| Basic Information | |
|---|---|
| Family ID | F057697 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 136 |
| Average Sequence Length | 44 residues |
| Representative Sequence | YTTGWVDYQPGDLPADLLKRAAQLLHLYENAAKESFSSTLAPH |
| Number of Associated Samples | 104 |
| Number of Associated Scaffolds | 136 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 88.24 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.529 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (41.912 % of family members) |
| Environment Ontology (ENVO) | Unclassified (40.441 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (45.588 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.44% β-sheet: 0.00% Coil/Unstructured: 60.56% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 136 Family Scaffolds |
|---|---|---|
| PF00578 | AhpC-TSA | 5.88 |
| PF13407 | Peripla_BP_4 | 4.41 |
| PF13418 | Kelch_4 | 2.21 |
| PF07238 | PilZ | 2.21 |
| PF14294 | DUF4372 | 1.47 |
| PF03475 | 3-alpha | 1.47 |
| PF13751 | DDE_Tnp_1_6 | 1.47 |
| PF02576 | RimP_N | 1.47 |
| PF11154 | DUF2934 | 0.74 |
| PF06114 | Peptidase_M78 | 0.74 |
| PF05163 | DinB | 0.74 |
| PF04909 | Amidohydro_2 | 0.74 |
| PF13673 | Acetyltransf_10 | 0.74 |
| PF03575 | Peptidase_S51 | 0.74 |
| PF01344 | Kelch_1 | 0.74 |
| PF05569 | Peptidase_M56 | 0.74 |
| PF03928 | HbpS-like | 0.74 |
| PF12867 | DinB_2 | 0.74 |
| PF00970 | FAD_binding_6 | 0.74 |
| PF00903 | Glyoxalase | 0.74 |
| PF02621 | VitK2_biosynth | 0.74 |
| PF01116 | F_bP_aldolase | 0.74 |
| PF01112 | Asparaginase_2 | 0.74 |
| PF00175 | NAD_binding_1 | 0.74 |
| PF13489 | Methyltransf_23 | 0.74 |
| PF13561 | adh_short_C2 | 0.74 |
| PF04392 | ABC_sub_bind | 0.74 |
| PF10459 | Peptidase_S46 | 0.74 |
| PF14520 | HHH_5 | 0.74 |
| COG ID | Name | Functional Category | % Frequency in 136 Family Scaffolds |
|---|---|---|---|
| COG0779 | Ribosome maturation factor RimP | Translation, ribosomal structure and biogenesis [J] | 1.47 |
| COG2258 | N-hydroxylaminopurine reductase YiiM, contains MOSC domain | Defense mechanisms [V] | 1.47 |
| COG0191 | Fructose/tagatose bisphosphate aldolase | Carbohydrate transport and metabolism [G] | 0.74 |
| COG1427 | Chorismate dehydratase (menaquinone biosynthesis, futalosine pathway) | Coenzyme transport and metabolism [H] | 0.74 |
| COG1446 | Isoaspartyl peptidase or L-asparaginase, Ntn-hydrolase superfamily | Amino acid transport and metabolism [E] | 0.74 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.74 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.74 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.53 % |
| Unclassified | root | N/A | 1.47 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_101376700 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 686 | Open in IMG/M |
| 3300001431|F14TB_102201040 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1296 | Open in IMG/M |
| 3300002914|JGI25617J43924_10173853 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300002914|JGI25617J43924_10207072 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300004082|Ga0062384_100767752 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 670 | Open in IMG/M |
| 3300005175|Ga0066673_10633031 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
| 3300005176|Ga0066679_10266022 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
| 3300005186|Ga0066676_10524828 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300005186|Ga0066676_10844670 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300005187|Ga0066675_10200096 | All Organisms → cellular organisms → Bacteria | 1403 | Open in IMG/M |
| 3300005518|Ga0070699_101854766 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
| 3300005555|Ga0066692_10380503 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300005557|Ga0066704_10018365 | All Organisms → cellular organisms → Bacteria | 4075 | Open in IMG/M |
