Basic Information | |
---|---|
Family ID | F057775 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 136 |
Average Sequence Length | 41 residues |
Representative Sequence | MFLFRLFRSFLPLHNPIGFGASDFIELAFAVLLVLLVLA |
Number of Associated Samples | 113 |
Number of Associated Scaffolds | 136 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 76.12 % |
% of genes near scaffold ends (potentially truncated) | 97.06 % |
% of genes from short scaffolds (< 2000 bps) | 90.44 % |
Associated GOLD sequencing projects | 111 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.47 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (88.235 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil (15.441 % of family members) |
Environment Ontology (ENVO) | Unclassified (34.559 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (30.147 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.78% β-sheet: 0.00% Coil/Unstructured: 55.22% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 136 Family Scaffolds |
---|---|---|
PF06808 | DctM | 3.68 |
PF00072 | Response_reg | 2.21 |
PF00478 | IMPDH | 2.21 |
PF00004 | AAA | 2.21 |
PF13229 | Beta_helix | 2.21 |
PF13649 | Methyltransf_25 | 2.21 |
PF05167 | DUF711 | 1.47 |
PF06439 | 3keto-disac_hyd | 1.47 |
PF06964 | Alpha-L-AF_C | 1.47 |
PF01850 | PIN | 1.47 |
PF08242 | Methyltransf_12 | 1.47 |
PF01558 | POR | 1.47 |
PF01402 | RHH_1 | 1.47 |
PF00583 | Acetyltransf_1 | 1.47 |
PF00034 | Cytochrom_C | 1.47 |
PF05592 | Bac_rhamnosid | 0.74 |
PF00924 | MS_channel | 0.74 |
PF01175 | Urocanase | 0.74 |
PF00593 | TonB_dep_Rec | 0.74 |
PF01625 | PMSR | 0.74 |
PF16861 | Carbam_trans_C | 0.74 |
PF01934 | HepT-like | 0.74 |
PF08241 | Methyltransf_11 | 0.74 |
PF02610 | Arabinose_Isome | 0.74 |
PF03193 | RsgA_GTPase | 0.74 |
PF03938 | OmpH | 0.74 |
PF01266 | DAO | 0.74 |
PF10502 | Peptidase_S26 | 0.74 |
PF01244 | Peptidase_M19 | 0.74 |
PF09285 | Elong-fact-P_C | 0.74 |
PF00326 | Peptidase_S9 | 0.74 |
PF00015 | MCPsignal | 0.74 |
PF12867 | DinB_2 | 0.74 |
PF01814 | Hemerythrin | 0.74 |
PF16576 | HlyD_D23 | 0.74 |
PF00106 | adh_short | 0.74 |
PF04365 | BrnT_toxin | 0.74 |
PF02627 | CMD | 0.74 |
PF00196 | GerE | 0.74 |
PF13462 | Thioredoxin_4 | 0.74 |
PF13489 | Methyltransf_23 | 0.74 |
PF09371 | Tex_N | 0.74 |
PF11700 | ATG22 | 0.74 |
PF13646 | HEAT_2 | 0.74 |
PF01894 | UPF0047 | 0.74 |
PF13620 | CarboxypepD_reg | 0.74 |
PF01014 | Uricase | 0.74 |
PF09335 | SNARE_assoc | 0.74 |
PF03992 | ABM | 0.74 |
PF00133 | tRNA-synt_1 | 0.74 |
PF03069 | FmdA_AmdA | 0.74 |
PF01565 | FAD_binding_4 | 0.74 |
PF13517 | FG-GAP_3 | 0.74 |
COG ID | Name | Functional Category | % Frequency in 136 Family Scaffolds |
---|---|---|---|
COG3534 | Alpha-L-arabinofuranosidase | Carbohydrate transport and metabolism [G] | 1.47 |
COG2848 | Uncharacterized conserved protein, UPF0210 family | Cell cycle control, cell division, chromosome partitioning [D] | 1.47 |
COG0840 | Methyl-accepting chemotaxis protein (MCP) | Signal transduction mechanisms [T] | 1.47 |
COG1014 | Pyruvate:ferredoxin oxidoreductase or related 2-oxoacid:ferredoxin oxidoreductase, gamma subunit | Energy production and conversion [C] | 1.47 |
COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.74 |
COG3648 | Uricase (urate oxidase) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.74 |
COG3408 | Glycogen debranching enzyme (alpha-1,6-glucosidase) | Carbohydrate transport and metabolism [G] | 0.74 |
COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 0.74 |
COG2987 | Urocanate hydratase | Amino acid transport and metabolism [E] | 0.74 |
COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 0.74 |
COG2825 | Periplasmic chaperone for outer membrane proteins, Skp family | Cell wall/membrane/envelope biogenesis [M] | 0.74 |
COG2445 | Uncharacterized HEPN domain protein YutE, UPF0331/DUF86 family | General function prediction only [R] | 0.74 |
COG2421 | Acetamidase/formamidase | Energy production and conversion [C] | 0.74 |
COG2361 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 0.74 |
COG2355 | Zn-dependent dipeptidase, microsomal dipeptidase homolog | Posttranslational modification, protein turnover, chaperones [O] | 0.74 |
COG2160 | L-arabinose isomerase | Carbohydrate transport and metabolism [G] | 0.74 |
COG0060 | Isoleucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.74 |
COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 0.74 |
