLQTLWLMLAVSLDTQQSSLQDILRLATGQLGIQFSVSVAAF
Ga0116222_134265413300009521Peatlands SoilMIKPDLGLIAKWLNPVIVEELDKKRHLRKEWRRYRKLGTLETLWLMLAVSLDTGR
Ga0116120_111177323300009641PeatlandMTTPDLGLVAKWLDADIVEALERKRRLSKEWQRNRKLGTLGTLWLMLAVSLDTGRSSLHEILRL
Ga0074045_1036723313300010341Bog Forest SoilMTKPDLHLLAKWLDPIIVETLDKRRHLKREWRRNRKLGTLETLWLMLAVSLDTQRASLHEILRLATGEIGIQWSISVAA
Ga0136851_1081003523300010413Mangrove SedimentMKKPDLQMLAQWLDPAIVAALETRRLLKKEFYRHRKLATLQTLWLMLAVSLDTQQSSLQDILRLATGQLGIQFSVSVAAFCKA
Ga0153915_1165380923300012931Freshwater WetlandsMLKPDLRLLAQWLDPALVSMLEDRRRLKKEWQRRRKLATLETLWLMLAVSLDTHRDSLYEILRLATGQLALQ
Ga0153916_1134741523300012964Freshwater WetlandsMLKPDLQLLAHWLDPSLVSVLEGRRRLKKEWYRRRKLATLETLWLMLAVSLE
(restricted) Ga0172371_1079945413300013138FreshwaterMPNPDLRTLARWLDPSLVTALEARRWRKKEWRRHRKLATLETLWLMLA
Ga0181539_116922913300014151BogMTKPDLHLLAHWLDPVLVMTLEKRRRLKKEWRRYRKLATLETLWLMLAVSLDTQRSSLHEILRL
Ga0181526_1035856723300014200BogMIKPDLRLIAKWLDPAVVEALDKRRHLKKEWRRNRKLGTLETLWLMLAVSLDTARSSLHEILRLATGDLNMRWSVSVPAFC
Ga0075308_100584233300014264Natural And Restored WetlandsMNQPDLRMLAHWLDPALVTTLETRRRLKKEWYRRRKLPTLQTLWLMLAVSLDTQK
Ga0075342_109865913300014320Natural And Restored WetlandsMKQPDLRMLAHWLDPALVKTLETRRRLKKEWHRRRKLPTLQTLWLMLAVSLD
Ga0182013_1027594613300014492BogMVKPDLLFLAKWLDPVIVEALDKRRYLKKEWRRNRKLGTLETLWLMLAVSLDTARSSLHEILRLATGELDIGWSV
Ga0182019_1116098323300014498FenMPKLELPNLAQWIDVALISSLEQRRQKNKEWRRRRKLGTLQTLWLMLAVSLDAQRSSLHEILALAVAQLDIQWSV
Ga0187856_124026023300017925PeatlandMTKPDLHLLAHWLDPVLVMTLEKRRRLKKEWRRYRKLATLETLWLMLAVSLDTQRSSLHEILRLATGELG
Ga0187853_1039846613300017940PeatlandMPRPDLGMLAQWLDPILVAMLENRRRLKNEWHRHRKLATLETLWLMLAVSLDTHRFSLYEILRL
Ga0187847_1036453023300017948PeatlandMTTPDLGLVAKWLDADIVEALERKRRLSKEWQRNRKLGTLGTLWLMLAVSLDTGRSSLHEILRLATGE
Ga0187781_1128564923300017972Tropical PeatlandMIKPDLQLLAKWLDPAVVEELDKRRYLKKEWRRNRKLGTLETLWLMLAVSLDTARSSLHEILRLS
Ga0181520_1057534823300017988BogMIKPDLRLIAKWLDPAVVEALDKRRHLKKEWRRNRKLGTLETLWLMLAVSLDTARSSLHEILRLATGDLNMRWSVSVPAYCKARSRFSP
Ga0187876_121700713300018003PeatlandMTKPDLHLLAHWLDPVLVMTLEKRRRLKKEWRRYRKLATLETLWLMLA
