NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F057780

Metagenome / Metatranscriptome Family F057780

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F057780
Family Type Metagenome / Metatranscriptome
Number of Sequences 136
Average Sequence Length 87 residues
Representative Sequence MIDAKQAVQIARVKAAEMLNQDSSNLEEIERDSYKDREVWSITLSLPRDVTMLAPFAQLSADPLQYKRFLIDVETGELVAMKLREVASR
Number of Associated Samples 111
Number of Associated Scaffolds 136

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 75.00 %
% of genes near scaffold ends (potentially truncated) 25.00 %
% of genes from short scaffolds (< 2000 bps) 82.35 %
Associated GOLD sequencing projects 101
AlphaFold2 3D model prediction Yes
3D model pTM-score0.78

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (94.853 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland
(9.559 % of family members)
Environment Ontology (ENVO) Unclassified
(28.676 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(45.588 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 19.66%    β-sheet: 30.77%    Coil/Unstructured: 49.57%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.78
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
d.17.1.6: Cystatin/monellind2gu3a12gu30.66
d.17.1.6: Cystatin/monellind2gu3a12gu30.66
d.17.2.1: Amine oxidase N-terminal regiond2oqea22oqe0.63
d.17.2.1: Amine oxidase N-terminal regiond2oqea22oqe0.63
d.17.2.1: Amine oxidase N-terminal regiond1oaca21oac0.61
b.125.1.3: Prokaryotic lipoproteins and lipoprotein localization factorsd2byoa12byo0.61
d.17.4.26: NTF2-liked2cc3a12cc30.61
d.17.2.1: Amine oxidase N-terminal regiond1oaca21oac0.61
b.125.1.3: Prokaryotic lipoproteins and lipoprotein localization factorsd2byoa12byo0.61
d.17.4.26: NTF2-liked2cc3a12cc30.61


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 136 Family Scaffolds
PF01850PIN 19.85
PF14524Wzt_C 4.41
PF00436SSB 2.21
PF01175Urocanase 2.21
PF00480ROK 2.21
PF01844HNH 1.47
PF03466LysR_substrate 1.47
PF10282Lactonase 1.47
PF02350Epimerase_2 1.47
PF13847Methyltransf_31 1.47
PF01894UPF0047 0.74
PF06672DUF1175 0.74
PF13271DUF4062 0.74
PF06230LpxI_C 0.74
PF13242Hydrolase_like 0.74
PF13649Methyltransf_25 0.74
PF01872RibD_C 0.74
PF00905Transpeptidase 0.74
PF08241Methyltransf_11 0.74
PF12697Abhydrolase_6 0.74
PF02781G6PD_C 0.74
PF00977His_biosynth 0.74
PF04093MreD 0.74
PF07920DUF1684 0.74
PF04892VanZ 0.74
PF05988DUF899 0.74
PF16499Melibiase_2 0.74
PF02782FGGY_C 0.74
PF06134RhaA 0.74
PF13386DsbD_2 0.74
PF03235DUF262 0.74
PF08450SGL 0.74
PF01740STAS 0.74
PF02463SMC_N 0.74
PF02646RmuC 0.74
PF01402RHH_1 0.74
PF01019G_glu_transpept 0.74
PF10079BshC 0.74
PF04255DUF433 0.74
PF00072Response_reg 0.74

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 136 Family Scaffolds
COG1940Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domainTranscription [K] 4.41
COG0629Single-stranded DNA-binding proteinReplication, recombination and repair [L] 2.21
COG2987Urocanate hydrataseAmino acid transport and metabolism [E] 2.21
COG2965Primosomal replication protein NReplication, recombination and repair [L] 2.21
COG0381UDP-N-acetylglucosamine 2-epimeraseCell wall/membrane/envelope biogenesis [M] 1.47
COG0707UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferaseCell wall/membrane/envelope biogenesis [M] 1.47
COG2442Predicted antitoxin component of a toxin-antitoxin system, DUF433 familyDefense mechanisms [V] 0.74
COG4806L-rhamnose isomeraseCarbohydrate transport and metabolism [G] 0.74
COG4312Predicted dithiol-disulfide oxidoreductase, DUF899 familyGeneral function prediction only [R] 0.74
COG3494Uncharacterized conserved protein, DUF1009 familyFunction unknown [S] 0.74
COG3391DNA-binding beta-propeller fold protein YncEGeneral function prediction only [R] 0.74
COG3386Sugar lactone lactonase YvrECarbohydrate transport and metabolism [G] 0.74
COG3358Uncharacterized conserved protein, DUF1684 familyFunction unknown [S] 0.74
COG3234Uncharacterized conserved protein YfaT, DUF1175 familyFunction unknown [S] 0.74
COG2891Cell shape-determining protein MreDCell wall/membrane/envelope biogenesis [M] 0.74
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 0.74
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 0.74
COG1479DNAse/DNA nickase specific for phosphorothioated or glycosylated phage DNA, GmrSD/DndB/SspE family, contains DUF262 and HNH nuclease domainsDefense mechanisms [V] 0.74
COG1322DNA anti-recombination protein (rearrangement mutator) RmuCReplication, recombination and repair [L] 0.74
COG0432Thiamin phosphate synthase YjbQ, UPF0047 familyCoenzyme transport and metabolism [H] 0.74
COG0405Gamma-glutamyltranspeptidaseAmino acid transport and metabolism [E] 0.74
COG0364Glucose-6-phosphate 1-dehydrogenaseCarbohydrate transport and metabolism [G] 0.74


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.85 %
UnclassifiedrootN/A5.15 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090015|GPICI_9232644All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium1881Open in IMG/M
2124908038|B3_all_c_ConsensusfromContig97945All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter1284Open in IMG/M
2140918008|ConsensusfromContig356429All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6617Open in IMG/M
2140918024|NODE_395784_length_649_cov_6.399076All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6699Open in IMG/M