| 3300005557|Ga0066704_10807017 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300005559|Ga0066700_10436757 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300005566|Ga0066693_10284125 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300006046|Ga0066652_100380146 | All Organisms → cellular organisms → Bacteria | 1280 | Open in IMG/M |
| 3300006163|Ga0070715_10950694 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300006796|Ga0066665_10023510 | All Organisms → cellular organisms → Bacteria | 3916 | Open in IMG/M |
| 3300006914|Ga0075436_100065646 | All Organisms → cellular organisms → Bacteria | 2508 | Open in IMG/M |
| 3300006954|Ga0079219_12323114 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300007258|Ga0099793_10002778 | All Organisms → cellular organisms → Bacteria | 5920 | Open in IMG/M |
| 3300007265|Ga0099794_10616885 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300007265|Ga0099794_10803265 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300009038|Ga0099829_11002822 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300009088|Ga0099830_11349551 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300009137|Ga0066709_101834041 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300009143|Ga0099792_10757968 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300009143|Ga0099792_10857953 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300009143|Ga0099792_10909516 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300009683|Ga0116224_10558651 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300010048|Ga0126373_11683659 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 698 | Open in IMG/M |
| 3300010303|Ga0134082_10232845 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300010321|Ga0134067_10457731 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300010321|Ga0134067_10502345 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300010322|Ga0134084_10033873 | All Organisms → cellular organisms → Bacteria | 1442 | Open in IMG/M |
| 3300010358|Ga0126370_11883106 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300010361|Ga0126378_11688278 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300010366|Ga0126379_11184575 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 870 | Open in IMG/M |
| 3300010376|Ga0126381_103316909 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 635 | Open in IMG/M |
| 3300011270|Ga0137391_11149998 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300011271|Ga0137393_10112661 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2234 | Open in IMG/M |
| 3300012096|Ga0137389_10447413 | All Organisms → cellular organisms → Bacteria | 1106 | Open in IMG/M |
| 3300012189|Ga0137388_11110782 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300012189|Ga0137388_11363321 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300012200|Ga0137382_10334904 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
| 3300012200|Ga0137382_10582928 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300012201|Ga0137365_10790274 | Not Available | 693 | Open in IMG/M |
| 3300012203|Ga0137399_11101648 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 669 | Open in IMG/M |
| 3300012205|Ga0137362_11473637 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300012206|Ga0137380_10687908 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
| 3300012210|Ga0137378_11422078 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
| 3300012356|Ga0137371_10473366 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
| 3300012357|Ga0137384_10360756 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → unclassified Acidipila → Acidipila sp. | 1203 | Open in IMG/M |
