 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F057760 |
| Family Type | Metagenome |
| Number of Sequences | 136 |
| Average Sequence Length | 40 residues |
| Representative Sequence | VTKLQTKLKRDVKLSRSQVIKTLVNEKARTLNGKLSK |
| Number of Associated Samples | 122 |
| Number of Associated Scaffolds | 136 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 94.12 % |
| Associated GOLD sequencing projects | 117 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (85.294 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (18.382 % of family members) |
| Environment Ontology (ENVO) | Unclassified (49.265 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (53.676 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.46% β-sheet: 7.69% Coil/Unstructured: 53.85% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 136 Family Scaffolds |
|---|---|---|
| PF05050 | Methyltransf_21 | 2.94 |
| PF13392 | HNH_3 | 1.47 |
| PF08241 | Methyltransf_11 | 0.74 |
| PF04545 | Sigma70_r4 | 0.74 |
| PF00961 | LAGLIDADG_1 | 0.74 |
| PF01370 | Epimerase | 0.74 |
| PF13578 | Methyltransf_24 | 0.74 |
| PF13759 | 2OG-FeII_Oxy_5 | 0.74 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 85.29 % |
| All Organisms | root | All Organisms | 14.71 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 18.38% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 11.03% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 8.82% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 8.09% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 5.88% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 5.88% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 5.15% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.15% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 3.68% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.21% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 2.21% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 2.21% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 2.21% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.47% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.47% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 1.47% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 1.47% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 1.47% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.74% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.74% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.74% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.74% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.74% |
| Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.74% |
| Marine Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water | 0.74% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.74% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.74% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.74% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.74% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.74% |