3300001213|JGIcombinedJ13530_102857888All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6510Open in IMG/M
3300003154|Ga0052186_10097651All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6628Open in IMG/M
3300003369|JGI24140J50213_10181709All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6661Open in IMG/M
3300003369|JGI24140J50213_10200198All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia623Open in IMG/M
3300005327|Ga0070658_10982222All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6734Open in IMG/M
3300005526|Ga0073909_10687610All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6512Open in IMG/M
3300005530|Ga0070679_100947012Not Available805Open in IMG/M
3300005542|Ga0070732_10089706All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA61804Open in IMG/M
3300005591|Ga0070761_10066981All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2034Open in IMG/M
3300005614|Ga0068856_100762474All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6987Open in IMG/M
3300005921|Ga0070766_11320772All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6500Open in IMG/M
3300006028|Ga0070717_10103183All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2424Open in IMG/M
3300006055|Ga0097691_1030366All Organisms → cellular organisms → Bacteria2140Open in IMG/M
3300006059|Ga0075017_100013558All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5209Open in IMG/M
3300006237|Ga0097621_101229734All Organisms → cellular organisms → Bacteria706Open in IMG/M
3300006642|Ga0075521_10309794All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6761Open in IMG/M
3300006904|Ga0075424_101182369Not Available814Open in IMG/M
3300007982|Ga0102924_1339931All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6583Open in IMG/M
3300009029|Ga0066793_10189009All Organisms → cellular organisms → Bacteria1200Open in IMG/M
3300009038|Ga0099829_11592968All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6539Open in IMG/M
3300009090|Ga0099827_11399848All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6609Open in IMG/M
3300009093|Ga0105240_11873540All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6624Open in IMG/M
3300009137|Ga0066709_103171108All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6600Open in IMG/M
3300009400|Ga0116854_1126594All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6874Open in IMG/M
3300009839|Ga0116223_10903305All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6504Open in IMG/M
3300010373|Ga0134128_11370357All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6779Open in IMG/M
3300010379|Ga0136449_100072689All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae7353Open in IMG/M
3300010379|Ga0136449_100475506All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA62181Open in IMG/M
3300010379|Ga0136449_103209800All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6631Open in IMG/M
3300010379|Ga0136449_104286507All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6528Open in IMG/M
3300012189|Ga0137388_10852424All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae843Open in IMG/M
3300012202|Ga0137363_10601583All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6928Open in IMG/M
3300012212|Ga0150985_102991360Not Available853Open in IMG/M
3300012922|Ga0137394_10231660All Organisms → cellular organisms → Bacteria1579Open in IMG/M
3300012922|Ga0137394_11203915All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6621Open in IMG/M
3300012923|Ga0137359_10945221All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6742Open in IMG/M
3300012923|Ga0137359_11712880All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6516Open in IMG/M
3300012931|Ga0153915_10945188All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA61003Open in IMG/M
3300012971|Ga0126369_12597619All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium591Open in IMG/M
3300013104|Ga0157370_10529784All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1081Open in IMG/M
3300013307|Ga0157372_12940497All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6545Open in IMG/M
3300014151|Ga0181539_1013873All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus5019Open in IMG/M
3300014156|Ga0181518_10025290All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus3967Open in IMG/M
3300014156|Ga0181518_10134863All Organisms → cellular organisms → Bacteria1339Open in IMG/M
3300014158|Ga0181521_10547983All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6548Open in IMG/M
3300014159|Ga0181530_10415421All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6682Open in IMG/M
3300014161|Ga0181529_10645490All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6549Open in IMG/M
3300014162|Ga0181538_10128090All Organisms → cellular organisms → Bacteria → Acidobacteria1472Open in IMG/M
3300014168|Ga0181534_10238060All Organisms → cellular organisms → Bacteria962Open in IMG/M
3300014489|Ga0182018_10114125All Organisms → cellular organisms → Bacteria1571Open in IMG/M
3300014491|Ga0182014_10001816All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus27849Open in IMG/M
3300014491|Ga0182014_10037559All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → unclassified Pedosphaera → Pedosphaera sp.3572Open in IMG/M
3300014491|Ga0182014_10150257All Organisms → cellular organisms → Bacteria1315Open in IMG/M