| 3300012361|Ga0137360_10175714 | All Organisms → cellular organisms → Bacteria | 1717 | Open in IMG/M |
| 3300012363|Ga0137390_10268141 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1692 | Open in IMG/M |
| 3300012363|Ga0137390_11511739 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300012582|Ga0137358_10635175 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300012918|Ga0137396_10151518 | All Organisms → cellular organisms → Bacteria | 1688 | Open in IMG/M |
| 3300012918|Ga0137396_10403279 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300012918|Ga0137396_11275879 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300012922|Ga0137394_11244469 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300012922|Ga0137394_11309172 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300012923|Ga0137359_10267180 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1525 | Open in IMG/M |
| 3300012923|Ga0137359_10338083 | All Organisms → cellular organisms → Bacteria | 1339 | Open in IMG/M |
| 3300012923|Ga0137359_11284543 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300012923|Ga0137359_11603539 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300012923|Ga0137359_11659631 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300012927|Ga0137416_11511868 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 610 | Open in IMG/M |
| 3300012927|Ga0137416_12048459 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300012929|Ga0137404_10504282 | All Organisms → cellular organisms → Bacteria | 1080 | Open in IMG/M |
| 3300012929|Ga0137404_10975719 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300012931|Ga0153915_12675593 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300012931|Ga0153915_13107318 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300012975|Ga0134110_10179063 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300015051|Ga0137414_1104061 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300015053|Ga0137405_1112194 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2183 | Open in IMG/M |
| 3300015054|Ga0137420_1127424 | All Organisms → cellular organisms → Bacteria | 1245 | Open in IMG/M |
| 3300015193|Ga0167668_1087366 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
| 3300015241|Ga0137418_10193667 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1762 | Open in IMG/M |
| 3300015241|Ga0137418_10292702 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1365 | Open in IMG/M |
| 3300015245|Ga0137409_10371862 | All Organisms → cellular organisms → Bacteria | 1242 | Open in IMG/M |
| 3300015264|Ga0137403_10204583 | All Organisms → cellular organisms → Bacteria | 1905 | Open in IMG/M |
| 3300015264|Ga0137403_10511338 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
| 3300015264|Ga0137403_11525444 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300016341|Ga0182035_10510663 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1027 | Open in IMG/M |
| 3300016445|Ga0182038_11006828 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 738 | Open in IMG/M |
| 3300017934|Ga0187803_10013632 | All Organisms → cellular organisms → Bacteria | 3250 | Open in IMG/M |
| 3300020199|Ga0179592_10399947 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
| 3300021168|Ga0210406_10052853 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3548 | Open in IMG/M |
| 3300021168|Ga0210406_11233745 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
| 3300021181|Ga0210388_10008420 | All Organisms → cellular organisms → Bacteria | 8158 | Open in IMG/M |
| 3300021181|Ga0210388_10128352 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2190 | Open in IMG/M |
| 3300021478|Ga0210402_10575142 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