COG1162 | Ribosome biogenesis GTPase RsgA | Translation, ribosomal structure and biogenesis [J] | 0.74 |
COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 0.74 |
COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.74 |
COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 0.74 |
COG0525 | Valyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.74 |
COG0495 | Leucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.74 |
COG0432 | Thiamin phosphate synthase YjbQ, UPF0047 family | Coenzyme transport and metabolism [H] | 0.74 |
COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 0.74 |
COG0225 | Peptide methionine sulfoxide reductase MsrA | Posttranslational modification, protein turnover, chaperones [O] | 0.74 |
COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.74 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 88.24 % |
Unclassified | root | N/A | 11.76 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001356|JGI12269J14319_10369449 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300004643|Ga0062591_100182863 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1513 | Open in IMG/M |
3300005467|Ga0070706_101472458 | Not Available | 622 | Open in IMG/M |
3300005529|Ga0070741_11739601 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
3300005532|Ga0070739_10139910 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1300 | Open in IMG/M |
3300005541|Ga0070733_10087658 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1975 | Open in IMG/M |
3300005559|Ga0066700_10411301 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 953 | Open in IMG/M |
3300005573|Ga0078972_1138231 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1228 | Open in IMG/M |
3300005577|Ga0068857_101526964 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 651 | Open in IMG/M |
3300005952|Ga0080026_10265194 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 521 | Open in IMG/M |
3300006052|Ga0075029_101171063 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
3300006176|Ga0070765_100428607 | Not Available | 1237 | Open in IMG/M |
3300006358|Ga0068871_102059321 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
3300006797|Ga0066659_10513602 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae | 962 | Open in IMG/M |
3300006903|Ga0075426_10604639 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 819 | Open in IMG/M |
3300009012|Ga0066710_101861985 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 904 | Open in IMG/M |
3300009038|Ga0099829_11745843 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
3300009038|Ga0099829_11771259 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
3300009635|Ga0116117_1143151 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 613 | Open in IMG/M |
3300009638|Ga0116113_1173446 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300009640|Ga0116126_1203242 | Not Available | 637 | Open in IMG/M |
3300009644|Ga0116121_1092337 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 947 | Open in IMG/M |
3300009645|Ga0116106_1105486 | Not Available | 910 | Open in IMG/M |
3300009698|Ga0116216_10667048 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 625 | Open in IMG/M |
3300009762|Ga0116130_1183618 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 662 | Open in IMG/M |
3300010048|Ga0126373_13204197 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
3300010361|Ga0126378_13472681 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 500 | Open in IMG/M |
3300010373|Ga0134128_11441714 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 758 | Open in IMG/M |
3300010376|Ga0126381_103635110 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
3300010379|Ga0136449_101396283 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1082 | Open in IMG/M |
3300010379|Ga0136449_101656554 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 967 | Open in IMG/M |
3300011270|Ga0137391_10074829 | All Organisms → cellular organisms → Bacteria | 2914 | Open in IMG/M |
3300012200|Ga0137382_11209905 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
3300012961|Ga0164302_11357721 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
3300012971|Ga0126369_11489691 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 766 | Open in IMG/M |
3300014151|Ga0181539_1049889 | All Organisms → cellular organisms → Bacteria | 1976 | Open in IMG/M |