3300014491|Ga0182014_10606664All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6527Open in IMG/M
3300014492|Ga0182013_10097765All Organisms → cellular organisms → Bacteria1993Open in IMG/M
3300014496|Ga0182011_10312781All Organisms → cellular organisms → Bacteria1040Open in IMG/M
3300014496|Ga0182011_10582026All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6714Open in IMG/M
3300014499|Ga0182012_10021955All Organisms → cellular organisms → Bacteria5682Open in IMG/M
3300014501|Ga0182024_10083072All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales4761Open in IMG/M
3300014501|Ga0182024_11256729All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6862Open in IMG/M
3300014501|Ga0182024_11646667All Organisms → cellular organisms → Bacteria725Open in IMG/M
3300014501|Ga0182024_11846908Not Available674Open in IMG/M
3300014502|Ga0182021_10081728All Organisms → cellular organisms → Bacteria3752Open in IMG/M
3300014502|Ga0182021_10294192All Organisms → cellular organisms → Bacteria1911Open in IMG/M
3300014502|Ga0182021_10697983All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1217Open in IMG/M
3300014502|Ga0182021_13217494All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6545Open in IMG/M
3300014655|Ga0181516_10722771Not Available517Open in IMG/M
3300014655|Ga0181516_10727683All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300014838|Ga0182030_10808626All Organisms → cellular organisms → Bacteria856Open in IMG/M
3300014839|Ga0182027_10730854All Organisms → cellular organisms → Bacteria1045Open in IMG/M
3300014839|Ga0182027_10996167All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6859Open in IMG/M
3300015069|Ga0167633_100148All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales34538Open in IMG/M
3300017935|Ga0187848_10043706All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA62190Open in IMG/M
3300017946|Ga0187879_10570814All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3628Open in IMG/M
3300017998|Ga0187870_1160746All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6814Open in IMG/M
3300018015|Ga0187866_1093720All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA61252Open in IMG/M
3300018016|Ga0187880_1190561Not Available936Open in IMG/M
3300018035|Ga0187875_10779495All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6500Open in IMG/M
3300018037|Ga0187883_10406186All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6698Open in IMG/M
3300018043|Ga0187887_10304898All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3941Open in IMG/M
3300018043|Ga0187887_10710816All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6593Open in IMG/M
3300018044|Ga0187890_10107771All Organisms → cellular organisms → Bacteria → Acidobacteria1616Open in IMG/M
3300018044|Ga0187890_10303408All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6897Open in IMG/M
3300018044|Ga0187890_10868467All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6509Open in IMG/M
3300018046|Ga0187851_10312004All Organisms → cellular organisms → Bacteria910Open in IMG/M
3300018059|Ga0184615_10356473All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6809Open in IMG/M
3300018083|Ga0184628_10027864All Organisms → cellular organisms → Bacteria2810Open in IMG/M
3300019458|Ga0187892_10064618All Organisms → cellular organisms → Bacteria2384Open in IMG/M
3300019788|Ga0182028_1522276All Organisms → cellular organisms → Bacteria1736Open in IMG/M
3300019890|Ga0193728_1362913All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6515Open in IMG/M
3300020579|Ga0210407_10853907All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6700Open in IMG/M
3300020580|Ga0210403_11258499All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6567Open in IMG/M
3300020583|Ga0210401_11355188All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6569Open in IMG/M
3300021178|Ga0210408_10510443All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6955Open in IMG/M
3300021374|Ga0213881_10005371All Organisms → cellular organisms → Bacteria5293Open in IMG/M
3300021432|Ga0210384_10019408All Organisms → cellular organisms → Bacteria6583Open in IMG/M
3300021433|Ga0210391_10166281All Organisms → cellular organisms → Bacteria1737Open in IMG/M
3300021478|Ga0210402_11531137All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6594Open in IMG/M
3300021559|Ga0210409_10810581All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium809Open in IMG/M
3300021861|Ga0213853_11148203All Organisms → cellular organisms → Bacteria → Acidobacteria687Open in IMG/M
3300022467|Ga0224712_10263151Not Available799Open in IMG/M
3300022557|Ga0212123_10858666All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6539Open in IMG/M
3300023068|Ga0224554_1069023All Organisms → cellular organisms → Bacteria869Open in IMG/M
3300025527|Ga0208714_1042799All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA61009Open in IMG/M
3300025619|Ga0207926_1079814All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6832Open in IMG/M
3300025725|Ga0209638_1014168All Organisms → cellular organisms → Bacteria4034Open in IMG/M
3300025725|Ga0209638_1175894All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6666Open in IMG/M
3300025909|Ga0207705_10797476All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6733Open in IMG/M