| Marine Harbor | Environmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor | 0.74% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.74% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.74% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.74% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300001419 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline water (15 m) | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001720 | Marine viral communities from the Pacific Ocean - LP-36 | Environmental | Open in IMG/M |
| 3300001748 | Saline surface water microbial communities from Etoliko Lagoon, Greece - surface water (0 m) | Environmental | Open in IMG/M |
| 3300001853 | Marine viral communities from the Subarctic Pacific Ocean - LP-49 | Environmental | Open in IMG/M |
| 3300002471 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - MAY 2013 | Environmental | Open in IMG/M |
| 3300005057 | Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-0.2um | Environmental | Open in IMG/M |
| 3300005346 | Saline sediment microbial community from Etoliko Lagoon, Greece | Environmental | Open in IMG/M |
| 3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007963 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2) | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300008121 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample HABS-E2014-0110-100-LTR | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009529 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG | Environmental | Open in IMG/M |
| 3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300011013 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaG | Environmental | Open in IMG/M |
| 3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017726 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 | Environmental | Open in IMG/M |
| 3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017759 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017769 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2) | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017991 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_2 metaG | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018418 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018428 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019093 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_43 | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300020083 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300m | Environmental | Open in IMG/M |
| 3300020182 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160502_2 | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300020198 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015019 Mahale Deep Cast 65m | Environmental | Open in IMG/M |
| 3300020200 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015020 Mahale Deep Cast 50m | Environmental | Open in IMG/M |
| 3300020222 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015034 Kigoma Deep Cast 250m | Environmental | Open in IMG/M |
| 3300020474 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001564 (ERX555957-ERR598976) | Environmental | Open in IMG/M |