3300014152|Ga0181533_1228917 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
3300014155|Ga0181524_10192491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 1007 | Open in IMG/M |
3300014156|Ga0181518_10396508 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 668 | Open in IMG/M |
3300014158|Ga0181521_10065479 | All Organisms → cellular organisms → Bacteria | 2397 | Open in IMG/M |
3300014159|Ga0181530_10347908 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 765 | Open in IMG/M |
3300014162|Ga0181538_10328825 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 825 | Open in IMG/M |
3300014162|Ga0181538_10611780 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300014164|Ga0181532_10020852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter | 4749 | Open in IMG/M |
3300014164|Ga0181532_10515055 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 654 | Open in IMG/M |
3300014164|Ga0181532_10797509 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300014165|Ga0181523_10073967 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2072 | Open in IMG/M |
3300014165|Ga0181523_10837101 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300014199|Ga0181535_10398042 | Not Available | 807 | Open in IMG/M |
3300014200|Ga0181526_10422887 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 845 | Open in IMG/M |
3300014490|Ga0182010_10801025 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300014491|Ga0182014_10271094 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
3300014496|Ga0182011_10904206 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
3300014502|Ga0182021_11301244 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 876 | Open in IMG/M |
3300014638|Ga0181536_10532508 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300014655|Ga0181516_10316559 | Not Available | 794 | Open in IMG/M |
3300014658|Ga0181519_10399979 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 848 | Open in IMG/M |
3300014658|Ga0181519_10612189 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
3300014969|Ga0157376_11432713 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 723 | Open in IMG/M |
3300016701|Ga0181509_1209850 | All Organisms → cellular organisms → Bacteria | 3118 | Open in IMG/M |
3300016750|Ga0181505_10159725 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 1237 | Open in IMG/M |
3300016750|Ga0181505_10618193 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 666 | Open in IMG/M |
3300017925|Ga0187856_1254541 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
3300017928|Ga0187806_1391797 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
3300017933|Ga0187801_10475409 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
3300017936|Ga0187821_10408711 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
3300017942|Ga0187808_10252858 | Not Available | 789 | Open in IMG/M |
3300017946|Ga0187879_10355464 | Not Available | 812 | Open in IMG/M |
3300017988|Ga0181520_11033862 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 542 | Open in IMG/M |
3300018004|Ga0187865_1084993 | All Organisms → cellular organisms → Bacteria | 1185 | Open in IMG/M |
3300018009|Ga0187884_10392057 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 559 | Open in IMG/M |
3300018012|Ga0187810_10407650 | Not Available | 572 | Open in IMG/M |
3300018015|Ga0187866_1118145 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1070 | Open in IMG/M |
3300018033|Ga0187867_10044025 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2709 | Open in IMG/M |
3300018035|Ga0187875_10407541 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 726 | Open in IMG/M |
3300018044|Ga0187890_10692795 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 575 | Open in IMG/M |
3300018046|Ga0187851_10836146 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium | 518 | Open in IMG/M |
3300018433|Ga0066667_12063667 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
3300019786|Ga0182025_1272563 | All Organisms → cellular organisms → Bacteria | 3218 | Open in IMG/M |
3300021384|Ga0213876_10507453 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
3300021420|Ga0210394_11565106 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
3300021476|Ga0187846_10437555 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
3300021478|Ga0210402_11893611 | Not Available | 522 | Open in IMG/M |
3300021560|Ga0126371_10754601 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter | 1120 | Open in IMG/M |
