| Basic Information | |
|---|---|
| Family ID | F057628 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 136 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MVVLLVTGKLLLTVASAGFGASLGFAVKNWLDQREQVED |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 136 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 78.68 % |
| % of genes near scaffold ends (potentially truncated) | 19.12 % |
| % of genes from short scaffolds (< 2000 bps) | 69.12 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.588 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (37.500 % of family members) |
| Environment Ontology (ENVO) | Unclassified (41.176 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.059 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.22% β-sheet: 0.00% Coil/Unstructured: 44.78% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 136 Family Scaffolds |
|---|---|---|
| PF11138 | DUF2911 | 30.88 |
| PF01557 | FAA_hydrolase | 23.53 |
| PF02646 | RmuC | 11.76 |
| PF00266 | Aminotran_5 | 9.56 |
| PF01370 | Epimerase | 5.15 |
| PF13432 | TPR_16 | 2.94 |
| PF01619 | Pro_dh | 2.94 |
| PF09828 | Chrome_Resist | 1.47 |
| PF00196 | GerE | 1.47 |
| PF13478 | XdhC_C | 0.74 |
| PF13414 | TPR_11 | 0.74 |
| PF13460 | NAD_binding_10 | 0.74 |
| PF00561 | Abhydrolase_1 | 0.74 |
| PF00990 | GGDEF | 0.74 |
| COG ID | Name | Functional Category | % Frequency in 136 Family Scaffolds |
|---|---|---|---|
| COG1322 | DNA anti-recombination protein (rearrangement mutator) RmuC | Replication, recombination and repair [L] | 11.76 |
| COG0506 | Proline dehydrogenase | Amino acid transport and metabolism [E] | 2.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.59 % |
| Unclassified | root | N/A | 4.41 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001661|JGI12053J15887_10078362 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1823 | Open in IMG/M |
| 3300001661|JGI12053J15887_10116014 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1436 | Open in IMG/M |
| 3300002243|C687J29039_10126266 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300002557|JGI25381J37097_1005228 | All Organisms → cellular organisms → Bacteria | 2273 | Open in IMG/M |
| 3300002558|JGI25385J37094_10008235 | All Organisms → cellular organisms → Bacteria | 3699 | Open in IMG/M |
| 3300002558|JGI25385J37094_10019670 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2412 | Open in IMG/M |
| 3300002560|JGI25383J37093_10013537 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2699 | Open in IMG/M |
| 3300002560|JGI25383J37093_10036230 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1636 | Open in IMG/M |
| 3300002561|JGI25384J37096_10023305 | All Organisms → cellular organisms → Bacteria | 2412 | Open in IMG/M |
| 3300002562|JGI25382J37095_10001893 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6577 | Open in IMG/M |
| 3300002911|JGI25390J43892_10034519 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1217 | Open in IMG/M |
| 3300005174|Ga0066680_10188095 | All Organisms → cellular organisms → Bacteria | 1302 | Open in IMG/M |
| 3300005176|Ga0066679_10005529 | All Organisms → cellular organisms → Bacteria | 5844 | Open in IMG/M |
| 3300005181|Ga0066678_10085074 | All Organisms → cellular organisms → Bacteria | 1883 | Open in IMG/M |
| 3300005406|Ga0070703_10006300 | All Organisms → cellular organisms → Bacteria | 3325 | Open in IMG/M |
| 3300005440|Ga0070705_100495336 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 926 | Open in IMG/M |
| 3300005445|Ga0070708_101654138 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 595 | Open in IMG/M |
| 3300005447|Ga0066689_10168283 | All Organisms → cellular organisms → Bacteria | 1313 | Open in IMG/M |
| 3300005467|Ga0070706_100680693 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 954 | Open in IMG/M |
| 3300005471|Ga0070698_100013739 | All Organisms → cellular organisms → Bacteria | 8570 | Open in IMG/M |
| 3300005552|Ga0066701_10675379 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 622 | Open in IMG/M |
| 3300005556|Ga0066707_10105029 | All Organisms → cellular organisms → Bacteria | 1740 | Open in IMG/M |
| 3300005558|Ga0066698_10513977 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300005574|Ga0066694_10058370 | All Organisms → cellular organisms → Bacteria | 1765 | Open in IMG/M |
| 3300006031|Ga0066651_10108650 | All Organisms → cellular organisms → Bacteria | 1407 | Open in IMG/M |
| 3300006173|Ga0070716_100096520 | All Organisms → cellular organisms → Bacteria | 1802 | Open in IMG/M |
| 3300006794|Ga0066658_10006406 | All Organisms → cellular organisms → Bacteria | 4232 | Open in IMG/M |
| 3300006797|Ga0066659_10034055 | All Organisms → cellular organisms → Bacteria | 3078 | Open in IMG/M |
| 3300006854|Ga0075425_100474284 | All Organisms → cellular organisms → Bacteria | 1441 | Open in IMG/M |
| 3300007255|Ga0099791_10094679 | All Organisms → cellular organisms → Bacteria | 1370 | Open in IMG/M |
| 3300009012|Ga0066710_101932397 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300009038|Ga0099829_10004116 | All Organisms → cellular organisms → Bacteria | 8583 | Open in IMG/M |
| 3300009038|Ga0099829_10085343 | All Organisms → cellular organisms → Bacteria | 2427 | Open in IMG/M |
| 3300009038|Ga0099829_10788594 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 789 | Open in IMG/M |
| 3300009088|Ga0099830_10074133 | All Organisms → cellular organisms → Bacteria | 2477 | Open in IMG/M |
| 3300009088|Ga0099830_10277785 | All Organisms → cellular organisms → Bacteria | 1332 | Open in IMG/M |
| 3300009089|Ga0099828_10193300 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1814 | Open in IMG/M |
| 3300009089|Ga0099828_10339370 | All Organisms → cellular organisms → Bacteria | 1353 | Open in IMG/M |
| 3300009089|Ga0099828_10744712 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300009090|Ga0099827_10280265 | All Organisms → cellular organisms → Bacteria | 1407 | Open in IMG/M |
| 3300009090|Ga0099827_10373410 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1216 | Open in IMG/M |
| 3300009090|Ga0099827_10408521 | All Organisms → cellular organisms → Bacteria | 1161 | Open in IMG/M |
| 3300009803|Ga0105065_1087332 | Not Available | 504 | Open in IMG/M |
| 3300009808|Ga0105071_1039335 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 737 | Open in IMG/M |
| 3300010081|Ga0127457_1016171 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 649 | Open in IMG/M |
| 3300010085|Ga0127445_1035994 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 508 | Open in IMG/M |
| 3300010096|Ga0127473_1064448 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 506 | Open in IMG/M |
| 3300010126|Ga0127482_1065255 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 554 | Open in IMG/M |
| 3300010303|Ga0134082_10004449 | All Organisms → cellular organisms → Bacteria | 4993 | Open in IMG/M |
| 3300010337|Ga0134062_10106290 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
| 3300010396|Ga0134126_10840237 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
| 3300011270|Ga0137391_10159954 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1963 | Open in IMG/M |
| 3300012096|Ga0137389_11501265 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 570 | Open in IMG/M |
| 3300012198|Ga0137364_10110388 | All Organisms → cellular organisms → Bacteria | 1948 | Open in IMG/M |
| 3300012198|Ga0137364_10636057 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300012199|Ga0137383_11168459 | Not Available | 554 | Open in IMG/M |
| 3300012202|Ga0137363_10011946 | All Organisms → cellular organisms → Bacteria | 5576 | Open in IMG/M |
| 3300012203|Ga0137399_10125118 | All Organisms → cellular organisms → Bacteria | 2025 | Open in IMG/M |
| 3300012203|Ga0137399_10240057 | All Organisms → cellular organisms → Bacteria | 1483 | Open in IMG/M |
| 3300012204|Ga0137374_10122765 | All Organisms → cellular organisms → Bacteria | 2386 | Open in IMG/M |
| 3300012206|Ga0137380_10006001 | All Organisms → cellular organisms → Bacteria | 10817 | Open in IMG/M |
| 3300012206|Ga0137380_10140639 | All Organisms → cellular organisms → Bacteria | 2201 | Open in IMG/M |
| 3300012206|Ga0137380_10611984 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
| 3300012207|Ga0137381_10046142 | All Organisms → cellular organisms → Bacteria | 3583 | Open in IMG/M |
| 3300012208|Ga0137376_10011640 | All Organisms → cellular organisms → Bacteria | 6340 | Open in IMG/M |
| 3300012351|Ga0137386_10976545 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 604 | Open in IMG/M |
| 3300012357|Ga0137384_10822474 | Not Available | 751 | Open in IMG/M |
| 3300012359|Ga0137385_10394136 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
| 3300012397|Ga0134056_1081130 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 670 | Open in IMG/M |
| 3300012399|Ga0134061_1380853 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300012406|Ga0134053_1424898 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 554 | Open in IMG/M |
| 3300012685|Ga0137397_10113813 | All Organisms → cellular organisms → Bacteria | 1990 | Open in IMG/M |
| 3300012922|Ga0137394_10444561 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1103 | Open in IMG/M |
| 3300012929|Ga0137404_10730707 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300012944|Ga0137410_11563532 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300014154|Ga0134075_10203844 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
| 3300015054|Ga0137420_1455691 | All Organisms → cellular organisms → Bacteria | 2448 | Open in IMG/M |
| 3300015241|Ga0137418_11139660 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 553 | Open in IMG/M |
| 3300015242|Ga0137412_10275963 | All Organisms → cellular organisms → Bacteria | 1324 | Open in IMG/M |
| 3300017654|Ga0134069_1269562 | Not Available | 596 | Open in IMG/M |
| 3300017659|Ga0134083_10009691 | All Organisms → cellular organisms → Bacteria | 3199 | Open in IMG/M |
| 3300017659|Ga0134083_10116132 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1065 | Open in IMG/M |
| 3300017659|Ga0134083_10492780 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300018071|Ga0184618_10034681 | All Organisms → cellular organisms → Bacteria | 1756 | Open in IMG/M |
| 3300018431|Ga0066655_10006879 | All Organisms → cellular organisms → Bacteria | 4724 | Open in IMG/M |
| 3300018431|Ga0066655_10532036 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 783 | Open in IMG/M |
| 3300018433|Ga0066667_10015167 | All Organisms → cellular organisms → Bacteria | 3891 | Open in IMG/M |
| 3300019789|Ga0137408_1196206 | All Organisms → cellular organisms → Bacteria | 4432 | Open in IMG/M |
| 3300019789|Ga0137408_1429981 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 993 | Open in IMG/M |
| 3300019866|Ga0193756_1040888 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300020004|Ga0193755_1213561 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 541 | Open in IMG/M |
| 3300020170|Ga0179594_10004125 | All Organisms → cellular organisms → Bacteria | 3570 | Open in IMG/M |
| 3300020170|Ga0179594_10062337 | All Organisms → cellular organisms → Bacteria | 1283 | Open in IMG/M |
| 3300021046|Ga0215015_10029521 | All Organisms → cellular organisms → Bacteria | 4953 | Open in IMG/M |
| 3300021046|Ga0215015_10804514 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300021086|Ga0179596_10006143 | All Organisms → cellular organisms → Bacteria | 3655 | Open in IMG/M |
| 3300021086|Ga0179596_10009092 | All Organisms → cellular organisms → Bacteria | 3173 | Open in IMG/M |
| 3300021086|Ga0179596_10264076 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 852 | Open in IMG/M |
| 3300021088|Ga0210404_10527790 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 668 | Open in IMG/M |
| 3300024330|Ga0137417_1108880 | All Organisms → cellular organisms → Bacteria | 1873 | Open in IMG/M |
| 3300024330|Ga0137417_1330233 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1505 | Open in IMG/M |
| 3300025159|Ga0209619_10386904 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300025289|Ga0209002_10418628 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300025319|Ga0209520_10620991 | Not Available | 619 | Open in IMG/M |
| 3300025939|Ga0207665_10985769 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 670 | Open in IMG/M |
| 3300026295|Ga0209234_1000382 | All Organisms → cellular organisms → Bacteria | 15005 | Open in IMG/M |
| 3300026296|Ga0209235_1020757 | All Organisms → cellular organisms → Bacteria | 3512 | Open in IMG/M |
| 3300026296|Ga0209235_1264338 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 528 | Open in IMG/M |
| 3300026297|Ga0209237_1262462 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 529 | Open in IMG/M |
| 3300026301|Ga0209238_1051314 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1481 | Open in IMG/M |
| 3300026307|Ga0209469_1120572 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 645 | Open in IMG/M |
| 3300026313|Ga0209761_1071369 | All Organisms → cellular organisms → Bacteria | 1839 | Open in IMG/M |
| 3300026324|Ga0209470_1254082 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300026326|Ga0209801_1221704 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300026328|Ga0209802_1080001 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1520 | Open in IMG/M |
| 3300026332|Ga0209803_1012451 | All Organisms → cellular organisms → Bacteria | 4437 | Open in IMG/M |
| 3300026333|Ga0209158_1306957 | Not Available | 547 | Open in IMG/M |
| 3300026551|Ga0209648_10005500 | All Organisms → cellular organisms → Bacteria | 10844 | Open in IMG/M |
| 3300026551|Ga0209648_10008303 | All Organisms → cellular organisms → Bacteria | 8956 | Open in IMG/M |
| 3300026551|Ga0209648_10020421 | All Organisms → cellular organisms → Bacteria | 5791 | Open in IMG/M |
| 3300026551|Ga0209648_10192909 | All Organisms → cellular organisms → Bacteria | 1564 | Open in IMG/M |
| 3300026551|Ga0209648_10765775 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 527 | Open in IMG/M |
| 3300026551|Ga0209648_10832786 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 505 | Open in IMG/M |
| 3300027181|Ga0208997_1002007 | All Organisms → cellular organisms → Bacteria | 2283 | Open in IMG/M |
| 3300027273|Ga0209886_1050804 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 650 | Open in IMG/M |
| 3300027388|Ga0208995_1011632 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1498 | Open in IMG/M |
| 3300027480|Ga0208993_1007026 | All Organisms → cellular organisms → Bacteria | 1906 | Open in IMG/M |
| 3300027655|Ga0209388_1176116 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 599 | Open in IMG/M |
| 3300027846|Ga0209180_10399813 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 779 | Open in IMG/M |
| 3300027862|Ga0209701_10043807 | All Organisms → cellular organisms → Bacteria | 2886 | Open in IMG/M |
| 3300027862|Ga0209701_10055337 | All Organisms → cellular organisms → Bacteria | 2535 | Open in IMG/M |
| 3300027882|Ga0209590_10224784 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1192 | Open in IMG/M |
| 3300028536|Ga0137415_10319109 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1357 | Open in IMG/M |
| 3300031720|Ga0307469_10014425 | All Organisms → cellular organisms → Bacteria | 4047 | Open in IMG/M |
| 3300031720|Ga0307469_10039251 | All Organisms → cellular organisms → Bacteria | 2856 | Open in IMG/M |
| 3300031962|Ga0307479_11859353 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 553 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 37.50% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 17.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 12.50% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 10.29% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.15% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.21% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.21% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.21% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.74% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.74% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.74% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.74% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002243 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 | Environmental | Open in IMG/M |
| 3300002557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009803 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_40_50 | Environmental | Open in IMG/M |
| 3300009808 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 | Environmental | Open in IMG/M |
| 3300010081 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010085 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010096 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010126 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012397 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012399 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012406 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019866 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m1 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025159 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 3 | Environmental | Open in IMG/M |
| 3300025289 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 2 | Environmental | Open in IMG/M |
| 3300025319 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 1 | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027181 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027273 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 (SPAdes) | Environmental | Open in IMG/M |
| 3300027388 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027480 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12053J15887_100783624 | 3300001661 | Forest Soil | MMVLLVTGKVLLSVASAGFGASLGFAVKNWLDQREQVGD* |
| JGI12053J15887_101160142 | 3300001661 | Forest Soil | MVVLLMTGKLLLTVASAGFGASLGFAVKNWLDQREQVED* |
| C687J29039_101262661 | 3300002243 | Soil | MTVLVVTGKLLLSLASAGFGASLGFAVKQWLERRERLRS |
| JGI25381J37097_10052284 | 3300002557 | Grasslands Soil | MVVLLVTGKLLLTVASAGFGASLGFAVKNWLDQREQVED* |
| JGI25385J37094_100082354 | 3300002558 | Grasslands Soil | MVVLLIAGKLLLTVASAGFGATLGFAVKNWLDQREQVED* |
| JGI25385J37094_100196702 | 3300002558 | Grasslands Soil | MTVLLVTGKLLLGVASAGFGASLGFLIKDWLERRERVRD* |
| JGI25383J37093_100135373 | 3300002560 | Grasslands Soil | MVVLLMTGKLLLTVASAGFGASLGFAVKHWLDQREQVED* |
| JGI25383J37093_100362301 | 3300002560 | Grasslands Soil | MVVLLVTGKVLLTVASAGFGASLGFAVKNWLDQREQVED* |
| JGI25384J37096_100233052 | 3300002561 | Grasslands Soil | MTVXLVTGKLLLGVASAGFGASLGFLIKDWLERRERVRD* |
| JGI25382J37095_100018936 | 3300002562 | Grasslands Soil | MMALLVTGKLLLGVASAGFGASLGLALKNWLDQREQVGD* |
| JGI25390J43892_100345191 | 3300002911 | Grasslands Soil | AQGMVVLLVTGKLLLTVASAGFGASLGFAVKNWLDQREQVED* |
| Ga0066680_101880952 | 3300005174 | Soil | MAVLFVTGKLLLGVASAGFGASLGFALKSWLERRERVRD* |
| Ga0066679_100055294 | 3300005176 | Soil | MMVLLVTGKVLLSVASAGFGASLGFAVKNWLDQRDQVGD* |
| Ga0066678_100850743 | 3300005181 | Soil | MTVLLVTGKLLLGVASAGFGASLGFVIKDWLERRERVRD* |
| Ga0070703_100063003 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MVVLLVTGKLLLTVASAGFGASLGFAVKHWLDQREQVED* |
| Ga0070705_1004953362 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MAVLLVTGKVLLTVASAGFGASLGFAVKNWLDQREQVED* |
| Ga0070708_1016541382 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | RGMAVLLVTGKVLLTVASAGFGASLGFAVKNWLDQREQVED* |
| Ga0066689_101682832 | 3300005447 | Soil | MVVLLLTGKLLLTVASAGFGASLGFAVKHWLDHREQQVGD* |
| Ga0070706_1006806931 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MAVLLVTGKVLLTVASAGFGASLGFAVKHWLDQREQVED* |
| Ga0070698_10001373910 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MVVLLATGKLLLTVASAGFGASLGFAVKHWLDQREQVED* |
| Ga0066701_106753791 | 3300005552 | Soil | GMVVLLVTGKVLLTVASAGFGASLGFAVKNWLDQREQVED* |
| Ga0066707_101050293 | 3300005556 | Soil | MMALLVIGKLLLGVASAGFGASLGLALKNWLDQREQVGD* |
| Ga0066698_105139773 | 3300005558 | Soil | MVVLLMTGKLLLTVASAGFGASLGFAVKSWLDQREQVEE* |
| Ga0066694_100583703 | 3300005574 | Soil | MMALLVTGKLQLGVASAGFGASLGLALKNWLDQREQVGD* |
| Ga0066651_101086501 | 3300006031 | Soil | VVLLVTGKLLLTVASAGFGASLGFAVKNWLDQREQVED* |
| Ga0070716_1000965204 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MMVLLMTGKVLLSVASAGFGASLGFAVKNWLDRREEVGD* |
| Ga0066658_100064064 | 3300006794 | Soil | MVVLLVTGKLLLTVASAGFGASLGFAVKNWLEQREQVED* |
| Ga0066659_100340553 | 3300006797 | Soil | MMALLVIGKLLLGVASAGFGVSLGLALKNWLDQREQVGD* |
| Ga0075425_1004742843 | 3300006854 | Populus Rhizosphere | MVVLLVIGKLLLTVASAGFGATLGFAVKTWLDQREQVED* |
| Ga0099791_100946791 | 3300007255 | Vadose Zone Soil | MAVLLIAGKLLLTVASAGFGATLGFAVKNWLDQREQVED* |
| Ga0066710_1019323973 | 3300009012 | Grasslands Soil | RGMVVLLVTGKVLLTVASAGFGASLGFAVKNWLDQREQVED |
| Ga0099829_100041165 | 3300009038 | Vadose Zone Soil | MVVLLVTGKLLLTVASAGFGACLGFALKNWLDQREQVED* |
| Ga0099829_100853434 | 3300009038 | Vadose Zone Soil | MIVLVATGKLLLGMASAGFGASLGFAVKGWLEQRERVRD* |
| Ga0099829_107885942 | 3300009038 | Vadose Zone Soil | MLLIAGKLLLTVASAGFGATLGFAVKNWLDQREQVED* |
| Ga0099830_100741333 | 3300009088 | Vadose Zone Soil | MAVLLITGKLLLTVASAGFGATLGFAVKTWLDQREQVED* |
| Ga0099830_102777853 | 3300009088 | Vadose Zone Soil | MIVLVATGKLLLGMASAGFGASLGFAVKGWLEQRDRVRD* |
| Ga0099828_101933002 | 3300009089 | Vadose Zone Soil | MVVLLVTGKLLLTVASAGFGASLGFALKNWLDQREQVED* |
| Ga0099828_103393701 | 3300009089 | Vadose Zone Soil | MIVLVATGKLLLGMASAGFGASLGFAVKGWLEQRKRVRD* |
| Ga0099828_107447121 | 3300009089 | Vadose Zone Soil | LLIAGKLLLTVASAGFGATLGFAVKNWLDQREQVED* |
| Ga0099827_102802653 | 3300009090 | Vadose Zone Soil | MTGKLLLTVASAGFGASLGFAVKTWLDQREQVKD* |
| Ga0099827_103734101 | 3300009090 | Vadose Zone Soil | MVALLVTGKLLLTVASAGFGASLGFALKNWLDQREQVED* |
| Ga0099827_104085211 | 3300009090 | Vadose Zone Soil | MVVLLVTGKLLLTVASAGFGASLGFAVKSWLDQREQVED* |
| Ga0105065_10873321 | 3300009803 | Groundwater Sand | MLVVTGKLLLAIASGGFGASLGFAVKQWLEFRERL |
| Ga0105071_10393351 | 3300009808 | Groundwater Sand | MTGKLLLTVASAGFGASLGFAVKHWLDQRERVED* |
| Ga0127457_10161711 | 3300010081 | Grasslands Soil | MVVLLIAGKLLLTMASAGFGATLGFAVKNWLDQREQVED* |
| Ga0127445_10359941 | 3300010085 | Grasslands Soil | VTGKLLLTVASAGFGASLGFAVKNWLDQREQVED* |
| Ga0127473_10644482 | 3300010096 | Grasslands Soil | RGMVVLLVTGKLLLTVASAGFGASLGFAVKNWLDQREQVED* |
| Ga0127482_10652552 | 3300010126 | Grasslands Soil | VTGKLLLTMASAGFGASLGFAVKNWLDQREQVED* |
| Ga0134082_100044491 | 3300010303 | Grasslands Soil | LVTGKLLLTVASAGFGASLGFAVKNWLDQREQVED* |
| Ga0134062_101062902 | 3300010337 | Grasslands Soil | MMALLVTGKLLLGMASAGFGASLGLALKNWLDQREQVGD* |
| Ga0134126_108402371 | 3300010396 | Terrestrial Soil | GMVVLLVTGKLLLTVASAGFGASLGFAVKHWLDQREQVED* |
| Ga0137391_101599544 | 3300011270 | Vadose Zone Soil | MAVLLIAGKLLLTVASAVFGATLGFAVKNWLDQRAQVED* |
| Ga0137389_115012652 | 3300012096 | Vadose Zone Soil | MAVLLIAGKLLLTVASAGFGATLGFAVKNWLDQRAQVED* |
| Ga0137364_101103884 | 3300012198 | Vadose Zone Soil | LLVTGKLLLTVASAGFGASLGFALKNWLDQREQVED* |
| Ga0137364_106360571 | 3300012198 | Vadose Zone Soil | SMVVLLVTGKLLLTVASAGFGASLGFAVKNWLDQREQVED* |
| Ga0137383_111684591 | 3300012199 | Vadose Zone Soil | MIVLVATGKLLLSVASAGFGASLGFAVKDWLEHRGRVRG* |
| Ga0137363_100119461 | 3300012202 | Vadose Zone Soil | MAVLLIAGKLLLTVASAGCGATLGFAVKNWLDQREQVED* |
| Ga0137399_101251183 | 3300012203 | Vadose Zone Soil | MTGKFLLTVASAGFGASLGFAVKNWLDQRQQVED* |
| Ga0137399_102400572 | 3300012203 | Vadose Zone Soil | MVVLLMTGKLLLTVASAGFGASLGFSVKNWLDQREQGEE* |
| Ga0137374_101227653 | 3300012204 | Vadose Zone Soil | MTFLLATGKLLLGVASAGLGASLGLAVKDWLEHRERVRD* |
| Ga0137380_1000600113 | 3300012206 | Vadose Zone Soil | MTVLLITGKLLLSVASAGFGTSLGLAVKDWLERRERVRD* |
| Ga0137380_101406394 | 3300012206 | Vadose Zone Soil | MTALLITGKLLLSVASAGFGTSLGLAVKDWLERRERARD* |
| Ga0137380_106119841 | 3300012206 | Vadose Zone Soil | MVVLLVTGKVLLTVASAGFGASLGFAVKNWLDQREQIED* |
| Ga0137381_100461423 | 3300012207 | Vadose Zone Soil | MTVLLITGKLLLSVASAGFGTSLGLAVKDWLERRERARD* |
| Ga0137376_100116401 | 3300012208 | Vadose Zone Soil | MVVLLMTGKLLLTVASAGFGASLGFAVKSWLDQREQVED* |
| Ga0137386_109765452 | 3300012351 | Vadose Zone Soil | VTGKLLLTVASAGFGASLGFALKNWLDQREQVED* |
| Ga0137384_108224742 | 3300012357 | Vadose Zone Soil | ITGKLLLSVASAGFGTSLGLAVKDWLERRERARD* |
| Ga0137385_103941362 | 3300012359 | Vadose Zone Soil | MTALLITGKLLLSVASAGFGTSLGLAVKDWLERRERAR |
| Ga0134056_10811302 | 3300012397 | Grasslands Soil | LLIAGKLLLTMASAGFGATLGFAVKNWLDQREQVED* |
| Ga0134061_13808532 | 3300012399 | Grasslands Soil | MTLLLVTGKLLLGVASAGFGASLGFLIKDWLERRERVRD* |
| Ga0134053_14248982 | 3300012406 | Grasslands Soil | MVVLLVTGKLLLTVASAGFGASLGFAVKNWLDPREQVED* |
| Ga0137397_101138134 | 3300012685 | Vadose Zone Soil | MVVLLVTGKLLLTVASAGFGASLGFAVKTWLDQREQVED* |
| Ga0137394_104445612 | 3300012922 | Vadose Zone Soil | MTGKLLLTVASAGFGASLGFAVKHWLDQRQQVED* |
| Ga0137404_107307071 | 3300012929 | Vadose Zone Soil | MGVLLVTGKLLLTVASAGFGASLGFAVKNWLDQREQVED* |
| Ga0137410_115635322 | 3300012944 | Vadose Zone Soil | MIVLLVTGKLLLTVASAGFGASLGFAVKTWLDQREQVED* |
| Ga0134075_102038442 | 3300014154 | Grasslands Soil | MTFLLATGKVLLGIASAGLGASLGLAVKDWLEHRERVRD* |
| Ga0137420_14556911 | 3300015054 | Vadose Zone Soil | MLVLLVTGKLLLTVASAGFGASLGFAVKNWLDQREQVED* |
| Ga0137418_111396601 | 3300015241 | Vadose Zone Soil | MTGKLLLTVASAGFGASLGFAVKNWLDQRQQVED* |
| Ga0137412_102759632 | 3300015242 | Vadose Zone Soil | MVVLLMTGKLLLTVASAGFGATLGFAVKNWLDQREQVED* |
| Ga0134069_12695621 | 3300017654 | Grasslands Soil | MVVLLVTGKVLLTVASAGFGASLGFAVKNWLDQREQ |
| Ga0134083_100096913 | 3300017659 | Grasslands Soil | MVVLLIAGKLLLTMASAGFGATLGFAVKNWLDQREQVED |
| Ga0134083_101161321 | 3300017659 | Grasslands Soil | MVVLLVTGKVLLTVASAGFGASLGFAVKNWLDQREQIED |
| Ga0134083_104927802 | 3300017659 | Grasslands Soil | VLLVTGKLLLGVASAGFGASLGFVIKDWLERRERVRD |
| Ga0184618_100346811 | 3300018071 | Groundwater Sediment | MVVLLVTGKLLLTVASAGFGASLGFALKHWLDQREQVED |
| Ga0066655_100068795 | 3300018431 | Grasslands Soil | MTVLLVTGKLLLGVASAGFGASLGFLIKDWLERRERVRD |
| Ga0066655_105320362 | 3300018431 | Grasslands Soil | MVVLLVTGKLLLTVASAGFGASLGFAVKNWLDQREQVED |
| Ga0066667_100151671 | 3300018433 | Grasslands Soil | MVVLLVTGKVLLTVASAGFGASLGFAVKNWLDQREQVED |
| Ga0137408_11962062 | 3300019789 | Vadose Zone Soil | MVVLLIAGKLLLTVASAGFGATFGFAVKNWLDQREQVED |
| Ga0137408_14299812 | 3300019789 | Vadose Zone Soil | MGVLLVTGKLLLTVASAGFGASLGFAVKNWLDQREQVED |
| Ga0193756_10408881 | 3300019866 | Soil | MVVLLVTGKLLLTVASAGFGASLGFAVKHWLDQREQVED |
| Ga0193755_12135612 | 3300020004 | Soil | GMVVLLVTGKLLLTVASAGFGASLGFAVKHWLDQREQVED |
| Ga0179594_100041252 | 3300020170 | Vadose Zone Soil | MVVLLMTGKLLLTVASAGFGASLGFAVKSWLDQREQVEE |
| Ga0179594_100623371 | 3300020170 | Vadose Zone Soil | LVTGKLLLTVASAGFGASLGFAVKHWLDQREQVED |
| Ga0215015_100295215 | 3300021046 | Soil | MAVLLATGKLLLDVASAGFGASLGLAIKGWLERRDRMRD |
| Ga0215015_108045143 | 3300021046 | Soil | MIVLVATGKLLLGMASAGFGASLGFAVKGWLEQRDRVRD |
| Ga0179596_100061435 | 3300021086 | Vadose Zone Soil | MAVLLIAGKLLLTVASAGFGATLGFAVKNWLDQREQVED |
| Ga0179596_100090924 | 3300021086 | Vadose Zone Soil | MVVLLVTGKLLLTVASAGFGASLGFALKNWLDQREQVED |
| Ga0179596_102640762 | 3300021086 | Vadose Zone Soil | MVVLLIAGKLLLTVASAGFGATLGFAVKNWLDQREQVED |
| Ga0210404_105277901 | 3300021088 | Soil | MAVLLITGKLLLTVASAGFGATLGFAVKHWLDQREQVED |
| Ga0137417_11088803 | 3300024330 | Vadose Zone Soil | MMVLLVTGKVLLSVASAGFGASLGFAVKNWLDQRDQVGD |
| Ga0137417_13302333 | 3300024330 | Vadose Zone Soil | MVVLLMTGKLLLTVASAGFGASLGFAVKTWLDQREQVKD |
| Ga0209619_103869042 | 3300025159 | Soil | MTMLVVTGKLLLGLASAGFGASLGFAVKQWLERRERLRSDVEE |
| Ga0209002_104186281 | 3300025289 | Soil | MTVLVVTGKLLLSLASAGFGASLGFAVKQWLERRERLRSDVEE |
| Ga0209520_106209911 | 3300025319 | Soil | MTVLVVTGKLLLSLASAGFGASLGFAVKQWLERRERLGAEL |
| Ga0207665_109857692 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MMVLLMTGKVLLSVASAGFGASLGFAVKNWLDRREEVGD |
| Ga0209234_10003829 | 3300026295 | Grasslands Soil | MMVLFVTGKLLLGVASAGFGASLGFAVKNWLERQQVGD |
| Ga0209235_10207574 | 3300026296 | Grasslands Soil | MVVLLMTGKLLLTVASAGFGASLGFAVKHWLDQREQVED |
| Ga0209235_12643382 | 3300026296 | Grasslands Soil | MVVLLVTGKLLLTVASAGFGASLGFAVKNWLDQREQVEE |
| Ga0209237_12624622 | 3300026297 | Grasslands Soil | MMALLVTGKLLLGVASAGFGASLGLALKNWLDQREQVGD |
| Ga0209238_10513141 | 3300026301 | Grasslands Soil | MVVLLVTGKLLLTVASAGFGASLGFAVKNWLEQREQVED |
| Ga0209469_11205722 | 3300026307 | Soil | MMALLVTGKLQLGVASAGFGASLGLALKNWLDQREQVGD |
| Ga0209761_10713692 | 3300026313 | Grasslands Soil | MTVLLVTGKLLLGVASAGFGASLGFVIKDWLERRERVRD |
| Ga0209470_12540822 | 3300026324 | Soil | MMALLVIGKLLLGVASAGFGASLGLALKNWLDQREQVGD |
| Ga0209801_12217042 | 3300026326 | Soil | MAVLFVTGKLLLGVASAGFGASLGFALKSWLERRERVRD |
| Ga0209802_10800013 | 3300026328 | Soil | MMALLVIGKLLLGVASAGFGVSLGLALKNWLDQREQVGD |
| Ga0209803_10124517 | 3300026332 | Soil | GMVVLLVTGKVLLTVASAGFGASLGFAVKNWLDQREQVED |
| Ga0209158_13069571 | 3300026333 | Soil | VVMAVLFVTGKLLLGVASAGFGASLGFALKSWLERRERVRD |
| Ga0209648_100055008 | 3300026551 | Grasslands Soil | MIVLVATGKLLLGMASAGFGASLGFAVKGWLEQRKRVRD |
| Ga0209648_100083032 | 3300026551 | Grasslands Soil | MAVLLATGKLLLSVASAGFGASLGLALKGWLDQRDRTRD |
| Ga0209648_100204217 | 3300026551 | Grasslands Soil | MSLLVATGKLLLGVASAGFGASLGFAVKGWLEQRERVRD |
| Ga0209648_101929092 | 3300026551 | Grasslands Soil | MAVLLATGKLLLGVASAGFGTSLGLALKDWLERRDRQRD |
| Ga0209648_107657752 | 3300026551 | Grasslands Soil | VATGKLLLGVASAGFGASLGFAVKGWLEQRERVRD |
| Ga0209648_108327862 | 3300026551 | Grasslands Soil | MVVLLVTGKLLLTVASAGFGASLGFAVKNWLDQRDQVED |
| Ga0208997_10020071 | 3300027181 | Forest Soil | MVVLLMTGKLLLTVASAGFGASLGFAVKNWLDQREQVGD |
| Ga0209886_10508041 | 3300027273 | Groundwater Sand | MVVLLMTGKLLLTVASAGFGASLGFAVKHWLDQRERVED |
| Ga0208995_10116322 | 3300027388 | Forest Soil | MVVLLMTGKLLLTVASAGFGASLGFAVKNWLDQREQVED |
| Ga0208993_10070263 | 3300027480 | Forest Soil | MMVLLVTGKVLLSVASAGFGASLGFAVKNWLDQREQVGD |
| Ga0209388_11761161 | 3300027655 | Vadose Zone Soil | LLIAGKLLLTVASAGFGATLGFAVKNWLDQREQVED |
| Ga0209180_103998132 | 3300027846 | Vadose Zone Soil | MVMLLIAGKLLLTVASAGFGATLGFAVKNWLDQREQVED |
| Ga0209701_100438072 | 3300027862 | Vadose Zone Soil | MAVLLITGKLLLTVASAGFGATLGFAVKTWLDQREQVED |
| Ga0209701_100553371 | 3300027862 | Vadose Zone Soil | MIVLVATGKLLLGMASAGFGASLGFAVKGWLEQRERVRD |
| Ga0209590_102247843 | 3300027882 | Vadose Zone Soil | MVALLVTGKLLLTVASAGFGASLGFALKNWLDQREQVED |
| Ga0137415_103191091 | 3300028536 | Vadose Zone Soil | MVVLLMTGKFLLTVASAGFGASLGFAVKNWLDQRQQVED |
| Ga0307469_100144254 | 3300031720 | Hardwood Forest Soil | MVVLLVTGKLLLTVASAGFGASLGFAVKTWLDQREQVED |
| Ga0307469_100392514 | 3300031720 | Hardwood Forest Soil | MVVLLVTGKVMLTVASAGFGASLGFAVKNWLDQREQVED |
| Ga0307479_118593532 | 3300031962 | Hardwood Forest Soil | MLALVATGKLLLGVASAGFGASLGFAVKGWLEQRERLRD |
| ⦗Top⦘ |