Ga0187885_1029953013300018025PeatlandMPRPDLGMLAQWLDPILVAMLENRRRLKNEWHRHRKLATLETLWLMLAVSLDTHRFSLYEILRLAT
Ga0187784_1146437323300018062Tropical PeatlandMIEPDLQLLAQWLDPGIVKELDRKRRVRKECCRNRKLGTLGTLWLMLAVSLDTARSSL
Ga0184636_111212923300018068Groundwater SedimentMPNPDLQLLTQWLDPALVSGLEGRRRVKKEWHRRRKLATLETLWLMLAVSLDTHRSSLYEILRLATGELAIRWSISVAAFCKA
Ga0184631_1037006123300018070Groundwater SedimentMTKPDLRLLADWLAPALVAELETRRWVKKEWRRRRKLATLETLWLMLAVSLDTH
Ga0187769_1071937123300018086Tropical PeatlandMVKPDLHLLAKWLDPVILEALDKRRHLKKEWRRNRKLGTLETLWLMLAVSLDTARS
Ga0194011_101748323300019721SedimentMKKPDLQLLTQWLDPVTVAALESRRRKKKEFHRRRKLATLQTVWL
Ga0193983_109128523300019749SedimentMKKPDLQLLAQWLDPVTVAALETRRRKKKEFHRRRKLATLQTVWLMLAVSLDTQ
Ga0194125_1077893523300020222Freshwater LakeMPKPDLQLLAHWLDPALVDALENRRRLKKEWHRRRKLATLETLWLMLAVSLDTHRSSLYDILRLATGQLGIQWS
Ga0224514_1031308713300022217SedimentMKLPDLQMLAHWLDPALVATLETRRRKKKEWHRRRKLATLQTLWLMLAVSLDTQRSSLHEIL
Ga0224502_1019209233300022218SedimentMKLPDLQMLAHWLEPALVSTLDARRRKKKEWQRRRKLATLQTLWLMLAVSLDTQRSSLHEILR
Ga0210318_108889123300022389EstuarineMKKPDLQMLAQWLDPTIVTALENRRRMKKEWHRRRKMATLQTVWLMLAVSLDTHRSSL
Ga0210374_104104323300022391EstuarineMKKPDLQMLAQWLDPAIVTALETRRRIKKEFHRRRKLATLQTLWLMLAVSLDTQLSSLHD
Ga0224557_113814823300023101SoilMVKPDLNLLAKWLDTDIVEVLDRKRRLGKELRRNRKLGTLGTLWLMLAVSLDTARSSLHEILRLATGGLNIGWS
Ga0124853_106059323300024056Freshwater WetlandsMRKPDLRMLAQWLDPVFVAMLETRRRRNHEWHRRRKLATLETLWLMLAVSLDTQRASLYEILRFATAQLGVQWSISVAAFCKA
Ga0124853_132341553300024056Freshwater WetlandsMKKLDLQMLAQWLDPVFVAMLETRRRRNHEWHRRRKLATLETLWLMLAVSLDTQ
(restricted) Ga0233422_1037009023300024333FreshwaterMPKPDLKLLAQWFDADLIAKLEIKRRLKKECHRHRKLATLETLWLMLAVSLDTHRSSIYEILRLTT
(restricted) Ga0255044_1021197623300024529SeawaterMLQPDLQMLAHWLDPAIVATLETRRRRKKEWHRHRKLATLQTLWLMFAVSLDTQRSSLHEILRLTTGDLG
Ga0208321_104368613300025409PeatlandMIKPDLSLLAKWLDPDTVEALDSKRRLNKEWRRNRKLGTLETLWLMLAVSLDTARSSLREILRLATGEL
Ga0208037_106506113300025448PeatlandMTTPDLGLVAKWLDADIVEALERKRRLSKEWQRNRKLGTLGTLWLMLAVSLDTGRSSLHE