3300021560|Ga0126371_12757281 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300022516|Ga0224542_1038806 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 609 | Open in IMG/M |
3300022840|Ga0224549_1020891 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
3300023091|Ga0224559_1195746 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 700 | Open in IMG/M |
3300025917|Ga0207660_11098864 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 648 | Open in IMG/M |
3300025922|Ga0207646_11220850 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 659 | Open in IMG/M |
3300026451|Ga0247845_1038290 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Bryocella → Bryocella elongata | 792 | Open in IMG/M |
3300027846|Ga0209180_10684259 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 559 | Open in IMG/M |
3300027853|Ga0209274_10668656 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
3300027867|Ga0209167_10057186 | All Organisms → cellular organisms → Bacteria | 1927 | Open in IMG/M |
3300027965|Ga0209062_1004177 | All Organisms → cellular organisms → Bacteria | 15526 | Open in IMG/M |
3300028748|Ga0302156_10116122 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1337 | Open in IMG/M |
3300028874|Ga0302155_10457887 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 543 | Open in IMG/M |
3300029910|Ga0311369_10179309 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 2000 | Open in IMG/M |
3300029913|Ga0311362_11069959 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 620 | Open in IMG/M |
3300029915|Ga0311358_10626674 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
3300029999|Ga0311339_11938843 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
3300030054|Ga0302182_10416073 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 562 | Open in IMG/M |
3300031234|Ga0302325_10589656 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1641 | Open in IMG/M |
3300031234|Ga0302325_10937166 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1195 | Open in IMG/M |
3300031234|Ga0302325_11786387 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
3300031258|Ga0302318_10702391 | Not Available | 509 | Open in IMG/M |
3300031525|Ga0302326_13038939 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
3300031564|Ga0318573_10409160 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
3300031711|Ga0265314_10368860 | Not Available | 785 | Open in IMG/M |
3300031736|Ga0318501_10635272 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
3300031820|Ga0307473_11000487 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
3300032205|Ga0307472_102182021 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
3300032770|Ga0335085_10600002 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1240 | Open in IMG/M |
3300032770|Ga0335085_10997917 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
3300032783|Ga0335079_10415217 | All Organisms → cellular organisms → Bacteria | 1448 | Open in IMG/M |
3300032783|Ga0335079_12301668 | Not Available | 512 | Open in IMG/M |
3300032805|Ga0335078_10429002 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1724 | Open in IMG/M |
3300032805|Ga0335078_11306508 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
3300032805|Ga0335078_11824996 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
3300032829|Ga0335070_11915768 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
3300032892|Ga0335081_11184994 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
3300032892|Ga0335081_11423441 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 773 | Open in IMG/M |
3300032892|Ga0335081_12558435 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300032893|Ga0335069_10078557 | All Organisms → cellular organisms → Bacteria | 4223 | Open in IMG/M |
3300032893|Ga0335069_11148668 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 853 | Open in IMG/M |
3300032893|Ga0335069_11749144 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 662 | Open in IMG/M |
3300032954|Ga0335083_10709860 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
3300033134|Ga0335073_11665777 | Not Available | 604 | Open in IMG/M |
3300033158|Ga0335077_10077240 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 3962 | Open in IMG/M |
3300033158|Ga0335077_10324088 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1678 | Open in IMG/M |