| 3300020536 | Freshwater microbial communities from Lake Mendota, WI - 02JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021092 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015021 Mahale Deep Cast 10m | Environmental | Open in IMG/M |
| 3300021378 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131 | Environmental | Open in IMG/M |
| 3300021379 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247 | Environmental | Open in IMG/M |
| 3300022053 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022167 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v2) | Environmental | Open in IMG/M |
| 3300022168 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v2) | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300023175 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG | Environmental | Open in IMG/M |
| 3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024510 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepA_8h | Environmental | Open in IMG/M |
| 3300025071 | Marine viral communities from the Pacific Ocean - LP-36 (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025141 | Marine viral communities from the Pacific Ocean - ETNP_6_85 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025701 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025751 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025828 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027333 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepA_8d | Environmental | Open in IMG/M |
| 3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027596 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepC_8h | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027760 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027974 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028022 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 750m | Environmental | Open in IMG/M |
| 3300028044 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_15m | Environmental | Open in IMG/M |
| 3300028125 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB | Environmental | Open in IMG/M |
| 3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300028569 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8m | Environmental | Open in IMG/M |
| 3300029308 | Marine harbor viral communities from the Indian Ocean - SRB2 | Environmental | Open in IMG/M |
| 3300031143 | Marine microbial communities from water near the shore, Antarctic Ocean - #422 | Environmental | Open in IMG/M |
| 3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
| 3300033978 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002 | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOWin2010_100476079 | 3300000117 | Marine | KLQTKIAPDVKLSRSQVVKTLVNEKARKLNGRLSK* |
| JGI11705J14877_100541071 | 3300001419 | Saline Water And Sediment | TRLQTKMTPDVKLSRSQVIKTLVKEKARKLNGKFLKD* |
| JGI24006J15134_101211765 | 3300001450 | Marine | LQTKIAPDVKLSRSQVVKTLVNEKARKLNGRLNK* |
| JGI24003J15210_101678721 | 3300001460 | Marine | YSTITKLQTKIAPDVKLSRSQVVKTLVNEKARKLNGRLNK* |
| JGI24513J20088_10236314 | 3300001720 | Marine | LQTKIAPDVKLSRSQVVKTLVNEKARKLNGRLGK* |
| JGI11772J19994_10138425 | 3300001748 | Saline Water And Sediment | VDNETYATVTRLQTKMTPDVKLSRSQVIKTLVKEKARKLNGKLLKD* |