Ga0208455_108468923300025453PeatlandMTTPDLGLVAKWLDADIVEALERKRRLSKEWQRNRKLGTLGTLWLMLAVS
Ga0208688_107826913300025480PeatlandMIKPDLRLIAKWLDPAVVEALDKRRHLKKEWRRNRKLGTLETLWLMLAVSLDT
Ga0209567_1005687113300025895Pelagic MarineMKQPDLQMLANWLEPALVATLDARRRLKKEWQRRRKLATLQTVWLMLAVSLDTQRSKLA
Ga0210082_107668323300025984Natural And Restored WetlandsMKLPDLQMLAHWLDPALVAAVETRRREKKEWHRCRKLATLQTLWLMLAVSLDTQRSSLHEILRLA
Ga0209927_105463423300026106SoilMKLPDLQMLAHWLDPALVATLETRRRKKKEWHRRRKLATLQTLWLMLA
Ga0256823_102142123300026350SedimentMIKPDLRVLSQWLDPILMAMLEDRRRLKNEWRRRRKLATLETLWLMLAVSLDTQRAGLHE
Ga0207785_101060513300026872Tropical Forest SoilVLKPDLQLLACWLDVSLVALLKDRRRKAKEWRRHRKLGTLETLWLMLAVSLDTQRSSLHEILRLACAQLHMPWS
Ga0209287_1028336813300027792Freshwater SedimentMPKPDLQLLAQWIDPTLVSTLQSRRLLKKEWQRHRKLATLETLWLMLAVSLDTHRSSLY
(restricted) Ga0255055_1046760723300027881SeawaterMKLPDLQMLAHWLDPALVATLETRRRLKKEWHRRRKLATLQTLWLMLA
Ga0209450_1105319113300027885Freshwater Lake SedimentMKKLDLRMLAQWLDPVFVAMLETRRRRNHEWHRRRKLATLETLWLMLAVSLDTQRASLYEILRFATA
Ga0208980_1037166523300027887WetlandMTKPDLRMLTQWLDPIIVAMLENRRRMNHEWQRRRKLATLETLWLMLAVSLDTQRASLYEILRLATAELGVQWSV
Ga0209635_1096495013300027888Marine SedimentMTQPDLQLLAHWLDPALVALLESRRRLKKEWHRRRKLPTLETLWLML
Ga0209253_1040577213300027900Freshwater Lake SedimentMPKPDLQQLAHWVDSTLVALLEERRRQKKEWRRRRKLGTLETLWLMLAVSLDTQRSSLYEILRLATAQL
Ga0209048_1087199213300027902Freshwater Lake SedimentMPKPDLQLLAQWLDPTLVDTLQSRRLMKKEWHRHRKLATLETLWLMLAVSLDTHRSSLYEILRLATGQLI
Ga0265309_1059414413300028599SedimentMKKPDLQMLAQWLDPAIVAALETRRRMKKEWHRRRKLATLQTVWLMLAVSLDT
Ga0299915_1080531223300030613SoilMSKPDLRLLTQWLNPVLVSGLEDRRHLKNEWRRHRKLATLETLWLMLAVSLDTHRSSLYEILRLATGHLDIQWSVSVAAFCK
Ga0299915_1080837413300030613SoilMLDPALVSVLEHRRRLKKEWQRRRKLATLETLWLMLAVSLDTHRASLYE
Ga0299915_1083613313300030613SoilMTQPDLQLLAQWLDPTLVAAVEDRRRFKKEWHRRRKLATLQTLWLMLA
Ga0315542_124921023300031552Salt Marsh SedimentMKKPDLCMLAQWLEPAVVATLETRRRLKNEWRRHRKLATLETLWLMLAVSLDTQRAGLFEILRL
(restricted) Ga0315312_112574113300031898SedimentMLKPDLRLLAQWLDPALVSVLEDRRRLKKEWQRRRKLATLETLWLMLAVSLDTHRASLYEILRLATGQL