3300033158|Ga0335077_10587774 | All Organisms → cellular organisms → Bacteria | 1164 | Open in IMG/M |
3300033158|Ga0335077_11490798 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 648 | Open in IMG/M |
3300033405|Ga0326727_10286668 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1642 | Open in IMG/M |
3300033433|Ga0326726_11324965 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 701 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 15.44% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 14.71% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 8.82% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.15% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 4.41% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.41% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.68% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.68% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.68% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 3.68% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.94% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 2.94% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 2.21% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.47% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.47% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.47% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.47% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.47% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.47% |
Hot Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring | 0.74% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.74% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.74% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.74% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.74% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.74% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.74% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.74% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.74% |
Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.74% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.74% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.74% |
Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.74% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.74% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.74% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.74% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.74% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005573 | Hot spring thermophilic microbial communities from Obsidian Pool, Yellowstone National Park, USA - OP-RAMG-01 (SPADES assembly) | Environmental | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009635 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 | Environmental | Open in IMG/M |
3300009638 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 | Environmental | Open in IMG/M |
3300009640 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 | Environmental | Open in IMG/M |
3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300014151 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaG | Environmental | Open in IMG/M |
3300014152 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaG | Environmental | Open in IMG/M |
3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
3300014490 | Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaG | Environmental | Open in IMG/M |
3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
3300014496 | Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaG | Environmental | Open in IMG/M |
3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300016701 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
3300018004 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100 | Environmental | Open in IMG/M |
3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
3300018015 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150 | Environmental | Open in IMG/M |
3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022516 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E3 30-34 | Environmental | Open in IMG/M |
3300022840 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 1-5 | Environmental | Open in IMG/M |
3300023091 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 30-34 | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026451 | Peat soil microbial communities from Stordalen Mire, Sweden - P.F.S.T-25 | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027965 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