| JGI24524J20080_10188821 | 3300001853 | Marine | TKLQTKIAPDVKLSRSQVVKTLVNEKARKLNGXLSX* |
| metazooDRAFT_14835981 | 3300002471 | Lake | DNDTYAIVTKLQTKLKLDVKLSRSQVIKTLVNEKARTLNGKLSK* |
| Ga0068511_11021301 | 3300005057 | Marine Water | YATITKLQTKLAQDVKLSRSQVVKTLVNEKARKLNGRISK* |
| Ga0074242_109910211 | 3300005346 | Saline Water And Sediment | KLTTSLQRMQTKLKSDVKLSRSQVVCTLVQEKSEKLNGALK* |
| Ga0074648_10580076 | 3300005512 | Saline Water And Sediment | VDNKTYDTITKMQTKLKSDVKLSRSQVVCTLVQEKARKLNGALK* |
| Ga0075474_100606761 | 3300006025 | Aqueous | NETYATVTRLQTKMTPDVKLSRSQVIKTLVKEKARKLNGKLLKD* |
| Ga0075462_100575445 | 3300006027 | Aqueous | VTRLQTKMTPDVKLSRSQVIKTLVKEKARKLNGKLLKD* |
| Ga0098038_11491241 | 3300006735 | Marine | TRLQTKITPDVKLSRSQVVKTLVNEKARKLNGRLSK* |
| Ga0098037_11583871 | 3300006737 | Marine | ITRLQTKITPDVKLSRSQVVKTLVNEKARKLNGRLSK* |
| Ga0070749_103611891 | 3300006802 | Aqueous | TVDKDTYGTITKMQTKLADNVKLSRSQVVKTLVQEKAKKLNGKLKN* |
| Ga0070749_106359563 | 3300006802 | Aqueous | YDIVTKLQTKLYPNVKLSRSQVVKQLVQEKAEKLNGKLSK* |
| Ga0070754_103178821 | 3300006810 | Aqueous | NETYTIITKLQTKLKDDVKLSRSQVVKTLVTEKARKLNGKLSSK* |
| Ga0075476_101526845 | 3300006867 | Aqueous | DKDTYGTITKMQTKLADNVKLSRSQVVKTLVQEKAKKLNGKLKN* |
| Ga0075476_101660484 | 3300006867 | Aqueous | ITKLQTKLKDDVKLSRSQVVKTLVTEKARKLNGKLSK* |
| Ga0098041_11169734 | 3300006928 | Marine | LQTKIAPDVKLSRSQVVKTLVNEKARKLNGRLSK* |
| Ga0075460_101603031 | 3300007234 | Aqueous | YAVVTKLQTKMTPDVKLSRSQVIKTLVKEKARKLNGKLKD* |
| Ga0070752_12775931 | 3300007345 | Aqueous | YSIITKLQTKLKDDVKLSRSQVVKTLVTEKARKLNGKLSK* |
| Ga0099847_10611531 | 3300007540 | Aqueous | TVDKDTYATITRMQTKLADNVKLSRSQVVKTLVQEKAKKLNGKLKN* |
| Ga0099847_11351131 | 3300007540 | Aqueous | DIVTKLQTKLYPNVKLSRSQVVKQLVQEKAEKLNGKLSK* |
| Ga0110931_12677551 | 3300007963 | Marine | RLQTKITPDVKLSRSQVVKTLVNEKARKLNGRLSK* |
| Ga0075480_102844461 | 3300008012 | Aqueous | DNETYATVTRLQTKMTPDVKLSRSQVIKTLVKEKARKLNGKLLKD* |
| Ga0114356_14709634 | 3300008121 | Freshwater, Plankton | LQTKLKRDIKLSRSQVIKTLVNEKARTLNGKLSK* |
| Ga0114363_10618221 | 3300008266 | Freshwater, Plankton | YAIVTKLQTKLKSDVKLSRSQVIKTLVNEKARTLNGRVVYTVM* |
| Ga0114364_10852931 | 3300008267 | Freshwater, Plankton | KLQTKLKRDIKLSRSQVIKTLVNEKARTLNGKLSK* |
| Ga0102963_13993392 | 3300009001 | Pond Water | VDNKTYETITRLQTKMTPDVKLSRSQVVKTLVTEKARRMNGKLTGNK* |
| Ga0114918_104899241 | 3300009149 | Deep Subsurface | ETYATVTKLQTKMTPDVKLSRSQVIKTLVKEKARKLNGKFLKD* |
| Ga0114977_106271041 | 3300009158 | Freshwater Lake | KLQTKLKSDVKLSRSQVIKTLVNEKARTLNGKLK* |
| Ga0114975_104492061 | 3300009164 | Freshwater Lake | VTKLQTKLKSDVKLSRSQVIKTLVNEKARTLNGKLK* |
| Ga0105102_106044611 | 3300009165 | Freshwater Sediment | KLQTKLKSDVKLSRSQVIKTLVNEKARTLNGKLSK* |
| Ga0114959_103484341 | 3300009182 | Freshwater Lake | VDNDTYAIVTKLQTKLKDDIKLSRSQVIKTLVNEKARMLNGKLK* |
| Ga0114976_101991286 | 3300009184 | Freshwater Lake | VDNDTYAKLTKLQTKMVNDDLKLSRSQIVKMLVNEKVRKLNGSYSK* |
| Ga0114919_103576811 | 3300009529 | Deep Subsurface | TVDNQTYAIITKLQTKLVPEVTLSRSQVIKTIVQEKARTLNGRLK* |
| Ga0114933_106316294 | 3300009703 | Deep Subsurface | DNDTYATITKLQTKITQDVKLSRSQVVKTLVNEKARKLNGRLSK* |