| 3300022724|Ga0242665_10132108 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300024182|Ga0247669_1005843 | All Organisms → cellular organisms → Bacteria | 2484 | Open in IMG/M |
| 3300025915|Ga0207693_10317050 | All Organisms → cellular organisms → Bacteria | 1220 | Open in IMG/M |
| 3300025939|Ga0207665_10943343 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300026304|Ga0209240_1109705 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300026313|Ga0209761_1331919 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300026317|Ga0209154_1321494 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300026325|Ga0209152_10306036 | Not Available | 596 | Open in IMG/M |
| 3300026328|Ga0209802_1256892 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300026527|Ga0209059_1071684 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1485 | Open in IMG/M |
| 3300026557|Ga0179587_10060733 | All Organisms → cellular organisms → Bacteria | 2200 | Open in IMG/M |
| 3300026557|Ga0179587_10345174 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
| 3300027512|Ga0209179_1121310 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300027565|Ga0209219_1049539 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1048 | Open in IMG/M |
| 3300027643|Ga0209076_1011162 | All Organisms → cellular organisms → Bacteria | 2306 | Open in IMG/M |
| 3300027765|Ga0209073_10433068 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
| 3300027783|Ga0209448_10260096 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300027812|Ga0209656_10022956 | All Organisms → cellular organisms → Bacteria | 3794 | Open in IMG/M |
| 3300027842|Ga0209580_10216042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 952 | Open in IMG/M |
| 3300027853|Ga0209274_10418929 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 692 | Open in IMG/M |
| 3300027855|Ga0209693_10407864 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 656 | Open in IMG/M |
| 3300027882|Ga0209590_10802690 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300027911|Ga0209698_10064350 | All Organisms → cellular organisms → Bacteria | 3156 | Open in IMG/M |
| 3300028536|Ga0137415_10468636 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
| 3300028536|Ga0137415_10918821 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300031545|Ga0318541_10004643 | All Organisms → cellular organisms → Bacteria | 5681 | Open in IMG/M |
| 3300031720|Ga0307469_10437481 | All Organisms → cellular organisms → Bacteria | 1128 | Open in IMG/M |
| 3300031720|Ga0307469_11882322 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
| 3300031753|Ga0307477_10192573 | All Organisms → cellular organisms → Bacteria | 1419 | Open in IMG/M |
| 3300031754|Ga0307475_11576599 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300031793|Ga0318548_10195071 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 993 | Open in IMG/M |
| 3300031823|Ga0307478_10414514 | All Organisms → cellular organisms → Bacteria | 1117 | Open in IMG/M |
| 3300031833|Ga0310917_10159334 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1493 | Open in IMG/M |
| 3300031893|Ga0318536_10426054 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 669 | Open in IMG/M |
| 3300031962|Ga0307479_10631335 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
| 3300031962|Ga0307479_10772308 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300031962|Ga0307479_11046471 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 784 | Open in IMG/M |
| 3300032042|Ga0318545_10111733 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 961 | Open in IMG/M |
| 3300032180|Ga0307471_100334625 | All Organisms → cellular organisms → Bacteria | 1617 | Open in IMG/M |