3300025913|Ga0207695_11657513All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6520Open in IMG/M
3300025944|Ga0207661_10199819All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1757Open in IMG/M
3300026078|Ga0207702_10913711All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6870Open in IMG/M
3300027842|Ga0209580_10065975All Organisms → cellular organisms → Bacteria1712Open in IMG/M
3300027853|Ga0209274_10273519All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6866Open in IMG/M
3300027854|Ga0209517_10216029All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA61172Open in IMG/M
3300027911|Ga0209698_10320249All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA61224Open in IMG/M
3300030760|Ga0265762_1033174All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales987Open in IMG/M
3300031236|Ga0302324_101327173All Organisms → cellular organisms → Bacteria → Acidobacteria948Open in IMG/M
3300031708|Ga0310686_106091024All Organisms → cellular organisms → Bacteria970Open in IMG/M
3300031726|Ga0302321_101684145All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6733Open in IMG/M
3300031962|Ga0307479_10473612All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1236Open in IMG/M
3300032160|Ga0311301_10169484All Organisms → cellular organisms → Bacteria3864Open in IMG/M
3300032160|Ga0311301_10189465All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3564Open in IMG/M
3300032160|Ga0311301_12506470All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6577Open in IMG/M
3300032770|Ga0335085_11118610All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium843Open in IMG/M
3300032805|Ga0335078_11378307All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7798Open in IMG/M
3300033402|Ga0326728_10411800All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1148Open in IMG/M
3300033480|Ga0316620_10097572All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia2213Open in IMG/M
3300033482|Ga0316627_100086679All Organisms → cellular organisms → Bacteria2088Open in IMG/M
3300033887|Ga0334790_084938All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41063Open in IMG/M
3300033891|Ga0334811_049930All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA61126Open in IMG/M
3300034065|Ga0334827_087041All Organisms → cellular organisms → Bacteria1056Open in IMG/M
3300034128|Ga0370490_0255893All Organisms → cellular organisms → Bacteria → Acidobacteria578Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland9.56%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog7.35%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil6.62%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen6.62%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.88%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil5.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.88%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog5.15%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.94%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.94%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost2.94%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil2.94%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.21%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil2.21%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.21%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring1.47%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.47%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.47%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.47%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.47%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.47%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.47%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.47%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.74%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.74%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.74%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.74%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.74%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.74%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.74%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.74%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.74%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.74%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.74%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.74%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.74%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.74%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.74%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.74%
Bio-OozeEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze0.74%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.74%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.74%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.74%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.74%
BioreactorEngineered → Bioreactor → Unclassified → Unclassified → Unclassified → Bioreactor0.74%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090015Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
2124908038Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3EnvironmentalOpen in IMG/M
2140918008Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_allEnvironmentalOpen in IMG/M