Ga0315289_1127347023300032046SedimentMTQPDLRFLAHWIDPTLVAVLESQRRLKKEWHRRRKLATLETLWLMLAVSLDTPLRDHPFGYGRA
Ga0315540_1025169113300032061Salt Marsh SedimentMKQPDLRMLAQWLDPALVTNLETRRRLKKEWHRRRKLPTLQTLWLMLAVSLD
Ga0315295_1042774723300032156SedimentMLKPDLKLLAQWLDPVLVSALEGRRRLKKEWHRRRKLATLETLWLMLAVSLDTQRSSLYEILRLATGQLAIKWSVSVAAFCKA
Ga0315281_1057850533300032163SedimentMTQPDLQLLAQWLDPTLVDAVEDRRRFKKEWHRRRKLATLQTLWLMLAVSLDTHR
Ga0315281_1169299013300032163SedimentMPRPDLQQLAHWVDSTLVALLEERRRQKKEWRRRRKLGTLETLWLMLAVSLDTQRSSLYEILRLATAKLAIPWSISVAAFCK
Ga0315283_1064530033300032164SedimentMTQPDLRMLAQWLDPVLVAMLESRRRLNHEWHRHRKLATLETLWLML
Ga0315283_1223142713300032164SedimentMPRPDLQLLARWLDPTLVATLENRRRLKKEWYRRRKLTTLETLWLMLAVSLDTQRSSLYEILRLT
Ga0315268_1120201013300032173SedimentMPKPDLRLLAQWLDPALMSRLEGKRRLKNEWRRHRKLATLETLWLMLAVSLDTHRSSLHEILRLATGHLDIKWSISVAAFC
Ga0315276_1254836023300032177SedimentMTKPDLRIFAHWLDPALVAELENRRRLKKEWQRHRKLATLQTLWLMLAISLDTHRSSLFEILRLAT
Ga0316192_1011760633300032260Worm BurrowMKLPDLQMLAHWLDPALVATLETRRRLKKEWHRRRKLATLQTLWLMLAVS
Ga0316194_1048344313300032262SedimentMKQLDLRMLAHWLDPALVATLESRRRKKKEWHRRRKLATLQTLWLMLAVSLDTQRSSLHEILRLTTGQLGIQFSVS
Ga0316195_1058821323300032263SedimentMKQPDLRMLAQWLDPALVMELEKRRRLKNEWQRNRKLATLQTLWLMLAVSLDTQRRSLFE
Ga0315275_1221794913300032401SedimentMPKPDLRQLAHWVDATLVASLEERRRQKKEWRRRRKLGTLEALWLMLAVSLDTQRSSLYEILRLATAQLAIPW
Ga0315275_1235070623300032401SedimentMLNPDLRLLTQWLDPALVSGLEGRRRVKKEWHRRRKLATLETLWLMLAVSLDTHRSSLYEILRL
Ga0315275_1259622913300032401SedimentMPRPDLQQLAHWVDATLVALLEERRRQHKEWRRRRKLGTLETLWLMLAVSLDTQRSSLYEILRLAT
Ga0315273_1183089613300032516SedimentLLARWLDPTLVATLENRRRLKKEWCRRRKLTTLETLWLMLALSLDTQRSSLYEI
Ga0335081_1249149213300032892SoilMIKPDLHLLAKWLDPVTVEALDKRRHLKKEWRRSRKLGTLEMLWLMLAVSLNSARSSLHEILR
Ga0335071_1148892923300032897SoilMTEPDLQLLAKWLDTGIVKELDRKRRMRKECSRNRKLGTLGTLWLMLAVSLDTA
Ga0326728_1057742723300033402Peat SoilMPRPDLRMLAQWLDPILVAMLENRRRLKNEWHRHRKLATLETLWLMLAVSLDTHRFSLYEILRLATADIGI
Ga0316605_1130077223300033408SoilMKKLDLQMLAQWLDPVFVAMLETRRRRNHEWHRRRKLATLETLWLMLAV
Ga0316603_1180497523300033413SoilMTKPDLRMLAQWLDPIIVTMLENRRRLNQEWRRHRKLATLETLWLMLAVSLDTQRA
Ga0316619_1094318813300033414SoilMTQPDLQLLAQWLDPTLVAAVEDRRRFNKEWHRRRKLATLQTLWLMLAVSLDTHRSSLFEILRL
Ga0316619_1157609823300033414SoilMKKLDLRMLAQWLDSVFVAMLETRRRRNHGWHRRRKLATLVTLWLMLAVSLDTQRASLYE
Ga0316619_1194862613300033414SoilMTKPDLRMLAQWLDPVLMAMLENRRRLNNEWHRHRKLATLETLWLMLAVSLDTQRAGLYEILRFATAE
Ga0326726_1152595123300033433Peat SoilMLKPDLRLLAQWLYPTLVSVLENRRRLKKEWQRRRKLATLETLWLMLAVSLDSHRASLYEILRL
Ga0326726_1204162523300033433Peat SoilMLRPDLKLLACWLDSALVATLENRRRLKKEWHRRRKLTTLETLWLMLAVSLDTQRSSLFEILRLTTGQLGIPWSVSVAA
Ga0316620_1002791233300033480SoilMRKPDLRLLAQWLDPALVSVLEDRRRLKKEWQRRRKLATLETLWLMLAVSLDTHRDSLYEILRLATGQLALQWSGLTTRS
Ga0316600_1066343623300033481SoilMRKPDLRMLAQWLDPVFVAMLETRRRRNHEWHRRRKLATLETLWLML
Ga0316627_10146721623300033482SoilMSKPDLRQLAHWIDPTLVTLLEQRRRKNKEWRRHRKLGTLETFWLMLAI
Ga0316621_1045638623300033488SoilMAKPDLQQLAHWLDPTLVALLQERRHQRKEWSRHRKLGTLETLWLMLAVSLDTERSSLHEILRLATAHLGIGWSVSVAAFC
Ga0316621_1128018323300033488SoilMTKPDLRMLAQWLDPVLMAMLENRRRLSHEWHRHRKLATLETLWLMLAVSLDTQRASLYEILR
Ga0299912_1053925713300033489SoilMRKPDLRLLAQWLDPALVSVLEGRRRLKKEWQRRRKLATLETLWLMLAVSLDTHR
Ga0316628_10151841223300033513SoilMLNPDLRLLTQWLDPALVSGLEGRRRVKKEWHRRRKLATLETLWLMLAVSLDTHRSSLHEILRLATGELAIRWS
Ga0316628_10166004413300033513SoilMGKPDLRLLAQWLDPALVSVLESRRRLKKEWQRHRKLATLETLWLMLAVSLDTHRSSLYEILRLATGDLAIQWSISV
Ga0316616_10000281873300033521SoilMKKLDLRMLAQWLDSVFVAMLETRRRRNHGWHRRRKLATLVTLWLMLAVSLDTQRASLYEILRLATAQLGVQWSISVAAFC
Ga0316616_10423226023300033521SoilMTKPDLRMLTQWLDPIVVAMLENRRRLNHEWQRHRKLATLETLWLMLAVSLDTQRASLYEILRLAAAELGVQWS
Ga0316617_10060201913300033557SoilMTKPDLRMLAQWLDPIIVTMLENRRRLNQEWRRHRKLATLETLWLMLAVSLDTQRASLYEILR
Ga0326723_0563373_379_5253300034090Peat SoilMLKPDLRLLAQWLDPTLVSVLENRRRLKKEWQRRRKLATLETLWLMLAV
Ga0326724_0378609_558_7583300034091Peat SoilMIKPDLHLLARWLDPVIVEALDKRRNLKNEWRRNRKLGTLGTLWLMLAVSVDTARSSLHEILRLATG
Ga0373573_0187170_396_6383300034782SedimentMKKPDLQLLAKWLDPATVAALESRRRKKKEFHRRRKLATLQTVWLMLAVSLDTRQSSLHDILRLATGRLGIDFSVSVTSFC


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.