3300028748 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2 | Environmental | Open in IMG/M |
3300028874 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_1 | Environmental | Open in IMG/M |
3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
3300029913 | III_Bog_N3 coassembly | Environmental | Open in IMG/M |
3300029915 | III_Bog_E1 coassembly | Environmental | Open in IMG/M |
3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031258 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_1 | Environmental | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Host-Associated | Open in IMG/M |
3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12269J14319_103694491 | 3300001356 | Peatlands Soil | MFLFDFFRSFLPLHNPIGFGASDFLLLVFALMLAA |
Ga0062591_1001828632 | 3300004643 | Soil | MFLFQFFRSFLPLHNPIGFGASDFIELAFAVLLVFLVIARRPWLEPYAQRLP |
Ga0070706_1014724582 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MFLFRFFSSFLPLRNPIGFGASDFIELALAVLLICLALASR |
Ga0070741_117396011 | 3300005529 | Surface Soil | MAPFQLFRSFLPLHNPIGFGPPDWIELELAVLILLLL |
Ga0070739_101399103 | 3300005532 | Surface Soil | VYLFDLFRSFLPLRNPIGFGIADFVVFAIALLLTVLFFARQAL |
Ga0070733_100876581 | 3300005541 | Surface Soil | MFLFRLFRSFLPLHNPIGFGASDFIELAFAVLLVLLVLA |
Ga0066700_104113011 | 3300005559 | Soil | MFLFQFFRSFLPLHNPIGFGASDFIELTFALLLVL |
Ga0078972_11382312 | 3300005573 | Hot Spring | MYLFHVLRSFLPLHNPIGFGASDFVEFSLAVLLLLLIVAR |
Ga0068857_1015269641 | 3300005577 | Corn Rhizosphere | MPLSDLFRSFQPLHNPIGFGAADFIELLLALMMAGA |
Ga0080026_102651942 | 3300005952 | Permafrost Soil | MFDLFRSFLPLHNPIGFGAADFIELELAILLVLLILAHSG |
Ga0075029_1011710631 | 3300006052 | Watersheds | MFLFDFFRSFLPLHNPIGFGAADFIELAFTVLLVVLGMMFRPWIEPYARRLAVN |
Ga0070765_1004286071 | 3300006176 | Soil | MFYLWHLFRSFQPLNNPIGFGASDFIELALAAILVSLTLARNHLAAAA |
Ga0068871_1020593212 | 3300006358 | Miscanthus Rhizosphere | MFPVQLFRSFVPLQNPIGFGASDFIELAWAAMLVLLALAW |
Ga0066659_105136021 | 3300006797 | Soil | MFLFHFFRSFLPLHNTIGFGAADFIELALAAVLVLFA |
Ga0075426_106046392 | 3300006903 | Populus Rhizosphere | MFLFQFFRSFLPLHNPIGFGASDFIELAFAVLLVFLVIARRPWLEPYRQGLAGKTG |
Ga0066710_1018619853 | 3300009012 | Grasslands Soil | VFLFGWFRSFLPLRNPIGFGASDFIELAVAVLLVLSVLARV |
Ga0099829_117458431 | 3300009038 | Vadose Zone Soil | MFLFHFFRSFLPLHNPIGFGASDFIELAFAVLLVFLTIARRPWLEPYAQ |
Ga0099829_117712591 | 3300009038 | Vadose Zone Soil | MFLFHFFRSFLPLHNPIGFGASDFIELAFAFLLLLLALARRPWIE |
Ga0116117_11431511 | 3300009635 | Peatland | MFLFDFFRSFLPLHNPLGFGASDFVEFALIALLVAL |
Ga0116113_11734461 | 3300009638 | Peatland | MFLFDFFRSFLPLHNPLGFGASDFVEFALIALLIALVLARGALDPA |
Ga0116126_12032422 | 3300009640 | Peatland | MYLFHLFRSFLPLHNPIGFGASDFLELAAAALLVALVLGRAAI |
Ga0116121_10923371 | 3300009644 | Peatland | MFLFDLFRSFLPLHNPIGFGAADFIEFALAAMLVLM |
Ga0116106_11054861 | 3300009645 | Peatland | MFQLFRSFLPLHNPIGFGASDFIELELAALFLLLLA |
Ga0116216_106670481 | 3300009698 | Peatlands Soil | MYLFHIFRSFLPLHNPIGFGAVDFMELGLALLLVLLVI |
Ga0116130_11836181 | 3300009762 | Peatland | MYLFHVLRSFLPIHNPIGFGASDFIEFAVAVLLVLLVLARAWLEPAA |
Ga0126373_132041971 | 3300010048 | Tropical Forest Soil | MVVSMFYLFDWFRSFLPMHNPIGFGAVDFIALGLGAALVL |
Ga0126378_134726812 | 3300010361 | Tropical Forest Soil | MYLFHLLRSFLPLHNPIGFGAADFVELVLCAALVALALGRRWVKDAGS |
Ga0134128_114417141 | 3300010373 | Terrestrial Soil | MFPFHLFRSFLPLHNPIGFGASDFIELALAAMTMA |
Ga0126381_1036351101 | 3300010376 | Tropical Forest Soil | MVVSMFYLFDWFRSFLPMHNPIGFGAVDFIALGLGAALVLF |
Ga0136449_1013962832 | 3300010379 | Peatlands Soil | MFTPDLFRSLLPLHNPLGFGAADFLLLALAILLVALLALWR |
Ga0136449_1016565541 | 3300010379 | Peatlands Soil | MFLFDFFRSFLPLHNLLGFGASDFVEFALVVLLVAL |
Ga0137391_100748294 | 3300011270 | Vadose Zone Soil | MFLFDLFRSFLPLHNPIGFGAADFIELAFTVLLVVIAMMFR |
Ga0137382_112099052 | 3300012200 | Vadose Zone Soil | MFLFQFFRSFLPLHNPIGFGASDFIELAFAVLLVFLV |
Ga0164302_113577211 | 3300012961 | Soil | MFLFRLFQSFLPLHNPIGFGAGDFIEFGLAVLLVVG |
Ga0126369_114896912 | 3300012971 | Tropical Forest Soil | MFLFHFFRSFLPLHNPIGFGGSDFIELAFGLLLVMLTIARRPWIEPYAQR |
Ga0181539_10498895 | 3300014151 | Bog | MYLFHLFRSFLPLQNPIGFGVSDFIQLALTLLLLLPVM |
Ga0181533_12289171 | 3300014152 | Bog | MFPSWVLRSYLPLRNPIGFGASDFVELAVVAMLVCLVMARAWM |
Ga0181524_101924911 | 3300014155 | Bog | MFLFDVFRSFLPLNNSIGFGPADFIELALAAMLVLM |
Ga0181518_103965081 | 3300014156 | Bog | MFLFDFFRSFLPLHNPLGFGASDFVEFAAVALLVAL |
Ga0181521_100654791 | 3300014158 | Bog | MFQLFRSFLPLHNPIGFGASDFIELELAALLVLLI |
Ga0181530_103479081 | 3300014159 | Bog | MYLFDLFRSFLPLHNPIGFGAADFIEFALAAMLVLMVAL |
Ga0181538_103288251 | 3300014162 | Bog | MFLFDFFRSFLPLHNPLGFGASDFVEFALIALLVALALARG |
Ga0181538_106117801 | 3300014162 | Bog | VFFFDIFRSFLPLQNPIGFSGADFIELTIAALLVVLVIL |
Ga0181532_100208521 | 3300014164 | Bog | VQFHIFSSFLPFENPLGFGASDFIELFLAATLGFL |
Ga0181532_105150551 | 3300014164 | Bog | MFLFDFFRSFLPLHNPIGFGAADFIEFALATLLVSLVLLRARVEPG |
Ga0181532_107975092 | 3300014164 | Bog | MYLFDLFRSFLPLHNPIGYGAADFIELALAALLLVFVLARGPIEPI |
Ga0181523_100739673 | 3300014165 | Bog | MFLFDVFRSFLPLHNPIGFGPADFIELALAAMLVLM |
Ga0181523_108371011 | 3300014165 | Bog | MYLFDLFRSFLPLHNPIGFGAGDFIELALAGLLAVLVL |
Ga0181535_103980422 | 3300014199 | Bog | MYLFDIFRSFLPLRNPIGFGVADFILMALALMLAAM |
Ga0181526_104228871 | 3300014200 | Bog | MFLFDFFRSFLPLHNPLGFGASDFVEFALIALLVALVLAR |
Ga0182010_108010251 | 3300014490 | Fen | MFLFDFFRSFLPLPNPIGFGASDFIELALAVRRVSL |
Ga0182014_102710941 | 3300014491 | Bog | MFLFDFFRSFLPLHNPIGFGAADFIELALATLLVSL |
Ga0182011_109042061 | 3300014496 | Fen | MFLFDFFRSFLPLHNPIGFGAGDFIEFALAALLVSLV |
Ga0182021_113012441 | 3300014502 | Fen | MFLFDFFRSFLPLHNPIGFGAVDFIEFALAAALLLMAAWRGRVET |
Ga0181536_105325082 | 3300014638 | Bog | MFLFDVFRSFLPLNNSIGFGPADFIELALAAMLVLMAL |
Ga0181516_103165594 | 3300014655 | Bog | MFLFDIFRSFLPLHNPLGFGASDFVEFALVALLVALVL |
Ga0181519_103999791 | 3300014658 | Bog | MFLFDFFRSFLPLHNPLGFGASDFVEFGAVALLVAL |
Ga0181519_106121891 | 3300014658 | Bog | MFLFDFFRSFLPLHNPLGFGASDFVEFAAVALLVALILAR |
Ga0157376_114327132 | 3300014969 | Miscanthus Rhizosphere | MFLFHIFRSFLPLHNPLGFGASDFIEFSVAVLMVLLLLTGRSLI |
Ga0132256_1028134191 | 3300015372 | Arabidopsis Rhizosphere | MFLFRLFHSFLPLHNPIGFGASDFIELAVAAILVLLVLARHRIELFGRR |
Ga0181509_12098504 | 3300016701 | Peatland | MFLFDLFRSFLPLHNPIGFGAADFMEFALAATATN |
Ga0181505_101597252 | 3300016750 | Peatland | MRALFHSLRPLYNPIGFGAADFIVLAWTGLLVLLLLA |
Ga0181505_106181931 | 3300016750 | Peatland | MFQLFRSFLPLHNPIGFGASDFIELELAALLVLLIALHAGLDR |
Ga0187856_12545411 | 3300017925 | Peatland | MFLFDFFRSFLPLHNPIGFGAADFIELALAALLVSLVLLRARIEPGFQRL |
Ga0187806_13917972 | 3300017928 | Freshwater Sediment | MVLLELFRSFLPLRNPIGFGASDFLELALAALLVTLAL |
Ga0187801_104754092 | 3300017933 | Freshwater Sediment | MFYLFHLFRSFQPLSNPIGFGAGDFIEFALAAVLVSLAIGRERLMAPVRSF |
Ga0187821_104087111 | 3300017936 | Freshwater Sediment | MFPFHLFRSFLPLHNPIGFGASDFIELVLAAMLVLLVLAWR |
Ga0187808_102528581 | 3300017942 | Freshwater Sediment | MYLFHVFRSFLPLQNPIGFGASDFIEFTLVFLLVLLVVGRAWAIPAAQKLA |
Ga0187879_103554641 | 3300017946 | Peatland | MYLFDLFRSFLPLHNPIGFGAVDFIELALAGLLIVFVLARRPI |
Ga0181520_110338622 | 3300017988 | Bog | MYLFDIFRSFLPLHNPIGFGAADFILLALALLLVAFILTKPWIE |
Ga0187865_10849932 | 3300018004 | Peatland | MFLFDWFRSFLPMHNPLGFGASDFLELALVCLLILLM |
Ga0187884_103920572 | 3300018009 | Peatland | MFLFDVFRSFLPPHNSIGFGPADFIELALAAMLVL |
Ga0187810_104076501 | 3300018012 | Freshwater Sediment | MFIFHLFRSLLPLRNPIGFGAADFIELSVALLLVLLLIWSRPL |
Ga0187866_11181451 | 3300018015 | Peatland | MFLFDVFRSFLPLHNPIGFGPADFIELALAAMLVLMALVW |
Ga0187867_100440251 | 3300018033 | Peatland | MFDLFRSFLPLHNPIGFGATDFIELELAALLVLLIVAHAG |
Ga0187875_104075411 | 3300018035 | Peatland | MFLFQLFRSFLPLHNPIGFGSTDFLLLILAAMLLALTLAWR |
Ga0187890_106927952 | 3300018044 | Peatland | MFLFDIFRSFLPLHNPIGFGTADFIEFAAAAMLVLM |
Ga0187851_108361462 | 3300018046 | Peatland | MFLFDFFRSFLPLHNPLGFGASDFVEFGAVALLVALILARGVVEPAA |
Ga0066667_120636671 | 3300018433 | Grasslands Soil | MFLFQFFRSFLPLHNPIGFGASDFIELAFAVLLVFLVIARRPWLE |
Ga0182025_12725635 | 3300019786 | Permafrost | MFLFDFFRSFLPLHNPIGFGASDFIELALAALLDC |
Ga0213876_105074532 | 3300021384 | Plant Roots | MYLFHLFRSLLPVRNPIGFGASDFILIAVSVLFVFVTLLWPA |
Ga0210394_115651062 | 3300021420 | Soil | MFLFQLFRSFLPLGNPIGFGASDFIELAVAALLALL |
Ga0187846_104375552 | 3300021476 | Biofilm | MLQLFRSFLPLHNPIGFGATDFIELALVALLTGLILASCLEPR |
Ga0210402_118936112 | 3300021478 | Soil | MFGFQLFRTFQPFQNPIGFGGSDFIELAFTVLLVIFA |
Ga0126371_107546012 | 3300021560 | Tropical Forest Soil | MFLFDFFRSLLPLHNPIGFGSADFLELALAALLVLLLLARAELE |
Ga0126371_127572812 | 3300021560 | Tropical Forest Soil | MFLFDFFRSFLPLRNPIGFGASDFILLTIGLLLVAAVVLWRR |
Ga0224542_10388062 | 3300022516 | Soil | MFLFDFFRSFLPLHNPIGFGAGDFIEFALAALLVSLVLLRARVE |
Ga0224549_10208911 | 3300022840 | Soil | MYLFHVLRSFLPIHNPIGFGASDFIEFAVAVLLVLLVLARA |
Ga0224559_11957462 | 3300023091 | Soil | MFLFDWFRSFLPLHNPLGFGAADFVELALSALGVALV |
Ga0207660_110988642 | 3300025917 | Corn Rhizosphere | MFPFHLFRSFMPLHNPIGFGASDFIELALAATLVLLALAWRPWIESF |
Ga0207646_112208501 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VFPFHLFRSFLPLHNPIGFGASDFIELALAAMLVLLALAWRPWIE |
Ga0247845_10382903 | 3300026451 | Soil | MFLFDFFRSFLPLHNPIGFGAGDFIEFALAALLVSLVLLRARVEPAFQ |
Ga0209180_106842592 | 3300027846 | Vadose Zone Soil | MFLFHFFRSFLPLHNTIGFGAADFIELALAAVLVLFALIWRP |
Ga0209274_106686561 | 3300027853 | Soil | MFPLHLFRSFLQLDNPMGFGASDFIELFLAALLLA |
Ga0209167_100571861 | 3300027867 | Surface Soil | MFLFRLFRSFLPLHNPIGFGASDFIELAFAVLLVLLVLAWRP |
Ga0209062_10041771 | 3300027965 | Surface Soil | MFYLFDWFRSFLPLHNPIGFGVVDFIELGLGVMLVLFGL |
Ga0302156_101161223 | 3300028748 | Bog | MFLFDLFRSFLPLHNPIGFGSADFIEFALAAMLVLMV |
Ga0302155_104578872 | 3300028874 | Bog | MFLFDLFRSFLPLHNPIGFGSADFIEFALAAMLVLMVALHGREE |
Ga0311369_101793091 | 3300029910 | Palsa | MYLFHVLRSFLPLHNPIGFGASDFIQFCLAVLLVSLVLARAWLQPV |
Ga0311362_110699591 | 3300029913 | Bog | VFLFDLFRSFLPLHNPLGFGAADFLEFALAAILVT |
Ga0311358_106266741 | 3300029915 | Bog | VFLFEIFRSFLPIHNPIGFGAADFIEFTLAVGLLA |
Ga0311339_119388432 | 3300029999 | Palsa | MSFTPLHNPIGFGAIDFIELSVAGMMVALALLWRPYLA |
Ga0302182_104160732 | 3300030054 | Palsa | MFLFDFFRSFLPLHNPIGFGASDFIELALAALLVLLTLMRAEAEP |
Ga0302325_105896561 | 3300031234 | Palsa | MFLFRLFRSFLPFHNPIGFGADDFVELGLAALLVLLILF |
Ga0302325_109371663 | 3300031234 | Palsa | MFLFDFFRSFLPLHNPIGFGASDFIELALAALLVLLTLVRAEAQ |
Ga0302325_117863871 | 3300031234 | Palsa | VFLFEIFRSFLPIHNPIGFGAADFVELTFALGMMALALTWRP |
Ga0302318_107023911 | 3300031258 | Bog | VFLFEIFRSFLPIHNPIGFGAADFIEFTLAVGLLALALIW |
Ga0302326_130389392 | 3300031525 | Palsa | MYVFHLFRSFLPLRNPIGFGAADFIELALALLLVAFALARP |
Ga0318573_104091601 | 3300031564 | Soil | VFQSFLPLHNPLGFGAADFVELALALILLLLTMACRGWLE |
Ga0265314_103688601 | 3300031711 | Rhizosphere | MYLFDVFRSFLPLHNPIGFGAVDFVEVALAIALVALVLVRARL |
Ga0318501_106352722 | 3300031736 | Soil | MYLFHVFRSFLPLHNPIGFGVNDFIQFALALLLVFLLL |
Ga0307473_110004871 | 3300031820 | Hardwood Forest Soil | MLFSELFRSFVPLRNPIGFGASDFIELAFTLLLVVPALAWRPW |
Ga0307472_1021820211 | 3300032205 | Hardwood Forest Soil | MFLFDLFRSFLPLHNPIGFGAADFIELAFTVLLVVIAMMFRPWIEPYARRLSV |
Ga0335085_106000022 | 3300032770 | Soil | MYLFQWFRSFLPLHNPIGFGASDFLELFLVLLLVVMVIARPWVIPAAQKLARKP |
Ga0335085_109979174 | 3300032770 | Soil | MFLFRLFQSFLPLHNPIGFGAADFIELALAGLLVLL |
Ga0335079_103116932 | 3300032783 | Soil | MYLFDIFRSFLPLHNPIGFGAVDFIELAIALLLVVLVLARERIEPFGLRLAQRPV |
Ga0335079_104152172 | 3300032783 | Soil | MFGLFRSFLPLHNPIGFGASDFIELELAALLLLLIAVHH |
Ga0335079_123016682 | 3300032783 | Soil | MFLFQLFRSFLPLHNPIGFGVSDFLEFALAALLTCLVLGHARIDPWIRRVA |
Ga0335078_104290021 | 3300032805 | Soil | MFLFQLFRSFLPLHNPIGFGASDFIELELAALLVVLIVAYAGAVA |
Ga0335078_113065082 | 3300032805 | Soil | VFLFDWFRSLLPLHNPIGFGAADFIELALAVLLVAAVLAR |
Ga0335078_118249962 | 3300032805 | Soil | MFLFDWFRSLLPLHNPIGFGAADFIALALAVLLVLAV |
Ga0335070_119157682 | 3300032829 | Soil | MYLFQWFRSFLPLHNPIGFGASDFLELFLVLLLVVMVIARPWVIPAAQKLARK |
Ga0335081_111849942 | 3300032892 | Soil | MFLFDFFRSFLPLHNPIGFGASDFLLLAFAFLLAATAV |
Ga0335081_114234412 | 3300032892 | Soil | MYLLHLFRSFLPLQNPIGFGAVDFIEFSFALLLVLLI |
Ga0335081_125584351 | 3300032892 | Soil | MFLFDFFRSFLPLHNPIGFGVGDFLLLVLAVLLVTAAVVW |
Ga0335069_100785574 | 3300032893 | Soil | MYLFDIFRSFLPLHNPIGFGAVDFIELAIALLLVVLVLARERIE |
Ga0335069_111486682 | 3300032893 | Soil | MYLFHVFRSFLPLHNPLGFGASDFILFGFAFLLVAGVILRAW |
Ga0335069_117491441 | 3300032893 | Soil | MYLFQWFRSFLPLHNPIGFGASDFLELFLLLLLVVMVIARP |
Ga0335083_107098602 | 3300032954 | Soil | MYLFQWFRSFLPLHNPIGFGASDFLELVLVLLLVVM |
Ga0335073_116657771 | 3300033134 | Soil | MSALFRSLRPLENPIGFGAADFIILAWAALLVLLWLAAARLEPGMRRLARR |
Ga0335077_100772405 | 3300033158 | Soil | MFLFDFFRSFLPLHNPIGFGAADFIELALSLVLVLMT |
Ga0335077_103240882 | 3300033158 | Soil | MFLLDLFRSFLPLHNPIGFGASDFILLALAAVLVLLALL |
Ga0335077_105877741 | 3300033158 | Soil | MYLFDIFRSFLPLHNPIGFGATDFVQLALAILLAGVVLGRAWLAPAA |
Ga0335077_114907982 | 3300033158 | Soil | MFYLFQLFRSFLPLHNPIGFGGPDFIELFLAVILVICALCRQRIVR |
Ga0326727_102866685 | 3300033405 | Peat Soil | MFLFDFFRSFLPLHNPIGFGAGDFIEFALAALLVSLVLLRAR |
Ga0326726_113249652 | 3300033433 | Peat Soil | MDFFQAFRSFLQLHNPIGFGAPDFLELAVAAMLVLLSL |
⦗Top⦘ |