2140918024Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_allEnvironmentalOpen in IMG/M
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300003154Anode biofilm microbial communities from J. Craig Venter Institute, USA, in microbial fuel cellsEngineeredOpen in IMG/M
3300003369Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 002-22AEnvironmentalOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006055Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006642Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-DEnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300007982Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaGEnvironmentalOpen in IMG/M
3300009029Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009400Soil microbial community of the Robinson Ridge, Antarctica. Combined Assembly of Gp0139162, Gp0138857, Gp0138858EnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014151Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaGEnvironmentalOpen in IMG/M
3300014156Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaGEnvironmentalOpen in IMG/M
3300014158Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaGEnvironmentalOpen in IMG/M
3300014159Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaGEnvironmentalOpen in IMG/M
3300014161Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaGEnvironmentalOpen in IMG/M
3300014162Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaGEnvironmentalOpen in IMG/M
3300014168Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014492Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaGEnvironmentalOpen in IMG/M
3300014496Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaGEnvironmentalOpen in IMG/M
3300014499Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014655Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015069Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4C, Ice margin, adjacent to proglacial lakeEnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017998Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150EnvironmentalOpen in IMG/M
3300018015Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150EnvironmentalOpen in IMG/M
3300018016Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300018059Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coexEnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300019458Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaGEnvironmentalOpen in IMG/M
3300019788Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300019890Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021374Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08EnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021861Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022467Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300023068Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 20-24EnvironmentalOpen in IMG/M
3300025527Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025619Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025725Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-211 (SPAdes)EnvironmentalOpen in IMG/M
3300025909Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300030760Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033480Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_BEnvironmentalOpen in IMG/M
3300033482Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_CEnvironmentalOpen in IMG/M
3300033887Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1EnvironmentalOpen in IMG/M
3300033891Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-1-DEnvironmentalOpen in IMG/M
3300034065Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 1-5EnvironmentalOpen in IMG/M
3300034128Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_16EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPICI_000926602088090015SoilMITVKEAVQIAKAKAAEMLDKDSSNLEEIERDSYKGREIWSITLSIPRDVNQLPPLDRLAADPLQYKRFLIDVETGDLLAMKLRETASR
B3_all_c_035257402124908038SoilMIDAKQAVQIAREQAAGLFSQPSSNLEEIERDSYKARDVWSITLSLRRDLTQLSPLALLAASPLQYTRFLIDVETGELVAVKMRELASQ
Bog_all_C_025591802140918008SoilKQAVQIAREQAAGLLNQASFNLEEIDRDSYRGREVWSITLSLRRDLTQLSPFAQLASVPLQYTRFLIDVETGELVAVKLREVAAQ
B_all_v_016668102140918024SoilMIEVKQAVQIARERAADMLDQASFNLEEIDRDSYRGREVWSITLSLPRFAKQPSLSPFAELTADPLQYKRFLIDVETGELVAMKLREVASR
JGIcombinedJ13530_10285788823300001213WetlandMIDMKQAVQIAKSAAVDLLTETTTNLEEVERESYKGREVWSITLSLPRVMKQVLPVIAAFSVDRLQYKRFLIDVETGELVAMQLRDVASQ*
Ga0052186_1009765123300003154BioreactorMTIDVKQAVDIAKQQAACMLDQGQANLEEIERDVYKGREVWDITLSFPRDPEQISPLMRFGTNLLQYKRFLIDVQTGDLVAIKLRELASR*
JGI24140J50213_1018170923300003369Arctic Peat SoilMIDVKQAVQLAKAGAADLLDQSSSRLEEIERRTYNDRDVWSITLGLPRDQREISLMAPIARLTAGPLEYKRFLIDVETGELVAMQLREVASQ*
JGI24140J50213_1020019823300003369Arctic Peat SoilMIDVKQAVQNAKKEAWNLLDQASSNLEEIERHSYNGREVWSITLSVPRNAKLTGPFAELVAEPLQYKRFLIDVETGELVAMQLREVASR*
Ga0070658_1098222223300005327Corn RhizosphereIAKAKAAEMLDKDSSNLEEIERDSYKGREIWSITLSIPRDVNQLPPLDRLAADPLQYKRFLIDVETGDLLAMKLRETASR*
Ga0073909_1068761013300005526Surface SoilGGVMIDRKQAVEIARAEAATLLGQGLSSLEEIEKDSYKGREIWSITLSLPRDMTQLTGLAQLTANPLQYKRFLIDAETGELVAMQRREVTSQ*
Ga0070679_10094701213300005530Corn RhizosphereMITVKEAVQIAKAKAAEMLDKDSSNLEEIERDSYKGREIWSITLSIPRDVNQLPPLDRLAADPLQYKRFLIDVETGDLLAMKLRETASR*