| 3300032180|Ga0307471_102202499 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300032180|Ga0307471_102478087 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300033289|Ga0310914_10804446 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 838 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 41.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.56% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 8.09% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.68% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.68% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.68% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.94% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.21% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.47% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.47% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.47% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.47% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.74% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.74% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.74% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.74% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.74% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.74% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.74% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024182 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK10 | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1013767001 | 3300000364 | Soil | LEIVCSGRKVNLAYTTGWVDYQPGDLPSDLLNRATQLLNLYENAAKDSFSSTLAPH* |
| F14TB_1022010402 | 3300001431 | Soil | LDYQPGDLPSDLLRRATDILHLYKNASQDALSPTLAAS* |
| JGI25617J43924_101738532 | 3300002914 | Grasslands Soil | WVDYQPGELPSDLLKRATQILHLYENASKDSSSTTLAAR* |
| JGI25617J43924_102070722 | 3300002914 | Grasslands Soil | GWVDYQPGDLPSDLLKRASQILHLYENAAKESFSATLTTR* |
| Ga0062384_1007677523 | 3300004082 | Bog Forest Soil | NFTTGWVDYQPGDLPADLLKRAAELLHLYDAAAQESFSTTLAPH* |
| Ga0066673_106330312 | 3300005175 | Soil | YSTGWVDYQPGDLPSDLLKRASQLLHLYGDAAKDSYAAIGTSD* |
| Ga0066679_102660223 | 3300005176 | Soil | WVDYQPGDLPADLLKRAAQLLHLYENAAQENFSSTLAPH* |
| Ga0066676_105248282 | 3300005186 | Soil | AYTTGWVDYQPGDLPSDLLKRATQLLHLYENAVKDSFSSTFAPH* |
| Ga0066676_108446701 | 3300005186 | Soil | AYTTGWVDYQPGDLPSDLLKRATQLLHLYENAVKDSFSSTLSPR* |
| Ga0066675_102000961 | 3300005187 | Soil | YTTGWVDYQPGDLPSDLLKRAAQLLHLYENAAKESLSSTLAPH* |
| Ga0070699_1018547661 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | GWVDYQPGDLPSDLLKRATQLLHLYENAVKDSFSSTLAPH* |
| Ga0066692_103805033 | 3300005555 | Soil | SGRKINLAYTTGFVDYQPGDLPADLLKRAAQLLHLYENAANESFSSTRAPH* |
| Ga0066704_100183657 | 3300005557 | Soil | WVDYQAGDLPGDLLKRASQLLHLYDSAAKESFATTLNPH* |
| Ga0066704_108070171 | 3300005557 | Soil | IEVVCSGHRVNLAYTTGYVDYQPGDFPSDMLKRASQLLHLYENAAKESFSATLMPH* |
| Ga0066700_104367572 | 3300005559 | Soil | YTTGFVDYQPGDLPADLLKRAAQLLHLYENAAKESFSATLTPH* |
| Ga0066693_102841252 | 3300005566 | Soil | PGDLPADLLKRAAQLLHLYEDAAKESFSATLTPH* |
| Ga0066652_1003801463 | 3300006046 | Soil | MNLVYTTGWVDYQPGDLPADLLKRAAQLLHLYENAAKESLSSTLAPH* |
| Ga0070715_109506941 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | GWVDYQPGELPSDLLKRATQILHLYENASKDSTTLVAR* |
| Ga0066665_100235106 | 3300006796 | Soil | AYTTGFVDYQPGDLPADLLKRAAQLLHLYEDAAKESFSATLTPH* |
| Ga0075436_1000656464 | 3300006914 | Populus Rhizosphere | FVDYQQGDLPADLLKRAAQLLHLYENAAKESFSATLAPH* |
| Ga0079219_123231141 | 3300006954 | Agricultural Soil | SGQKIPLNFTTGWVDYQPGDLPAHLLKRAADLLHLYDTAAHDSFSQTLTPH* |
| Ga0099793_100027787 | 3300007258 | Vadose Zone Soil | VDYQPGDLPADLLKRAAQLLHLYENAAKESFSSTLAPH* |
| Ga0099794_106168852 | 3300007265 | Vadose Zone Soil | LTYTTGWVDYQAGDLPGDLLKRASQLLHLYDSAAKESFATTLHPH* |
| Ga0099794_108032652 | 3300007265 | Vadose Zone Soil | EVSCSGRKVSLTYTTGWVDYQAGDLPGDLLKRASQLLHLYDSAAKESFATTLNPH* |