| Ga0098043_12175151 | 3300010148 | Marine | LQTKLAQDVKLSRSQVVKTLVNEKARKLNGRLSK* |
| Ga0114967_102153904 | 3300010160 | Freshwater Lake | VVTKLQTKLKSDVKLSRSQVIKTLVNEKARTLNGKLK* |
| Ga0129348_11124931 | 3300010296 | Freshwater To Marine Saline Gradient | TVTRLQTKMTPDVKLSRSQVIKTLVKEKARKLNGKLLKD* |
| Ga0129345_12073541 | 3300010297 | Freshwater To Marine Saline Gradient | ITRMQTKLADNVKLSRSQVVKTLVQEKAKKLNGKLKN* |
| Ga0129345_13275961 | 3300010297 | Freshwater To Marine Saline Gradient | KMQTKLKSDVKLSRSQVVCTLVQEKARKLNGALK* |
| Ga0129351_12102301 | 3300010300 | Freshwater To Marine Saline Gradient | LQTKMTPDVKLSRSQVIKTLVKEKARKLNGKLKD* |
| Ga0129333_108686925 | 3300010354 | Freshwater To Marine Saline Gradient | AIVTKLQTKLKSDVKLSRSQVIKTLVNEKARTLNGKLK* |
| Ga0129333_109247941 | 3300010354 | Freshwater To Marine Saline Gradient | KDTYATITRMQTKLADNVKLSRSQVVKTLVQEKAKKLNGKLKN* |
| Ga0129333_114302771 | 3300010354 | Freshwater To Marine Saline Gradient | LQTKLKDDVKLSRSQVVKTLVTEKARKLNGKLSK* |
| Ga0129324_101713783 | 3300010368 | Freshwater To Marine Saline Gradient | YATVTRLQTKMTPDVKLSRSQVIKTLVKEKARKLNGKLLKD* |
| Ga0129336_104861351 | 3300010370 | Freshwater To Marine Saline Gradient | DTYAIVTKLQTKLKSDVKLSRSQVIKTLVNEKARTLNGKLK* |
| Ga0114934_100936951 | 3300011013 | Deep Subsurface | ITKLQTKITQDVKLSRSQVVKTLVNEKARKLNGRLSK* |
| Ga0153805_10645553 | 3300012013 | Surface Ice | KLQTKLKKDIKLSRSQVIKTLVNEKARTLNGKLK* |
| Ga0129327_109333991 | 3300013010 | Freshwater To Marine Saline Gradient | YSTITKLQTKIAPDVKLSRSQVVKTLVNEKARKLNGRLSK* |
| (restricted) Ga0172376_104306111 | 3300014720 | Freshwater | ITVDNQTYAIVTKLQTRLKRDVKLSRSQVVKTLVKEKARNLNGSLK* |
| Ga0180120_103545091 | 3300017697 | Freshwater To Marine Saline Gradient | ITVDKDTYATITRMQTKLADNVKLSRSQVVKTLVQEKAKKLNGKLKN |
| Ga0181350_11392343 | 3300017716 | Freshwater Lake | VTKLQTKLKRDIKLSRSQVIKTLVNEKARTLNGKLSK |
| Ga0181404_10308477 | 3300017717 | Seawater | YSTITKLQTKIAPDVKLSRSQVVKTLVNEKARKLNGRLSK |
| Ga0181347_11526671 | 3300017722 | Freshwater Lake | DNDTYGLVTKLQTKLKRDVKLSRSQVIKTLVNEKVRTLNGKLK |
| Ga0181381_10793841 | 3300017726 | Seawater | TITRLQTKITPDVKLSRSQVVKTLVNEKARKLNGRLSK |
| Ga0181420_11543374 | 3300017757 | Seawater | DTYATITKLQTKITQDVKLSRSQVVKTLVNEKARKLNGRLSK |
| Ga0181409_101991011 | 3300017758 | Seawater | STITKLQTKIAPDVKLSRSQVVKTLVNEKARKLNGRLSK |
| Ga0181414_11745151 | 3300017759 | Seawater | ATITKLQTRITQDVKLSRSQVVKTLVNEKARKLNGRLSK |
| Ga0181413_12498911 | 3300017765 | Seawater | TITKMQTKLTPDTKLSRSQVVTSLVNEKARKLNGKL |
| Ga0187221_10138411 | 3300017769 | Seawater | TKLQTKIAPDVKLSRSQVVKTLVNEKARKLNGRLGK |
| Ga0181380_10720111 | 3300017782 | Seawater | TKLQTKIAPDVKLSRSQVVKTLVNEKARKLNGRLSK |
| Ga0180434_101372768 | 3300017991 | Hypersaline Lake Sediment | ITKLQTKLKEDVKLSRSQVVKTLVTEKARKLNGKLDKK |
| Ga0181553_104712051 | 3300018416 | Salt Marsh | VDNDTYAIVTKLQTKLKSDVKLSRSQVIKTLVNEKARTLNGKLK |
| Ga0181567_104008981 | 3300018418 | Salt Marsh | ETITKMQTKLTPDTKLSRSQVVTTLVNEKARKLNGKL |
| Ga0181592_107520954 | 3300018421 | Salt Marsh | YAIVTKLQTKMTPDVKLSRSQVIKTLVKEKARKLNGKLKD |
| Ga0181568_100423461 | 3300018428 | Salt Marsh | TITKLQTKLATDVKLSRSQVVKTLVNEKARKLNGRISK |