Ga0070732_1008970623300005542Surface SoilMRSEHNSGEFSCQYEVGDVAMIDAKQAVQIAKQKAVELLNQNASGLEEIERVSYRDHEVWSITLSLPRDPTQLAPLAQLAQLSADPLQYKRFLIDVSSGELIAMKLREVSLQ*
Ga0070761_1006698123300005591SoilMVDVKQAIQIAKEEAAGMLNQASSNLEEIEKDSYRGREVWSITLSLPRDMTQLQGLAVLRADPLQYKRFLIDVETGELVAMKVREVASQ*
Ga0068856_10076247423300005614Corn RhizosphereMIEVKQAVQIAKAKAAEILEKGSSNLEEIERDTYKARDIWSITLSIPRDVDQLPVMARFSADPLQYKRFLIDADTGELLAIQLRETASR*
Ga0070766_1132077223300005921SoilMVDVKQAIQIAKEEAAEMLNQASSNLEEIEKDSYRGREVWSITLSLPRDMTQLQGLAILRADPLQYKRFLIDVETGELVAMKVREVASQ*
Ga0070717_1010318323300006028Corn, Switchgrass And Miscanthus RhizosphereMIDAKQAVQIAKQKAVELLNQNAFGLEEIERGSYRDHDVWSITLSLPRDPTQLAPLAQLAQLSADPLQYKRFLIDVNSGELIAMKLREVSLQ*
Ga0097691_103036633300006055Arctic Peat SoilMIDVKQAVQIARQGALELLSQAASTLEEIERDSYKGRDVWSITLGLRRDVSQLSGLAQLAADPLQYKRFLIDVETGELVAVKLREVASQ*
Ga0075017_10001355833300006059WatershedsMNRGGERMIDAKQAVQVAKAKALEMLAQASSSLEEIERESYKGREVWSITLSLPRDVSHLAPIAQLAADKMQYKRFLIDAKTGDFVAMKVREVASP*
Ga0097621_10122973423300006237Miscanthus RhizosphereMIDRKQAVEIARAEAATLLGQGLSSLEEIEKDSYKGREIWSITLSLPRDMTQLTGLAQLTANPLQYKRFLIDAETGELVAMQRREVTSQ*
Ga0075521_1030979423300006642Arctic Peat SoilMIDRKQAVEIARVEAASLLGQGSSSLEEIERDSYKGREIWSITLALPRDVNKLPPFAQLTANPLQYKRFLIDVETGELVAMQLRDVASQQ*
Ga0075424_10118236923300006904Populus RhizosphereMIDATQAVQIAKQRAAEMLDPNNFKLEEIQRETCKDRDVWSLTLSYPRDLDQLSQMARLATDPIQYKRFLIDVETGELVAMKLRAPASQ*
Ga0102924_133993113300007982Iron-Sulfur Acid SpringMIDVKQAVQVAKAKAAEMLNQGSSNLEEIEREIYKGRDVWSITLSIPRDIEQIPGFARLSADPLQYKRFLIDSETGDLLRIPTM*
Ga0066793_1018900933300009029Prmafrost SoilMIDRKQAVEIAKVEAANLLGQGLSGLEEIERDTYKGREVWSITLSLPRDMKQLTAFAQLTASPLQYKRFLIDVETGELVAMQRHEVSLR*
Ga0099829_1159296823300009038Vadose Zone SoilDMLNQSSFNLEEIERGDYKNREVWSITLSLPRDVKQLAPFAQLSADPLQYKRFLIDAETGEFVAMKLREVASQ*
Ga0099827_1139984813300009090Vadose Zone SoilMLAQFNTKLEEIERESYKDREVWSLTLSYPRDLNQLSPMASLAADPLQYKRFLIDVETGEFVAMKLREPASQ*
Ga0105240_1187354023300009093Corn RhizosphereMVDRKQAVEIAMAEAENLLGQGSFSLEEIERDSYKGRDIWSVTLGVPRNMKLLPPFAQLTASPVEYKRFLIDVETGELVAMQRHEVASRQ*
Ga0066709_10317110823300009137Grasslands SoilMIDRKQAVEIAMAEAANLLGQGSSSLEEIERDSYKGRDIWSITLGVPRNMKLLPPFAQLTASPVEYKRFLIDVETGELVAMQRHEVASRQ*
Ga0116854_112659423300009400SoilRSASSLEEVERDTYKTHDVWSITLSIPRDIDHLPTMARLSADPLQYKRFLIDAETGELLAIQLRETASR*
Ga0116223_1090330513300009839Peatlands SoilGGESQMINAKQATLLAKQQAAEMLGQASSNLEELERGRYLDHEVWQITLSFPRNLDQLSTLERLGADPLQYKRFLIDVETGELVAMKLREPASP*
Ga0134128_1137035713300010373Terrestrial SoilAKAAEILEKGSSNLEEIERDTYKARDIWSITLSIPRDVDQLPVMARFSADPLQYKRFLIDADTGELLAIQLRETASR*
Ga0136449_10007268963300010379Peatlands SoilMIDAKQAVLLARSKAAEMLGAGVSYLEEIERESYRDREVWSITLSFMRNLDQLPALSRLNADPLQYKRFLIDLETGELVAMKLREVALL*
Ga0136449_10047550623300010379Peatlands SoilMINAKQATLLAKQQAAEMLGQASSNLEELERGRYLDHEVWQITLSFPRNLDQLSTLERLGADPLQYKRFLIDVETGELVAMKLREPASP*
Ga0136449_10320980023300010379Peatlands SoilMIEAKQAVQIAKQRAADMLGESNFNLEEIEREPYKEREVWGITLSFPRDPNQLPLMARLGADPLQYKRFLIDVETGDLVAMKLREFISR*
Ga0136449_10428650713300010379Peatlands SoilVIDAKQATKLGMQAAADMLGQVHSNLEELERETYNGHEVWSITLSMPRNLGQLGPLVRIGADRLQYKRFLIDVTTGELVAMKLRELAFP*
Ga0137388_1085242423300012189Vadose Zone SoilMIEAKQAVQIAKEKAMDMLNQSSFNLNLEEIERGEYKNREVWSITFSLPRDLKQLAPFAQLSADPLQYKRFLI
Ga0137363_1060158313300012202Vadose Zone SoilMIDATQAVQIAKQKAEDILNLNSSVLEEIERESYKDRDVWSITLSLPRDLTLLHPLAQLSADTVQYRRFLIDVETGELVAMKLREVASQ*
Ga0150985_10299136023300012212Avena Fatua RhizosphereVVLDAKQAVEIAKTRAEEVLGPGVFSLEEIERETYKDREVWSITLSSPRNLEHLAPMALLRADPLQYKRFLIDAANGELIAMKLREPASQ*
Ga0137394_1023166023300012922Vadose Zone SoilMIDAKKAVQIAKEKAVEILNQSSSNLEEIERDSYKDRDVWSITLSMPRDLAHLTPVAKLSAEPLQYKRFLIDVETGELVAMKLREVASQ*
Ga0137394_1120391523300012922Vadose Zone SoilMIDAKQAVQIAKVRAEEMLGSSNFKLEEIERESYKDREVWSLTLSYPRDLDQLSQMARLATDPLQYKRFLIDVETGELVAMKLPEPASR*
Ga0137359_1094522123300012923Vadose Zone SoilMIDAKRAVQIAREKAAELLTQTSSNLEEIERDSYKDREVWSITLSLPRKMIELAPLAQLSADPVQYKRFLIDVETGELVAMKVRDVALQ*
Ga0137359_1171288023300012923Vadose Zone SoilMVDAKRAIQIAKEKAVELLNQTSSSLEEIERGSYKDREVWSITLSLPRDMNQLHAFARLSADPLQYKRFLIDVETGELVAMKVREVALQ*
Ga0153915_1094518823300012931Freshwater WetlandsAKQAIQIAQERAADMLSRSDLNLEEIGRESYRDREVWNITLSFSRDLERLPPIARLGADPLQYKRFLIDVETGELVAMKFRE*
Ga0126369_1259761923300012971Tropical Forest SoilMIDAKQAVQIAKQRAADLLGQNVFNLEEIERGLDNARDVWSITLSFPRDLDALSAITRLGADRLQYKRFLIDVTTGELVAMRLREPAAQ*
Ga0157370_1052978423300013104Corn RhizosphereMVDRKQAVEIAMAEAENLLGQGSSSLEEIERDSYKGRDIWSITLGLPRNMNLLPPFAQLTASPVEYKRFLIDVETGELVAMQRHEVASRQ*
Ga0157372_1294049723300013307Corn RhizosphereMVDRKQAVEIAMAEAENLLGQGSFSLEEIERDSYKGREIWSITLSIPRDVNQLPPLDRLAADPLQYKRFLIDVETGDLLAMKLRETASR*
Ga0181539_101387363300014151BogMIEVKQAVQIAKERAADMLGQASLNLEEIERDSYKGRDVWSITLSLPQYVKPQLNVFTQLSADPLQYKRFLIDVETGELVAIKLREAASR*
Ga0181518_1002529033300014156BogMIEVKQAVQIAREKAADMLDQTSFNLEEIERESYKGREVWSITLSLPRNLEQVSPMAALSADPLQYKRFLIDVETGELVAIKLREVASQ*
Ga0181518_1013486333300014156BogMIEVKQAVQIAKEKAVDMLGQASLNLEEIERDSYKGREVWSITLSLPRYVQPKENVFTFSADPLQYKRFLIDVETGELVAMKVRETASR*
Ga0181521_1054798313300014158BogMLGQASLNLEEIESDSYKGREVWSITLSLPRYVQPKENVFTFSADPLQYKRFLIDVETGELVAMKVRETASR*
Ga0181530_1041542123300014159BogMIEVKQAVQIAKEKAVDMLGQASLNLEEIERDSYKGREVWSITLSLPRYVQPKENVFTFSADPLQYKRFLIDVETGELVAMKLRETTSR*
Ga0181529_1064549013300014161BogMIEVKQAVQIAKEKAVDMLGQASLNLEEIERDSYKGREVWSITLSLPRYVQPKENVFTFSADPLQYKRFLIDVDTGELLAIKLREVASR*
Ga0181538_1012809013300014162BogMIEVKQAVQIAREKAADMLDQTSFNLEEIERESYKGREVWSITLSLPRNLEQVSPMAALSADPLQYKRFLIDVETGEL
Ga0181534_1023806023300014168BogMISVKTAVEIAKAKAGEILEQGSSNLEEIERESYKDRDVWSITLSIPRDMDLLPVMARLSADPLQYKRFLIDAETGDLLAIKLREVASQ*
Ga0182018_1011412523300014489PalsaMIEAKEAVLIAKSKAEEMLGARASSLEEIERESYRDREVWSITLGIPRNPVNMLSPELDRLRFSLGADPLQYKRFLIDVETRELVAMKLREVALP*
Ga0182014_10001816193300014491BogMIDVKQAVQIAKTKAVEMFGQTAINLEEIERDVYKGCDVWSITLSLPQDLRQLNPLAAALGTDRLRYKRFLIDVETGELVAMKLREVASQ*
Ga0182014_1003755933300014491BogMLSQASSNLEEIERDTYKGREVWNITLSLPRDVSQLTSFAQLAADPLQYKRFLIDAETGELLAVKLREVASQ*
Ga0182014_1015025723300014491BogMIEVKQAVQIAREKAADMLDQTSFNLEEIERESYKGRDVWSITLSLPRNLKQVSPMAALSADPLQYKRFLIDVETGELLAIKLREVASQ*
Ga0182014_1060666423300014491BogIAKTKAAEMLGQASLYLEEIERESYKDREVWSITLSLPRYEDPIPHPLQILPVDRLQYKRFLIDAETGELVAIKLREVASR*
Ga0182013_1009776533300014492BogMIDAKQAVLIAKQKAAEMLDQDPAKSNLEEIERESYKGREVWSITLSLPRDLERLQGLAQLAADPLQYKRLLIDAETGDLVAMKLREAA*
Ga0182011_1031278123300014496FenMIDAIQAVQIAKEQALHMLGQSSATLEEIEKETHKDREVWSITLSYPRDLSHLSSIARIGIEPLQYKRFLIDVETGDLVAVRLREPAAR*
Ga0182011_1058202613300014496FenMIEVKQAVQIAKERAADMLDQASFNLEEIDRDSYRGREVWSITLSLPRFAKQSSLSPFAELTADPLQYKRFLIDVETGELVAMKLREVASR*
Ga0182012_1002195523300014499BogMIDAKQAVLIAKQKAAEMLDQDPAKSNLEEIERESYKGREVWSITLSLPRDLEWLQGLAQLAADPLQYKRLLIDAETGDLVAMKLREAA*
Ga0182024_1008307233300014501PermafrostMIEAKEAVQIAKQRAADMLGQNTFSLEEIEREPYRDREVWGITLGFPRDPNQLTAIARFVADPIQYKRFLIDVETGDLVAMRLREPASR*
Ga0182024_1125672913300014501PermafrostMIDAKQAVLIARQKAAEMLDQDPAKSSLEEIERESYKGRDVWSITLSLPRDLERLQGLAQLAADPLQYKLFLIDVETGDLVAMKLREAA*
Ga0182024_1164666713300014501PermafrostMINAKQAVLVAKQKAAEMLDQPPAKTSLEEIERESYKGREVWSITLSLPRDLERLQGLAQLAADPLQYKLFLIDAETGELVAMKL
Ga0182024_1184690813300014501PermafrostSNRKTKAAVMLHQPPAKLSLEEIERESYKGREVWSITLRLLRDLERLQGLAQLAADPLPYKLFLIDAETGDLVAMKLREPASQ*
Ga0182021_1008172843300014502FenMIDAKQAVQIAKQRAADMLGWSIATLEEIERESHKDREAWSITLGFPRALDALSPITRIGADPLQYKRFLIDVETGDLVAIRLREPVVR*
Ga0182021_1029419223300014502FenMIDVKQAVQIAREKAADLLNQSTSNLEEVERDSYKAREVWSITLSLRRDLTQLSPFAQLAAVPLQYTRFLIDVETGELVAVKMREVAAQ*
Ga0182021_1069798313300014502FenMIDAKQAIQIAKAGAADLLDQAASSLEEIGRDSYKDRDVWSITLSGPRDLRLLAPIAQLAAPPLDYKRFLIDVETGELVAMQLREVASQ*
Ga0182021_1321749423300014502FenMIDRKQAVENARVEAASPLRQGSSSLEEIERDSYKGREIWSITLALPRDVNKLPPFAQLTANPLQYKRFLIDVETGELVAMQLRDVASQQ*
Ga0181516_1072277113300014655BogQIAKTKAAEMFGQAVINLEEIERDVYKGCDVWSITLSLPQDLRQLNSLAAALGTDRLRYKRFLIDVETGELVAMKLREVASQ*
Ga0181516_1072768313300014655BogMIDVKQAVQIAKAKAAEMLEKDSFNLEEIERDSYKSRDVWSITLSAPRDVNDVSAIFGIKSDPLQYKRFFIDAETGEL
Ga0182030_1080862613300014838BogMLSQASSNLEEIERDTYKGREVWNITLSLPRDVSQLTGFAQLAADPLQYKRFLIDAETGELLAVKLREVASQ*
Ga0182027_1073085433300014839FenQASSNLEEIERDTYKGREVWNITLSLPRDVSQLTGFAQLAADSLQYKRFLIDAETGELLAVKLREVASQ*
Ga0182027_1099616723300014839FenMTDVKQAVQIAKAGAADLLGKHSSTLEEIERRTYNGRDVWSITLGLPRDPREISLLAPIARISADPLQYKRFLIDVETGELVAMQLREVASQ*
Ga0167633_100148283300015069Glacier Forefield SoilMIDAKKAVQIAKEKAAEILNQSWSNLEEIERDSYRDRDVWSITLSMPRDLNQLSAILRLSAEPLQYKRFLIDVETGELVAMKLREVASQ*
Ga0187848_1004370623300017935PeatlandMIEVKQAVQIAKERAADMLGQASLNLEEIERDSYKGRDVWSITLSLPQYVKPQLNVFTQLSADPLQYKRFLIDVETGELVAIKLREAASR
Ga0187879_1057081423300017946PeatlandMIDVKQAVQIAKTKAAEMFGQAVINLEEIERDVYKGCDVWSITLSLPQDLRQLNPLAAALGTDRLRYKRFLIDVETGELVAMKLREVASQ
Ga0187870_116074613300017998PeatlandVLGQGITTLEEIERETYKDREVWSITLSFPRDLDQLAPIARIATDPIQYKRFLIDVETGDLVAMRLREPAAR
Ga0187866_109372033300018015PeatlandMIDAKQAVQIAKQRAADVLGQGITTLEEIERETYKDREVWSITLSFPRDLDQLAPIARIATDPIQYKRFLIDVETGDLVAMRLREPAAR
Ga0187880_119056133300018016PeatlandMIDVKHAVQIAKTKAVEMFGQTAINLEEIERDVYKGCDVWSITLSLPQDLRQLNPLAAALGTDRLRYKRFLIDVETGELVAMKLREVASQ
Ga0187875_1077949523300018035PeatlandMVEVKQAVQIAKEKAVDMLGQASLNLEEIERDSYKGREVWSITLSLPRYVQPKENVFTFSADPLQYKRFLIDVETGELVAMKVRETASR
Ga0187883_1040618623300018037PeatlandMIDVKQAVQIAKTKAVEMFGQTAINLEEIERDVYKGCDVWSITLSLPQDLRQLNPLAAALGTDRLRYKRFLIDVETGELVAMKLREVASQ
Ga0187887_1030489823300018043PeatlandMIDVKQAVQIAKTKAAEMFGQAVINLEEIERDVYKGCDVWSITLSLPQDLRQLNSLAAALGTDRLRYKRFLIDVETGELVAMKLREVASQ
Ga0187887_1071081623300018043PeatlandAKEAVQSAKTKAAEMLGQASLYLEEIERESYKDREVWSITLSLPRYEDPIPHPLQILPVDRLQYKRFLIDAETGELVAIKLREVASR
Ga0187890_1010777123300018044PeatlandMIDAKQAVQIVKEKAADMLGQASSSLEEIERESYKDRDVCSITLSLPRDLEQLSTLARLSADPLQYKRFLIDVETGELVAMKLREVASQ
Ga0187890_1030340823300018044PeatlandMIDVKQAVQIAKEKAAEMLDSGSASLEEIERETYKGRDVWSITLGLPRDLMALPAILRYSAGLLEYKRFLIDVETGEFVAMRMREVTSA
Ga0187890_1086846723300018044PeatlandMIEVKQAVQIAREKAAEMLDQTSFNLEEIERESYKGREVWSITLSLPRNLKQVSPVAALSADPLQYKRFLIDVETGELLALKLREVASQ
Ga0187851_1031200433300018046PeatlandMIDVKQAVQIAKTKAVEMFGQTAINLEEIERDVYKGCDVWSITLSLPQDLRQLNSLAAALGTDRLRYKRFLIDVETGELVAMKLREVASQ
Ga0184615_1035647323300018059Groundwater SedimentWVQVAMIDTKRAVQIAKEKAADMLNESSFNLEEIERESYKDRDVWSITLSFPRDLSPVPPLVRLGTDPLQYKRFLIDVETGELVAMKLRELASR
Ga0184628_1002786423300018083Groundwater SedimentMIDRKQAVEIAKAEAATLLGQGLSSLEEIEKDSYKGREIWSITLSLPRDMKQLTGLAQLTANPLQYKRFLIDAETGELVAMQRREVTSQ
Ga0187892_1006461823300019458Bio-OozeMVDVKQAVEIAKVKAREMLTGGPYNLEEIERESYRDRDVWSITISFPRDLHQVPSVARLGADPMQYKRFLIDVETGELVAMKLREVASR
Ga0182028_152227623300019788FenMIDAIQAVQIAKEQALHMLGQSSATLEEIEKETHKDREVWSITLSYPRDLSHLSSIARIGIEPLQYKRFLIDVETGDLVAVRLREPAAR
Ga0193728_136291313300019890SoilMIDAKQAVQIAKAKAAEMLNQGSSNLEEIERDSYKDREVWSVTLSLPRDVTMLAPFAQLSADPLQHKRFLIDVETGELVAMKLREVASR
Ga0210407_1085390723300020579SoilMIDAKKAVEVARAEATDMLNQTSPNLEEIERDSYKGREVWSITLSLPRDVRQLPPVAQHFADPLQYKRFLIDVETGELVAMKLREVASR
Ga0210403_1125849913300020580SoilMIDAKQAVQIAKARAAEMLNQASSNLEEIERDSYKDREVWSITRSLPRDVTMLAPFAQLSADPLQYKRFLIDVETGELVAMKLREVASR
Ga0210401_1135518823300020583SoilMIDAKKAVEVARAEATDMLNQTSSNLEEIERDSYKGREVWSITLSLPRDVRQLPPVAQHFADPLQYKRFLIDVETGELVAMKLREVASR
Ga0210408_1051044333300021178SoilMIDAKKAVEIARAEATDMLNQTSSNLEEIERDSYKGREVWSITLSLPRDVRQLPPVAQHFADPLQYKRFLIDVETGELVAMKLREVASR
Ga0213881_1000537143300021374Exposed RockMIDVKQAVQIAKAKAIEILEKNSSTLEEIEREMYKGRDVWFITLSVPRDVEELPVMARLSADPLQYKRFLIDAETGELAAIQLRETASR
Ga0210384_1001940883300021432SoilMIEAKQAVHIAKEKAAEMLGQASSGLEEIERETYKDRDVWSITLSFPRDLNQVAPFLKLSVDPLQYKRFLIDVQTGDLLAMKLREVASR
Ga0210391_1016628113300021433SoilIAKEEAAEMLNQASSNLEEIEKDSYRGREVWSITLSLPRDMTQLQGLAVLRADPLQYKRFLIDVETGELVAMKVREVASQ
Ga0210402_1153113723300021478SoilMIDAKQAVQIARVKAAEMLNQDSSNLEEIERDSYKDREVWSITLSLPRDVTMLAPFAQLSADPLQYKRFLIDVETGELVAMKLREVASR
Ga0210409_1081058123300021559SoilMIEAKQAVHIAKEKAAEMLGQAWSGLEEIERETYKDRDVWSITLSFPRDLNQVAPFLKLSVDPLQYKRFLIDVQTGDLLAMKLREVASR
Ga0213853_1114820323300021861WatershedsMNRGGERMIDAKQAVQVAKAKALEMLAQASSSLEEIERESYKGREVWSITLSLPRDVSHLAPIAQLAADKMQYKRFLIDAKTGDFVA
Ga0224712_1026315113300022467Corn, Switchgrass And Miscanthus RhizosphereMITVKEAVQIAKAKAAEMLDKDSSNLEEIERDSYKGREIWSITLSIPRDVNQLPPLDRLAADPLQYKRFLIDVET
Ga0212123_1085866613300022557Iron-Sulfur Acid SpringMIDVKQAVQVAKAKAAEMLNQGSSNLEEIEREIYKGRDVWSITLSIPRDIEQIPGFARLSADPLQYKRFLIDSETGDLLRIPTM
Ga0224554_106902323300023068SoilMLSQASSNLEEIERDTYKGREVWNITLSLPRDVSQLTSFAQLAADPLQYKRFLIDAETGELLAVKLREVASQ
Ga0208714_104279913300025527Arctic Peat SoilMIDVKQAVQNAKKEAWNLLDQASSNLEEIERHSYNGREVWSITLSVPRNAKLTGPFAELVAEPLQYKRFLIDVETGELVAMQLREVASR
Ga0207926_107981423300025619Arctic Peat SoilRGGDCVMIDVKQAVQIARQGALELLSQAASTLEEIERDSYKGRDVWSITLGLRRDVSQLSGLAQLAADPLQYKRFLIDVETGELVAVKLREVASQ
Ga0209638_101416823300025725Arctic Peat SoilMIDVKQAVQIARQGALELLSQAASTLEEIERDSYKGRDVWSITLGLRRDVSQLSGLAQLAADPLQYKRFLIDVETGELVAVKLREVASQ
Ga0209638_117589423300025725Arctic Peat SoilEQAAALFSQPSSNLEEIERDSYKARDVWSITLSLRRDLTQLSPLALLAATPLQYTRFLIDVETGELVAVKMRELASQ
Ga0207705_1079747613300025909Corn RhizosphereKAKAAEMLDKDSSNLEEIERDSYKGREIWSITLSIPRDVNQLPPLDRLAADPLQYKRFLIDVETGDLLAMKLRETASR
Ga0207695_1165751323300025913Corn RhizosphereMVDRKQAVEIAMAEAENLLGQGSFSLEEIERDSYKGRDIWSVTLGVPRNMKLLPPFAQLTASPVEYKRFLIDVETGELVAMQRHEVASRQ
Ga0207661_1019981913300025944Corn RhizosphereMVDRKQAVEIAMAEAENLLGQGSSSLEEIERDSYKGRDIWSITLGLPRNMNLLPPFAQLTASPVEYKRFLIDVETGELVAMQRHEVASRQ
Ga0207702_1091371123300026078Corn RhizosphereMIEVKQAVQIAKAKAAEILEKGSSNLEEIERDTYKARDIWSITLSIPRDVDQLPVMARFSADPLQYKRFLIDADTGELLAIQLRETASR
Ga0209580_1006597523300027842Surface SoilMRSEHNSGEFSCQYEVGDVAMIDAKQAVQIAKQKAVELLNQNASGLEEIERVSYRDHEVWSITLSLPRDPTQLAPLAQLAQLSADPLQYKRFLIDVSSGELIAMKLREVSLQ
Ga0209274_1027351923300027853SoilMVDVKQAIQIAKEEAAGMLNQASSNLEEIEKDSYRGREVWSITLSLPRDMTQLQGLAVLRADPLQYKRFLIDVETGELVAMKVREVASQ
Ga0209517_1021602913300027854Peatlands SoilMIEVKQAVQIAKERAADMLNQASFNLEEIERDSYRGREVWSITLSLPRYVKQPPLSPFAELTADPLQYKRFLIDVET
Ga0209698_1032024923300027911WatershedsMNRGGERMIDAKQAVQVAKAKALEMLAQASSSLEEIERESYKGREVWSITLSLPRDVSHLAPIAQLAADKMQYKRFLIDAKTGDFVAMKVREVASP
Ga0265762_103317423300030760SoilMVDVKQAIQIAKEEAAEMLNQASSNLEEIEKDSYRGREVWSITLSLPRDMTQLQGLAVLRTDPLQYKRFLIDVETGELVAMKVREVASQ
Ga0302324_10132717323300031236PalsaMTIDAKAAVQIAKKSAVDMLNQNASNLEEIETDSYKDREVWSITLSFPRDADRVSGLVRLTTDPLQYKRFLIDGQTGELVAIKMRDIPL
Ga0310686_10609102413300031708SoilMVDVKQAIQIAKEEAAEMLNQASSNLEEIEKDSYRGREVWSITLSLPRDMTQLQGLAVLRADPLQYKRFLIDVETGELVAMKVREVASQ
Ga0302321_10168414513300031726FenDCVMIDAKQAIQIARVGATDLLSQTSTNVEEIDRDSYKGREVWSITLSLPRNMKALAPFAQLSADPLHYKRFLIDIETGELVAVKLREVASQ
Ga0307479_1047361233300031962Hardwood Forest SoilDPMIDAKRAVEIAKEKATEMLGERLSYLEEIERDSYRDREVWSITLSYPRDLTALPAIIKLTADALQYKRFLIDVQTGDLLAMKLREVASR
Ga0311301_1016948443300032160Peatlands SoilMINAKQATLLAKQQAAEMLGQASSNLEELERGRYLDHEVWQITLSFPRNLDQLSTLERLGADPLQYKRFLIDVETGELVAMKLREPASP
Ga0311301_1018946543300032160Peatlands SoilMIDAKQAVLLARSKAAEMLGAGVSYLEEIERESYRDREVWSITLSFMRNLDQLPALSRLNADPLQYKRFLIDLETGELVAMKLREVALL
Ga0311301_1250647023300032160Peatlands SoilQIAKQRAADMLGESNFNLEEIEREPYKEREVWGITLSFPRDPNQLPLMARLGADPLQYKRFLIDVETGDLVAMKLREFISR
Ga0335085_1111861023300032770SoilMIEMKQAVQIAKENAAEMLGQAPFNLEEIERDSYKGRDIWSITLSSNSSNPFAALSGDLQYKRFLIDVETGELVAMKLREVSSR
Ga0335078_1137830723300032805SoilMVEAKQAVQIAKEKAAEMLGPGPTSLEEIEREPYKAREVWSITLSIPRDMSQLGTFAHPASADPLEYKRFLIDSETGDLLAIKLREFAAR
Ga0326728_1041180023300033402Peat SoilMIEVKQAVQIAKERAADMLNQASFNLEEIERDSYRGREVWSITLSLPRFAKQPSLSPFAELTADPLQYKRFLIDVETGELVAMKLREVAAR
Ga0316620_1009757253300033480SoilMIDAKQAIQIAQERAADMLSRSDLNLEEIGRESYRDREVWNITLSFSRDLERLPPIARLGADPLQYKRFLIDVETGELVAMKFREPAAR
Ga0316627_10008667943300033482SoilMIDAKQAVLIAKEKAADMLSPSSSNLEEIERDSYKDREVWSITLSLPRDVTQLAPLARLSAVPLQYKRFLIDVESGELVAMKLREVA
Ga0334790_084938_95_3643300033887SoilMIDLKQAIQVARQGAADMLSQASSNLEEIERDTYKGREVWNITLSLPRDVSQLTGFAQLAADSLQYKRFLIDVETGELLAVKLREVASQ
Ga0334811_049930_898_11163300033891SoilMLGQSSATLEEIEKETHKDREVWSITLSYPRDLSHLSSIARIGIEPLQYKRFLIDVETGDLVAVRLREPAAR
Ga0334827_087041_13_2823300034065SoilMIDAKQAVLIAKQKAAEMLDQDPAKSNLEEIERESYKGREVWSITLSLPRDLERLQGLAQLAADPLQYKRLLIDAETGDLVAMKLREAA
Ga0370490_0255893_2_2473300034128Untreated Peat SoilMIDAKQAVQIAKASAADLLNQASSNLEEIERDSYKAREVWSITLSLRRNVTEQSPVVQLFAAHLQYTRFLIDVETGELVAVK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.