| Ga0099829_110028221 | 3300009038 | Vadose Zone Soil | TTGFVDYQPGDMPGDLLKRAAQLLHLYENAAKESFSSTLAPH* |
| Ga0099830_113495511 | 3300009088 | Vadose Zone Soil | QPGDLPADLLKRAAQLLHLYENAAKESFSSTLAPH* |
| Ga0066709_1018340411 | 3300009137 | Grasslands Soil | VNLAYTTGFVDYQPGDLPADLLKRAAQLLHLYEDAAKESFSATLTPH* |
| Ga0099792_107579681 | 3300009143 | Vadose Zone Soil | GRRVALEYTTGWVDYQAGDLPGDLLKRASQLLHLYDSAAKESFATTLNPH* |
| Ga0099792_108579532 | 3300009143 | Vadose Zone Soil | WVDYQPGELPSDLLKRATQILHLYENASKDSLSTTLTR* |
| Ga0099792_109095162 | 3300009143 | Vadose Zone Soil | VDYQPGDLPADLLKRAAQLLHLYENAAKESLSSTLAPH* |
| Ga0116224_105586511 | 3300009683 | Peatlands Soil | VTLAYTTGFVDYQPGDLPADLLKRAANLLHLYENAAKESFSSTLAPH* |
| Ga0126373_116836592 | 3300010048 | Tropical Forest Soil | VDYQPGDMPSDLLKRASQLLHLYDNAAKESFFATGTR* |
| Ga0134082_102328452 | 3300010303 | Grasslands Soil | TDFADYQHSHLPADLLKRASQHFHLYEDAAKESFSATLTPH* |
| Ga0134067_104577312 | 3300010321 | Grasslands Soil | NLAYTTGYVDYQPGDFPSDMLKRASQLLHLYENAAKESFSATLMPH* |
| Ga0134067_105023452 | 3300010321 | Grasslands Soil | WVDYQAGDMPSDLLKRASQLLHLYGDAAKETCTATGTSN* |
| Ga0134084_100338731 | 3300010322 | Grasslands Soil | IEVVCSGHRVNLAYTTGYGDYQPGDFPSDMLKRASQLLHLYENAAKESFSATLMPH* |
| Ga0126370_118831062 | 3300010358 | Tropical Forest Soil | SISTGWIDYQPGESPAELLKRANHLLHLYENVAKSPLSTSLAS* |
| Ga0126378_116882782 | 3300010361 | Tropical Forest Soil | CITGCVDYQPGDLPSDLLKRASQILHLYENAAKESYSATVTSR* |
| Ga0126379_111845751 | 3300010366 | Tropical Forest Soil | QPGDMPSDLLKRASQLLHLYDNAAKESFFATGTR* |
| Ga0126381_1033169091 | 3300010376 | Tropical Forest Soil | LELTCLGREINLTYTTGWVDYQPGELPSELLKRASQLLHLYEHAAKESFASTLTPD* |
| Ga0137391_111499981 | 3300011270 | Vadose Zone Soil | WVDYQPGDLPADLLKRAAQLLHLYENAAKESFSSTLAPH* |
| Ga0137393_101126611 | 3300011271 | Vadose Zone Soil | NVAYTTGFVDYQPGDMPGDLLKRAAQLLHLYENAAKESFSSTLAPH* |
| Ga0137389_104474133 | 3300012096 | Vadose Zone Soil | NLAYTSGWVDYQPGDLPADLLNRAAQLLRLYENAAKESFSSTRAPH* |
| Ga0137388_111107821 | 3300012189 | Vadose Zone Soil | YTTGWVDYQPGDLPADLLMRAAQLLHLYENAAKESFSSTLAPH* |
| Ga0137388_113633212 | 3300012189 | Vadose Zone Soil | RINVAYTTGFVDYQPGDMPGDLLKRAAQLLHLYENAAKESFSSTLAPH* |
| Ga0137382_103349043 | 3300012200 | Vadose Zone Soil | VDYQAGDMPSALIKRAAQLLHLYENAAKDSFALTLAPH* |
| Ga0137382_105829281 | 3300012200 | Vadose Zone Soil | YQPGDFPSDMLKRASQLLHLYENAAKESFSATLMPH* |
| Ga0137365_107902741 | 3300012201 | Vadose Zone Soil | AGDMPSDLLKRTAQILHLYDSAAKDSFSPTVVQR* |
| Ga0137399_111016481 | 3300012203 | Vadose Zone Soil | YTTGWVAYQPGDLPSDLLTRAAHLLHLYENAAKESLSSTLAPH* |
| Ga0137362_114736372 | 3300012205 | Vadose Zone Soil | DYQAGDMPSDLLKRTAQILHLYDSAAKDSFSPTVVQR* |
| Ga0137380_106879082 | 3300012206 | Vadose Zone Soil | TTGWVDYQPGDLPGDLLKRAAQLLHLYENAANESFSSTIAPH* |
| Ga0137378_114220781 | 3300012210 | Vadose Zone Soil | TGWVDYQPGDMPSDLLKRASQLLHLYGDAAKETYSATGTSN* |
| Ga0137371_104733661 | 3300012356 | Vadose Zone Soil | GYVDYQPGDFPSDMLKRASQLLHLYENAAKESFSATLMPH* |
| Ga0137384_103607563 | 3300012357 | Vadose Zone Soil | AYTTGWVDYQPGDMPSDLLKRESQLLHLYGDAAKETYTATGTSN* |
| Ga0137360_101757143 | 3300012361 | Vadose Zone Soil | YTTGWVDYQPGDLPADLLKRAAQLLHLYENAAKESFSSTLAPH* |
| Ga0137390_102681414 | 3300012363 | Vadose Zone Soil | GWVDYQPGDLPADLLKRAAQLLHLYENAANESFSSTLAPH* |
| Ga0137390_115117391 | 3300012363 | Vadose Zone Soil | DYQPGDLPSDLLKRASQILHLYENASLDSSSTNLVAR* |
| Ga0137358_106351751 | 3300012582 | Vadose Zone Soil | TGWVDYQPGELPSDLLKRATQILHLYENASKDSSSTTLAAR* |
| Ga0137396_101515184 | 3300012918 | Vadose Zone Soil | GRRVALQYTTGWVDDQAADLPGDLLKRASQLLHLYDSAAKESFASTLHPH* |
| Ga0137396_104032792 | 3300012918 | Vadose Zone Soil | AYTTGFVDYQPGDLPGDLLKRAAQLLHLYENAANESFSSTLAPH* |
| Ga0137396_112758791 | 3300012918 | Vadose Zone Soil | GALEMVCSGRKMNLVYTTGWVDYQPGDLPADLLNRAAQLLHLYENAAKESFSSTLAPH* |
| Ga0137394_112444691 | 3300012922 | Vadose Zone Soil | TTGWVDYQPGDLPSDLLKRATQLLHLYENAANGSSSSTTALH* |
| Ga0137394_113091722 | 3300012922 | Vadose Zone Soil | QAGDLPGDLLKRASQLLHLYDSAAKESFATTLNPH* |
| Ga0137359_102671801 | 3300012923 | Vadose Zone Soil | RKINLVYTTGWVDYQPGDLPADLLKRAAQLLHLYENAAKESLSSTLAPH* |
| Ga0137359_103380833 | 3300012923 | Vadose Zone Soil | WVDYQPGELPSDLLKRATQILHLYENAAKDTLSTTVAAR* |
| Ga0137359_112845431 | 3300012923 | Vadose Zone Soil | PGELPSDLLKRATQILHLYENASKDSSSTTLAAR* |
| Ga0137359_116035391 | 3300012923 | Vadose Zone Soil | GWVDYQPGDLPSDLLKRASQILHLYENASKDSSSTTLVAR* |
| Ga0137359_116596312 | 3300012923 | Vadose Zone Soil | DYQPGDLPSDLLKRASQILHLYENASKDSSSTTLVAR* |
| Ga0137416_115118682 | 3300012927 | Vadose Zone Soil | EIACSGRKVNLAYTTGWVDYQAGDLPADLLKRALQLLHLYENAAKDNFASTLAPH* |
| Ga0137416_120484592 | 3300012927 | Vadose Zone Soil | IEVVCSGRRINLAYTTGFVDYQPGDLPADMLKRASQLLHLYENAAKDSFSATLAPH* |
| Ga0137404_105042821 | 3300012929 | Vadose Zone Soil | DLAYTTGWVDYQPGDLPSDLLKRATQLLHLYENALKDSFSSTRAPH* |
| Ga0137404_109757192 | 3300012929 | Vadose Zone Soil | AYTTGWVDYQPGDLPSDLLKRATQLLHLYETAVRDSFSSTLAPH* |
| Ga0153915_126755931 | 3300012931 | Freshwater Wetlands | VDYQPGDLPSELLKRATQLLHLYENAAKDSFSSTLAPH* |
| Ga0153915_131073181 | 3300012931 | Freshwater Wetlands | AGRKVNLVYTTGWVDYQSGDLPSELLERATQLLHLYENAAKDSFSSTLAPH* |
| Ga0134110_101790633 | 3300012975 | Grasslands Soil | QMTLAYTTGWVDYQPGDLPADLLKRAAQLLHLYENAAKESFSSTLAPH* |
| Ga0137414_11040611 | 3300015051 | Vadose Zone Soil | GRRVNVAYTTGFVDYQPGDMPGDLLKRAAQLLHLYENAANESFSSTLAPH* |
| Ga0137405_11121945 | 3300015053 | Vadose Zone Soil | KVTLAYTTGFVDYQPGDLPADLLKRAANLLHLYENAAKESFSSTLAPH* |
| Ga0137420_11274243 | 3300015054 | Vadose Zone Soil | RKVNLAYTTGWVDYQPGDLPADLLKRAAQLLHLYENAAKESFSSTLAPH* |
| Ga0167668_10873661 | 3300015193 | Glacier Forefield Soil | WVDYQPGDLPSDLLKRASQILHLYENASVDSPSTNLVAR* |
| Ga0137418_101936671 | 3300015241 | Vadose Zone Soil | TTGWVDYQPGDLPSDLLKRATQLLHLYENAAKDSFSSTLAPH* |
| Ga0137418_102927022 | 3300015241 | Vadose Zone Soil | TTGWVDYQPGDLPSDLLKRATQLLHLYENAAKDSFSSTLAQH* |
| Ga0137409_103718622 | 3300015245 | Vadose Zone Soil | TYTTGWVDYQPGDLPSDLLKRATQLLHLYENAANGSSSSTTALH* |
| Ga0137403_102045833 | 3300015264 | Vadose Zone Soil | TTGWVDYQPGDLPSDLLKRATQLLHLYETAVRDSFSSTLAPH* |
| Ga0137403_105113381 | 3300015264 | Vadose Zone Soil | TTGWVDYQPGDLPSDLLKRATQLLHLYENALKDSFSSTRAPH* |
| Ga0137403_115254441 | 3300015264 | Vadose Zone Soil | PGDLPSDLLKRATQLLHLYENAANGSSSSTTALH* |
| Ga0182035_105106633 | 3300016341 | Soil | WVDYQPGELPSDLLKRASQLLHLYEHAAKDSFASTLTPD |
| Ga0182038_110068282 | 3300016445 | Soil | DYQSGDMPSDLLKRASQLLHLYGDAAKDSYAATGTSN |
| Ga0187803_100136321 | 3300017934 | Freshwater Sediment | TTCSGRKITLGYTTGWVDYQQGDMPSDLLGRAAEILHLYDTAAKESFASTRAPN |
| Ga0179592_103999471 | 3300020199 | Vadose Zone Soil | AYTTGWVDYQPGDLPSDLLKRATQLLHLYENAAKDSFSSTLAPH |
| Ga0210406_100528535 | 3300021168 | Soil | DYQPGDLPGDLVKRAAQILHLYENAAKESYTLTRAPH |
| Ga0210406_112337451 | 3300021168 | Soil | IPLNFTTGWVDYQPGDLPADLLKRAAELLHLYDTAAHDSFSTTLAPH |
| Ga0210388_100084201 | 3300021181 | Soil | WVDYQPGDMPSDLLKRAAQILHLYETAANDSFSSTLAPH |
| Ga0210388_101283521 | 3300021181 | Soil | DYQAGDLPADLLKRAAQILHLYENAAKESVSATRLPH |
| Ga0210402_105751421 | 3300021478 | Soil | LAYTTGFVDYQPGDLPADMLKRASQLLHLYENAAKDSFSATLAPH |
| Ga0242665_101321081 | 3300022724 | Soil | TGWVDYQAGDLPADLLKRAAQLLHLYENAAKESFSATLAPH |
| Ga0247669_10058435 | 3300024182 | Soil | LSYTTGWVDYQPGDLPSDLLKRATQLLHLYENAAKDSSSSTLAAH |
| Ga0207693_103170503 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | AYTTGWVDYQPGDLPSDLLKRATQLLHLYETAVKDTFSSTLAP |
| Ga0207665_109433431 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | IVCSGRKVNFAYTTGWVDYQPGDLPSDLLNRATQLLNLYENAAKDSFSSSLVAH |
| Ga0209240_11097052 | 3300026304 | Grasslands Soil | ATGWVDYQPGELPSDLIKRATQILHLYENASKDSSSTTLAAR |
| Ga0209761_13319191 | 3300026313 | Grasslands Soil | TTGWVDYQAGDMPSDLLKRTAQILHLYDSAAKDSFSPTVVQR |
| Ga0209154_13214941 | 3300026317 | Soil | YQPGDFPSDMLKRASQLLHLYENAAKESFSATLMPH |
| Ga0209152_103060361 | 3300026325 | Soil | NLAYTTGFVDYQPGDLPADLLKRAAQLLHLYEDAAKESFSATLTPH |
| Ga0209802_12568922 | 3300026328 | Soil | AGRQLTLAYTTGWVDYQPGDLPSDMLKRATQLLHLYDDAAKQSFSTTLAPH |
| Ga0209059_10716841 | 3300026527 | Soil | TGCVDYQPGDMPSDLLKRASQLLHLYGDAAKDTYAATGTSN |
| Ga0179587_100607331 | 3300026557 | Vadose Zone Soil | FVDYQPGDLPADMLKRASQLLHLYENAAKDSFSATLAPH |
| Ga0179587_103451742 | 3300026557 | Vadose Zone Soil | MVCGGRRINLAYTTGWVDYQAGDMPSDLIKRAAQLLHLYENAAKDSFASTLAPH |
| Ga0209179_11213101 | 3300027512 | Vadose Zone Soil | DYQPGELPSDLLKRATQILHLYENASKDSLSTTLTR |
| Ga0209219_10495391 | 3300027565 | Forest Soil | GWVDYQPGDLPADLLKRAADLLHLYDTAAHDSFSTTLAPH |
| Ga0209076_10111621 | 3300027643 | Vadose Zone Soil | WVDYQPGDLPADLLKRAAQLLHLYENAAKESFSSTLAPH |
| Ga0209073_104330681 | 3300027765 | Agricultural Soil | LAYTTGWVDYQPGDMPSDLLKRASQLLHLYGDAAKDSYAATGTAN |
| Ga0209448_102600961 | 3300027783 | Bog Forest Soil | ALQLNCGGRQINLDYTTGWVDYQAGDLPSDLLRRAAQILHLYENAAKESFSATRVPH |
| Ga0209656_100229561 | 3300027812 | Bog Forest Soil | IPLNFTTGWVDYQPGDLPADLLKRAANLLHLYDTAAQDSFSTTLAPH |
| Ga0209580_102160422 | 3300027842 | Surface Soil | DYQPGDLPADLLKRAADLLHLYDTAAQDSFSTTLRPH |
| Ga0209274_104189292 | 3300027853 | Soil | WVDYQPGDLPADLLKRAAELLHLYDTAAHDSFSTTLAPH |
| Ga0209693_104078642 | 3300027855 | Soil | LNFTTGWVDYQPGDLPGDLLKRAAELLHLYDTAAHDSFSTTLAPH |
| Ga0209590_108026902 | 3300027882 | Vadose Zone Soil | VDYQPGDLPADLLKRAAQLLHLYENAANESFSSTRAPH |
| Ga0209698_100643507 | 3300027911 | Watersheds | VDYQSGDLPADLLKRAANLLHLYENAAKESFSSTLAPH |
| Ga0137415_104686363 | 3300028536 | Vadose Zone Soil | NLVYTTGWVDYQPGDLPADLLKRAAHLLHLYENAAKESFSSTLAPH |
| Ga0137415_109188211 | 3300028536 | Vadose Zone Soil | EIACSGRKVNLAYTTGWVDYQAGDLPADLLKRALQLLHLYENAAKDNFASTLAPH |
| Ga0318541_100046434 | 3300031545 | Soil | LPYTTGWVDYQPGDMPSDLLKRASQLLHLYGDATKDSYAATGTSN |
| Ga0307469_104374811 | 3300031720 | Hardwood Forest Soil | DYQAGDLPGDLLKRASQLLHLYDSAAKESFASTLHPH |
| Ga0307469_118823221 | 3300031720 | Hardwood Forest Soil | YTTGWVDYQPGDLPSDLLKRATQLLHLYENAAEGSFSSTLAPH |
| Ga0307477_101925733 | 3300031753 | Hardwood Forest Soil | YTTGFVDYQPGDLPADLLKRAAQLLHLYENAAKESFSATLAPH |
| Ga0307475_115765991 | 3300031754 | Hardwood Forest Soil | IPLDFTTGWVDYQPGDLPADLLKRAADLLHLYDTAAQDSFSTTLRPH |
| Ga0318548_101950712 | 3300031793 | Soil | YTTGWVDYQPGDMPSDLLKRASQLLHLYGDATKDSYAATGTSN |
| Ga0307478_104145143 | 3300031823 | Hardwood Forest Soil | VYTTGWVDYQPGDLPADLLKRAAQLLHLYENAAKESFSATLAPH |
| Ga0310917_101593341 | 3300031833 | Soil | YTTGWVDYQPGELPSDLLKRASQLLHLYEHAAKESFASTLRPD |
| Ga0318536_104260542 | 3300031893 | Soil | PYTTGWVDYQPGDMPSDLLKRASQLLHLYGDATKDSYAATGTSN |
| Ga0307479_106313352 | 3300031962 | Hardwood Forest Soil | RINLAYTTGFVDYQPGDLPADLLKRAAQLLHLYENAAKESFSATLVPH |
| Ga0307479_107723081 | 3300031962 | Hardwood Forest Soil | YTTGWVDYQPGDMPADLLKRAAQLLHLYENAAKESFSATLAPH |
| Ga0307479_110464711 | 3300031962 | Hardwood Forest Soil | LRQGKLGHMPAAYTTGWVDYQAGDLPSDLLERATQLLHLYENAAKDSFSSTLAPH |
| Ga0318545_101117332 | 3300032042 | Soil | VDYQPGELPSDLLKRASQLLHLYEHAAKESFASTLRPD |
| Ga0307471_1003346251 | 3300032180 | Hardwood Forest Soil | INLADTTGCVDYQPGYLPADMLKRASQLLHLYENAAKDSFSATLAPH |
| Ga0307471_1022024992 | 3300032180 | Hardwood Forest Soil | NVSGRRVVLEYTTGWVDYQAGDLPGDLLKRASQLLHLYDSAAKESFAATLHPH |
| Ga0307471_1024780871 | 3300032180 | Hardwood Forest Soil | TTGWVDYQAGDLPGDLLKRATQLLHLYDSAAKESFAATLHPH |
| Ga0310914_108044462 | 3300033289 | Soil | WVDYQSGDMPSDLLKRASQLLHLYGDAAKDSYAATGTSN |
| ⦗Top⦘ |