| Ga0187843_102389374 | 3300019093 | Freshwater | DNDTYAIVTKLQTKLKRDVKLSRSQVIKTLVNEKARTLNGKLSK |
| Ga0194113_103082911 | 3300020074 | Freshwater Lake | TVDNDTYAIVTKLQTKLKRDVKLSRSQVIKTLVKEKARLLNGSLTK |
| Ga0194113_108338781 | 3300020074 | Freshwater Lake | YATVTKLQTRLKKDVKLSRSQVVRTLVNEKARNLNGKYSK |
| Ga0194111_108709263 | 3300020083 | Freshwater Lake | KLQTKLKRDVKLSRSQVIKTLVKEKARLLNGSLTK |
| Ga0206129_102316741 | 3300020182 | Seawater | KLQTKIAPDVKLSRSQVVKTLVNEKARKLNGRLSK |
| Ga0194115_102230911 | 3300020183 | Freshwater Lake | IDNQTYATVTKLQTRLKKDVKLSRSQVVRTLVNEKARNLNGKYSK |
| Ga0194120_103313084 | 3300020198 | Freshwater Lake | TKLQTRLKKDVKLSRSQVVRTLVNEKARNLNGKYSK |
| Ga0194121_105420283 | 3300020200 | Freshwater Lake | VTKLQTRLKKDVKLSRSQVVRTLVNEKARNLNGKYSK |
| Ga0194125_101459727 | 3300020222 | Freshwater Lake | ATVTKLQTRLKKDVKLSRSQVVRTLVNEKARNLNGKYSK |
| Ga0211547_105576914 | 3300020474 | Marine | KLQTKITQDVKLSRSQVVKTLVNEKARKLNGRLSK |
| Ga0207939_10139035 | 3300020536 | Freshwater | NDTYAIVTKLQTKLKSDVKLSRSQVIKTLVNEKARTLNGKLK |
| Ga0194122_100276931 | 3300021092 | Freshwater Lake | DNQTYATVTKLQTRLKKDVKLSRSQVVRTLVNEKARNLNGKYSK |
| Ga0213861_102456896 | 3300021378 | Seawater | ITKLQTKIAPDVKLSRSQVVKTLVNEKARKLNGRLSK |
| Ga0213861_104985921 | 3300021378 | Seawater | VDNETYATVTRLQTKMTPDVKLSRSQVIKTLVKEKARKLNGKFLKD |
| Ga0213864_103146734 | 3300021379 | Seawater | TVTRLQTKMTPDVKLSRSQVIKTLVKEKARKLNGKLLKD |
| Ga0212030_10182585 | 3300022053 | Aqueous | TIDNKTYDIVTKLQTKLYPNVKLSRSQVVKQLVQEKAEKLNGKLSK |
| Ga0212020_10741603 | 3300022167 | Aqueous | RMQTKLADNVKLSRSQVVKTLVQEKAKKLNGKLKN |
| Ga0212027_10119917 | 3300022168 | Aqueous | ATITKMQTKLKKDIKLSRSQVVKTLVNEKARMLNGKLSK |
| Ga0212027_10483693 | 3300022168 | Aqueous | GTITKMQTKLADNVKLSRSQVVKTLVQEKAKKLNGKLKN |
| Ga0181353_10528421 | 3300022179 | Freshwater Lake | VTKLQTKLKEDIKLSRSQVIKTLVNEKARTLNGKLK |
| Ga0181353_11350363 | 3300022179 | Freshwater Lake | KKKKDTYAIVTKLQTKLKSDVKLSRSQVIKTLVNEKARTLNGKLK |
| Ga0181354_11654661 | 3300022190 | Freshwater Lake | TVDNDTYGFVTKLQTKLKKDIKLSRSQVIKTLVNEKVRTLNGKLSKVXT |
| Ga0255777_101063001 | 3300023175 | Salt Marsh | TYETITKLQTKLATDVKLSRSQVVKTLVNEKARKLNGRISK |
| Ga0210003_13590581 | 3300024262 | Deep Subsurface | IITKLQTKLIPEVTLSRSQVIKTIVQEKARKLNGRLK |
| Ga0255187_10088931 | 3300024510 | Freshwater | NDTYVIVTKLQTKLKKDIKLSRSQVIKTLVNEKARTLNGKLK |
| Ga0207896_10073881 | 3300025071 | Marine | STITKLQTKIAPDVKLSRSQVVKTLVNEKARKLNGKLSK |
| Ga0207896_10438404 | 3300025071 | Marine | TITKLQTKIAPDVKLSRSQVVKTLVNEKARKLNGRLSK |
| Ga0209232_10844975 | 3300025132 | Marine | ATYATITKLQTKLAQDVKLSRSQVVKTLVNEKARKLNGRLSK |
| Ga0209756_13145423 | 3300025141 | Marine | YATITKLQTKITPDVKLSRSQVVKTLVNEKARKLNGRLSK |
| Ga0209645_10933495 | 3300025151 | Marine | TKLQTKLAPDVKLSRSQVVKTLVNEKARKLNGRLSK |
| Ga0209645_10942485 | 3300025151 | Marine | TKLQTKLAPDVKLSRSQVVKTLVNEKARKLNGRFSK |
| Ga0208161_11088281 | 3300025646 | Aqueous | TKLQTKLKDDVKLSRSQVVKTLVSEKARKLNGKLSK |
| Ga0208161_11792851 | 3300025646 | Aqueous | ATITRMQTKLADNVKLSRSQVVKTLVQEKAKKLNGKLKN |
| Ga0208160_11373883 | 3300025647 | Aqueous | VDNETYATVTRLQTKMTPDVKLSRSQVIKTLVKEKARKLNGKLLKD |
| Ga0208019_12021641 | 3300025687 | Aqueous | NETYATVTRLQTKMTPDVKLSRSQVIKTLVKEKARKLNGKLLKD |
| Ga0209771_11659371 | 3300025701 | Marine | RLQTKMTPDVKLSRSQVVKTLVTEKARKMNGKLSSK |
| Ga0208150_11952503 | 3300025751 | Aqueous | TYATITRMQTKLADNVKLSRSQVVKTLVQEKAKKLNGKLKN |
| Ga0208899_11067445 | 3300025759 | Aqueous | VNNDTYTTITKLQTKLKDDVKLSRSQVVKTLVTEKARKLNGKLSSK |
| Ga0208767_11452791 | 3300025769 | Aqueous | VTKLQTKMTPDVKLSRSQVIKTLVKEKARKLNGKLKD |
| Ga0208547_11863741 | 3300025828 | Aqueous | TITKMQTKLADNVKLSRSQVVKTLVQEKAKKLNGKLKN |
| Ga0255138_10689563 | 3300027333 | Freshwater | ITVDNNTYGLVTKLQTKLKRDIKLSRSQVIKTLVNEKARTLNGKLSK |
| Ga0209651_11420813 | 3300027581 | Freshwater Lake | YAIVTKLQTKLKKDIKLSRSQVIKTLVNEKARTLNGKLSK |
| Ga0255119_10760523 | 3300027596 | Freshwater | DNDTYGLVTKLQTKLKRDVKLSRSQVIKTLVNEKARTLNGKLSK |
| Ga0208974_10816484 | 3300027608 | Freshwater Lentic | DTYAIVTKLQTKLKNDVKLSRSQVIKTLVNEKVRTLNGKLK |
| Ga0209596_11989791 | 3300027754 | Freshwater Lake | LVTKLQTKLKRDVKLSRSQVIKTLVNEKARTLNGKLSK |
| Ga0209598_103172313 | 3300027760 | Freshwater Lake | NITVDNDTYGLVTRLQTKLKRDVKLSRSQVIKTLVNEKARTLNGKLSK |
| Ga0209086_101064721 | 3300027770 | Freshwater Lake | NDTYGLVTKLQTKLKRDVKLSRSQVIKTLVNEKARTLNGKLSK |
| Ga0209086_103569473 | 3300027770 | Freshwater Lake | KLQTKLKRDVKLSRSQVIKTLVNEKARTLNGKLSK |
| Ga0209246_103141691 | 3300027785 | Freshwater Lake | TVDNDTYAIVTKLQTKLKKDIKLSRSQVIKTLVNEKARTLNGKLSK |
| Ga0209401_10568351 | 3300027971 | Freshwater Lake | TVDNDTYAIVTKLQTKLKSDVKLSRSQVIKTLVNEKARTLNGKLK |
| Ga0209299_10310181 | 3300027974 | Freshwater Lake | TVDNDTYGLVTRLQTKLKRDIKLSRSQVIKTLVNEKARTLNGKLSK |
| Ga0256382_11473551 | 3300028022 | Seawater | ATITKLQTKIAPDVKLSRSQVVKTLVNEKARKLNGRFSK |
| (restricted) Ga0247838_10212811 | 3300028044 | Freshwater | TKLQTKLKRDIKLSRSQVIKTLVKEKARLLNGSLTK |
| Ga0256368_10289491 | 3300028125 | Sea-Ice Brine | STITKLQTKIAPDVKLSRSQVVKTLVNEKARKLNGRLNK |
| Ga0304730_11659113 | 3300028394 | Freshwater Lake | VDNDTYGLVTRLQTKLKRDVKLSRSQVIKTLVNEKARTLNGKLSK |
| (restricted) Ga0247843_11926461 | 3300028569 | Freshwater | KNITVDNDTYSTVTKLQTKLKRDVKLSRSQVIKTLVKEKARLLNGSLTK |
| Ga0135226_10176791 | 3300029308 | Marine Harbor | FPVTINDTYATITKLQTKLAQDVKLSRSQVVKTLVNEKARKLNGRVSK |
| Ga0308025_10379941 | 3300031143 | Marine | NETYSIVTKMQTKITKDVKLSRSQVVKTLVKEKARKLNGSINNKSSD |
| Ga0307375_107939651 | 3300031669 | Soil | DNQTYAIITKLQTKLVPEVTLSRSQVIKTIVQEKARKLNGRLK |
| Ga0315274_108204015 | 3300031999 | Sediment | NDAYGLVTKLQTKLKRDVKLSRSQVIKTLVNEKARTLNGKLSK |
| Ga0315286_101147621 | 3300032342 | Sediment | VTKLQTKLKRDVKLSRSQVIKTLVNEKARTLNGKLSK |
| Ga0334977_0439539_481_603 | 3300033978 | Freshwater | TYVIVTKLQTKLKKDIKLSRSQVIKTLVNEKARTLNGKLK |
| Ga0334996_0324001_3_116 | 3300033994 | Freshwater | VTKLQTKLKKDIKLSRSQVIKTLVNEKARTLNGKLSK |
| Ga0334987_0753525_420_548 | 3300034061 | Freshwater | NDTYAIVTKLQTKLKKDIKLSRSQVIKTLVNEKARTLNGKLK |
| Ga0335031_0259219_3_152 | 3300034104 | Freshwater | NITVDNDTYGFVTKLQTKLKKDIKLSRSQVIKTLVNEKVRTLNGKLSKV |
| Ga0348337_073875_3_110 | 3300034418 | Aqueous | LQTKMTPDVKLSRSQVIKTLVKEKARKLNGKLLKD |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |