NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F057569

Metagenome / Metatranscriptome Family F057569

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F057569
Family Type Metagenome / Metatranscriptome
Number of Sequences 136
Average Sequence Length 45 residues
Representative Sequence AYFRYRFFQDTFVRALGIVTFAGVLIAAISAGLGSLLGAPVGG
Number of Associated Samples 119
Number of Associated Scaffolds 136

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.21 %
% of genes near scaffold ends (potentially truncated) 96.32 %
% of genes from short scaffolds (< 2000 bps) 97.06 %
Associated GOLD sequencing projects 113
AlphaFold2 3D model prediction Yes
3D model pTM-score0.54

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (95.588 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(7.353 % of family members)
Environment Ontology (ENVO) Unclassified
(26.471 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(50.000 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 50.70%    β-sheet: 0.00%    Coil/Unstructured: 49.30%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.54
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 136 Family Scaffolds
PF01196Ribosomal_L17 60.29
PF03118RNA_pol_A_CTD 19.12
PF01957NfeD 5.15
PF00416Ribosomal_S13 1.47
PF01988VIT1 1.47
PF01479S4 1.47
PF08241Methyltransf_11 0.74
PF00557Peptidase_M24 0.74
PF13384HTH_23 0.74
PF03176MMPL 0.74
PF00353HemolysinCabind 0.74
PF13649Methyltransf_25 0.74

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 136 Family Scaffolds
COG0203Ribosomal protein L17Translation, ribosomal structure and biogenesis [J] 60.29
COG0202DNA-directed RNA polymerase, alpha subunit/40 kD subunitTranscription [K] 19.12
COG0099Ribosomal protein S13Translation, ribosomal structure and biogenesis [J] 1.47
COG1633Rubrerythrin, includes spore coat protein YhjRInorganic ion transport and metabolism [P] 1.47
COG1814Predicted Fe2+/Mn2+ transporter, VIT1/CCC1 familyInorganic ion transport and metabolism [P] 1.47
COG1033Predicted exporter protein, RND superfamilyGeneral function prediction only [R] 0.74
COG2409Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamilyGeneral function prediction only [R] 0.74


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.59 %
UnclassifiedrootN/A4.41 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908041|P3_CLC_ConsensusfromContig138308All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium610Open in IMG/M
2124908045|KansclcFeb2_ConsensusfromContig537646All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria793Open in IMG/M
2166559005|cont_contig87955All Organisms → cellular organisms → Bacteria642Open in IMG/M
2209111022|2221217594All Organisms → cellular organisms → Bacteria719Open in IMG/M
3300000955|JGI1027J12803_108818347Not Available561Open in IMG/M
3300002568|C688J35102_118203496All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300003319|soilL2_10145354All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1904Open in IMG/M
3300003321|soilH1_10163649All Organisms → cellular organisms → Bacteria1505Open in IMG/M
3300004479|Ga0062595_101385174All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059640Open in IMG/M
3300004479|Ga0062595_102325805All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300005093|Ga0062594_102751649All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria546Open in IMG/M
3300005178|Ga0066688_11008243All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300005332|Ga0066388_102499832All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059939Open in IMG/M
3300005332|Ga0066388_103764525All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales774Open in IMG/M
3300005344|Ga0070661_100793708All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria776Open in IMG/M
3300005344|Ga0070661_101274475All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300005435|Ga0070714_100952054All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales835Open in IMG/M
3300005435|Ga0070714_101370299All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales691Open in IMG/M
3300005454|Ga0066687_10646135All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300005471|Ga0070698_101278821All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria683Open in IMG/M
3300005530|Ga0070679_100714986All Organisms → cellular organisms → Bacteria944Open in IMG/M
3300005539|Ga0068853_102087310Not Available549Open in IMG/M
3300005543|Ga0070672_102041769All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300005563|Ga0068855_100935658All Organisms → cellular organisms → Bacteria914Open in IMG/M
3300005566|Ga0066693_10309660All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium632Open in IMG/M
3300005578|Ga0068854_100457139All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1068Open in IMG/M
3300005587|Ga0066654_10256297All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales924Open in IMG/M
3300005616|Ga0068852_101202883All Organisms → cellular organisms → Bacteria779Open in IMG/M
3300005764|Ga0066903_104466779All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales746Open in IMG/M
3300005892|Ga0075275_1039054All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales731Open in IMG/M
3300005901|Ga0075274_1028725All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia786Open in IMG/M
3300006057|Ga0075026_100793728All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059574Open in IMG/M
3300006163|Ga0070715_10001255All Organisms → cellular organisms → Bacteria7272Open in IMG/M
3300006175|Ga0070712_100362251All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1189Open in IMG/M
3300006606|Ga0074062_10001568All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia691Open in IMG/M
3300006755|Ga0079222_10861653All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia752Open in IMG/M
3300006794|Ga0066658_10318294All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales831Open in IMG/M
3300006794|Ga0066658_10908272All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300006800|Ga0066660_10838234All Organisms → cellular organisms → Bacteria749Open in IMG/M
3300006852|Ga0075433_10076754All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2942Open in IMG/M
3300006954|Ga0079219_11935556All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300009090|Ga0099827_11565936All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300009093|Ga0105240_11412051All Organisms → cellular organisms → Bacteria732Open in IMG/M
3300009098|Ga0105245_11311100All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales773Open in IMG/M
3300009137|Ga0066709_101857017All Organisms → cellular organisms → Bacteria841Open in IMG/M
3300009137|Ga0066709_102630979All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300010039|Ga0126309_11085824All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300010159|Ga0099796_10538386All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300010229|Ga0136218_1019997All Organisms → cellular organisms → Bacteria742Open in IMG/M
3300010303|Ga0134082_10153658All Organisms → cellular organisms → Bacteria931Open in IMG/M
3300010303|Ga0134082_10420690All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300010321|Ga0134067_10257725All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300010337|Ga0134062_10441202All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300010359|Ga0126376_11548227All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300010362|Ga0126377_12468701All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300010398|Ga0126383_11612764All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales738Open in IMG/M
3300010880|Ga0126350_12034810All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales655Open in IMG/M
3300011106|Ga0151489_1434401All Organisms → cellular organisms → Bacteria820Open in IMG/M
3300012011|Ga0120152_1157776All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300012014|Ga0120159_1102849All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium817Open in IMG/M
3300012200|Ga0137382_10874438All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300012206|Ga0137380_11635483Not Available528Open in IMG/M
3300012208|Ga0137376_11290182All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria620Open in IMG/M
3300012358|Ga0137368_10272147All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1159Open in IMG/M
3300012405|Ga0134041_1112813All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300012469|Ga0150984_117353005All Organisms → cellular organisms → Bacteria713Open in IMG/M
3300012898|Ga0157293_10086843All Organisms → cellular organisms → Bacteria779Open in IMG/M
3300012927|Ga0137416_10386266All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1183Open in IMG/M
3300012931|Ga0153915_11616871All Organisms → cellular organisms → Bacteria758Open in IMG/M
3300012948|Ga0126375_10740201All Organisms → cellular organisms → Bacteria771Open in IMG/M
3300012955|Ga0164298_10636028All Organisms → cellular organisms → Bacteria738Open in IMG/M
3300012984|Ga0164309_10887218All Organisms → cellular organisms → Bacteria → Terrabacteria group725Open in IMG/M
3300012986|Ga0164304_10928004All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300012988|Ga0164306_10128618All Organisms → cellular organisms → Bacteria1697Open in IMG/M
3300013100|Ga0157373_10443207All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium934Open in IMG/M
3300013105|Ga0157369_10868722All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium925Open in IMG/M
3300013772|Ga0120158_10118720All Organisms → cellular organisms → Bacteria1538Open in IMG/M
3300014497|Ga0182008_10188664All Organisms → cellular organisms → Bacteria1045Open in IMG/M
3300014497|Ga0182008_10890520All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300015357|Ga0134072_10141656All Organisms → cellular organisms → Bacteria782Open in IMG/M
3300017924|Ga0187820_1269662Not Available552Open in IMG/M
3300017937|Ga0187809_10168597All Organisms → cellular organisms → Bacteria765Open in IMG/M
3300017944|Ga0187786_10527659All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300017947|Ga0187785_10046912All Organisms → cellular organisms → Bacteria1610Open in IMG/M
3300017947|Ga0187785_10621015All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300017974|Ga0187777_10929561All Organisms → cellular organisms → Bacteria626Open in IMG/M
3300017974|Ga0187777_11414424All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300018431|Ga0066655_10932406All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300018433|Ga0066667_11505902All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300018433|Ga0066667_12078114All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300018468|Ga0066662_10805097All Organisms → cellular organisms → Bacteria912Open in IMG/M
3300018468|Ga0066662_12178301All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300018482|Ga0066669_11574243All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300018482|Ga0066669_12117735All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300020070|Ga0206356_11295680All Organisms → cellular organisms → Bacteria2049Open in IMG/M
3300021441|Ga0213871_10292562All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300021445|Ga0182009_10672221All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300021478|Ga0210402_10199239All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1840Open in IMG/M
3300021560|Ga0126371_10223298All Organisms → cellular organisms → Bacteria1989Open in IMG/M
3300021860|Ga0213851_1345397All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300024251|Ga0247679_1053668All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300025898|Ga0207692_10464221All Organisms → cellular organisms → Bacteria799Open in IMG/M
3300025915|Ga0207693_11246914All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300025920|Ga0207649_11153384All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300025920|Ga0207649_11541835All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300025921|Ga0207652_11822831All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300025927|Ga0207687_10863926All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales773Open in IMG/M
3300025928|Ga0207700_10471171All Organisms → cellular organisms → Bacteria1109Open in IMG/M
3300025928|Ga0207700_11057306All Organisms → cellular organisms → Bacteria726Open in IMG/M
3300025929|Ga0207664_11860078All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300025929|Ga0207664_12011608All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300025931|Ga0207644_10349307All Organisms → cellular organisms → Bacteria1200Open in IMG/M
3300025938|Ga0207704_11957655All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300025949|Ga0207667_10481908All Organisms → cellular organisms → Bacteria1259Open in IMG/M
3300026078|Ga0207702_11479079All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300026078|Ga0207702_11669390All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300026315|Ga0209686_1133639All Organisms → cellular organisms → Bacteria797Open in IMG/M
3300026550|Ga0209474_10505168All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300026816|Ga0207509_100020All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales3867Open in IMG/M
3300027826|Ga0209060_10276489All Organisms → cellular organisms → Bacteria768Open in IMG/M
3300027903|Ga0209488_10955202All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300028577|Ga0265318_10271380All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300028653|Ga0265323_10166807All Organisms → cellular organisms → Bacteria701Open in IMG/M
3300028792|Ga0307504_10427267All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300028819|Ga0307296_10260807All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria943Open in IMG/M
3300031022|Ga0138301_1497578All Organisms → cellular organisms → Bacteria761Open in IMG/M
3300031170|Ga0307498_10183020All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales719Open in IMG/M
3300031720|Ga0307469_11115664All Organisms → cellular organisms → Bacteria742Open in IMG/M
3300031792|Ga0318529_10541281All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300031945|Ga0310913_11084597All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300032074|Ga0308173_11520040Not Available629Open in IMG/M
3300032783|Ga0335079_11493090All Organisms → cellular organisms → Bacteria668Open in IMG/M
3300032828|Ga0335080_12035651All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300033158|Ga0335077_11668794Not Available604Open in IMG/M
3300033550|Ga0247829_11174976All Organisms → cellular organisms → Bacteria636Open in IMG/M
3300034268|Ga0372943_1039299All Organisms → cellular organisms → Bacteria546Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil7.35%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil6.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.88%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.88%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.15%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere5.15%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil4.41%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.41%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.68%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.94%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil2.94%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.21%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost2.21%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.21%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.21%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.47%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.47%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil1.47%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.47%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil1.47%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.47%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.47%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.47%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.47%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.47%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.47%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.74%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.74%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.74%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.74%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.74%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.74%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.74%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.74%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.74%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.74%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.74%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.74%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.74%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.74%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.74%
SoilEngineered → Lab Enrichment → Unclassified → Unclassified → Unclassified → Soil0.74%
SimulatedEngineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated0.74%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.74%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908041Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P3EnvironmentalOpen in IMG/M
2124908045Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011EnvironmentalOpen in IMG/M
2166559005Simulated microbial communities from Lyon, FranceEngineeredOpen in IMG/M
2209111022Grass soil microbial communities from Rothamsted Park, UK - Chitin enrichmentEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300003319Sugarcane bulk soil Sample L2EnvironmentalOpen in IMG/M
3300003321Sugarcane bulk soil Sample H1EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005892Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_305EnvironmentalOpen in IMG/M
3300005901Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_201EnvironmentalOpen in IMG/M
3300006057Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006606Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010229Soil microbial communities from Bangor area, North Wales, UK, treated with sorgoleone, replicate 1EngineeredOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011106Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300012011Permafrost microbial communities from Nunavut, Canada - A30_65cm_6MEnvironmentalOpen in IMG/M
3300012014Permafrost microbial communities from Nunavut, Canada - A10_80cm_6MEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012405Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013772Permafrost microbial communities from Nunavut, Canada - A10_80_0.25MEnvironmentalOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017944Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MGEnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021441Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1Host-AssociatedOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300021860Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024251Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026315Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300026816Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-SCHO21-B (SPAdes)EnvironmentalOpen in IMG/M
3300027826Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300028577Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaGHost-AssociatedOpen in IMG/M
3300028653Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaGHost-AssociatedOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300031022Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300034268Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
P3_CLC_006658602124908041SoilFFEDTFIRALGIVTFAGIIIAAISAGLGSLLGTAS
KansclcFeb2_100898102124908045SoilVLAYLRWRFFKDTFVRALGIVTFAGVVIAAISAGLGSLLGSPVSG
cont_0955.000056302166559005SimulatedFFQDTFVRALGIVTFAGVLIAAVSAGIGSLLGAPVAS
22220629852209111022Grass SoilMLAYFRYRFFQDTFVRALGIVTFAGVLIAAVSAGIGSLLGAPVAS
JGI1027J12803_10881834713300000955SoilFAIAVVAFELVMLAYFRYRFFQDTFIRALGLVTFAGVLIAAISAGLGSILGSPVAS*
C688J35102_11820349623300002568SoilAYLRWRFFADTFVRALGIVTFAGVIIAAVSAGLGSLLGSPVG*
soilL2_1014535433300003319Sugarcane Root And Bulk SoilLAYLRWRFFEDTFVRALGIVTFAGIIIAAVSAGLGSALGNAT*
soilH1_1016364943300003321Sugarcane Root And Bulk SoilVLAYLRWRFFADTFVRALGIVTFAGIVIAAVAAGLGSLLGTPTG*
Ga0062595_10138517413300004479SoilELLMLAYFRYRFFQDTFIRALGIVTFAGILIAAISAGLGSVLGAPVGS*
Ga0062595_10232580513300004479SoilAYFRYRFFQDTFIRALGIVTFAGIIIAAISAGLGSLLGSPSG*
Ga0062594_10275164913300005093SoilLAYLRWRFFQDTFVRALGIVTFAGVIIAAVSAGLGSLLGSPV*
Ga0066688_1100824313300005178SoilAFELLILAYFRYRFFQDTFLRALGIVTFAGIIIAAISAGLGSLLGSPTGS*
Ga0066388_10249983213300005332Tropical Forest SoilFELLTLAYLRWKFFQDTFVRALGIVTFAGIIIAGISAGLGSLLGNPVTG*
Ga0066388_10376452523300005332Tropical Forest SoilVTLAYLRWRFFEDTFVRALGIVTFAGVIIAAVSAGLGSLLGSPV*
Ga0070661_10079370833300005344Corn RhizosphereAFELLMLAYFRYRFFQDTFVRALGIVTFAGVLIVAISAGLGSLLGAPVGS*
Ga0070661_10127447533300005344Corn RhizosphereLAYFRYRFFQDTFIRALGIVTFAGVIIAAISAGLGSLLGTPVGG*
Ga0070714_10095205433300005435Agricultural SoilELLTLAYLRYRFFQDTFVRALGLVTFAGILIAAISAGLGSLLGSPIS*
Ga0070714_10137029913300005435Agricultural SoilVVAFELLMLAYFRYRFFQDTFIRALGIVTFAGILIAAISAGLGSVLGAPVGG*
Ga0066687_1064613513300005454SoilYFRWRFFQDTFVRALAIVTFAGILIAAVRAGLGSVLGTPVGH*
Ga0070698_10127882123300005471Corn, Switchgrass And Miscanthus RhizosphereAAGVVAFELLVLAYFRYRFFQDTFVRALGIVTFAGVLIAAISAGLGSLLGTPAGG*
Ga0070679_10071498613300005530Corn RhizosphereTLAWLRWKFFEDTFVRALGIVTFAGIVIAAVSAGLGSVLGTPGG*
Ga0068853_10208731023300005539Corn RhizosphereVALSFAIAVVGLELLTLAYLRWKFFSDTFVRALGIVTFAGVVIAAVAAGLGSILGTPGGG
Ga0070672_10204176923300005543Miscanthus RhizosphereFFQDTFIRALGLVTFAGVLIAAISAGLGSLLGSPISG*
Ga0068855_10093565813300005563Corn RhizosphereYFRYRFFQDTFIRALGIVTFAGVIIAAISAGLGSLLGTPVGG*
Ga0066693_1030966023300005566SoilFFADTFIRALGIVTFAGLIIAAVSAGLGSLLGSPTGG*
Ga0068854_10045713913300005578Corn RhizosphereMLAYFRYRFFQDTFIRALGIVTFAGVIIAAISAGLGSLLGTPVGG*
Ga0066654_1025629713300005587SoilAYFRWRFFKDTFVRALAIVTFAGILIAAISAGLGSLLGTPVGS*
Ga0068852_10120288313300005616Corn RhizosphereFLISNYSVALSFAIAVVGLELLTLAFLRWKFFSDTFIRALGIVTFAGVVIAAVAAGLGSILGTPGGG*
Ga0066903_10446677933300005764Tropical Forest SoilRYRFFQDTFVRALGIVTFAGVLIAAVSAGLGSLLGKPIGG*
Ga0075275_103905433300005892Rice Paddy SoilRWKFFEDTFVRALGIVTFAGLAIAGISALLGTLLGSPTG*
Ga0075274_102872533300005901Rice Paddy SoilYHVALFFAVAIVAFELLMLAYFRYRFFQDTFIRALGIVTFAGILIAAISAGLGSILGAPVGS*
Ga0075026_10079372823300006057WatershedsLTLAYLRWKFFADTFVRALGIVTFAGMIIAGISVALGSALGTPGGG*
Ga0070715_10001255123300006163Corn, Switchgrass And Miscanthus RhizosphereFQDTFIRALGIVTFAGIVIAGISAGLGSTLGSPVG*
Ga0070712_10036225133300006175Corn, Switchgrass And Miscanthus RhizosphereAYFRYRFFQDTFVRALGIVTFAGVLIAAISAGLGSLLGAPVGG*
Ga0074062_1000156833300006606SoilPGAPLPHGLDQAELLMLAYLRYRFFHDTFIRALGIVTFAGVLIAAISAGLGSLLGNPISG
Ga0079222_1086165313300006755Agricultural SoilLLMLAYFRYRFFQDTFIRALGIVTFAGILIAAISAGLGSVLGAPVGS*
Ga0066658_1031829413300006794SoilFFQDTFVRALAIVTFAGILIAAVSAGLGSVLGTPVGH*
Ga0066658_1090827223300006794SoilFFHDTFIRALGIVTFAGVVIVAIAAGLGSLLGAPVGG*
Ga0066660_1083823413300006800SoilAYFRWRFFQDTFVRALGIVTFAGVVIVTISAGLGSLLGSPVGG*
Ga0075433_1007675413300006852Populus RhizosphereAFELLALAYLRYRFFQDTFIRALGLVTFAGVLIAAISAGLGSLLGSPISG*
Ga0079219_1193555623300006954Agricultural SoilLLLAYFRWRFFEDTFIRALGIVTFAGVVIAGISAGLGSALGSPVS*
Ga0099827_1156593623300009090Vadose Zone SoilWFELLLLAYFRYRFFQDTFVRALGIVTFAGMIIAAISAGLGSLLGAPPGG*
Ga0105240_1141205123300009093Corn RhizosphereYFRWRFFSDTFVRALGIVTFAGMLIAAISAGLGSLLGAPVGG*
Ga0105245_1131110013300009098Miscanthus RhizosphereDYRVALFFAIAVVAFELVMLAYFRYRFFQDTFIRALGLVTFAGVLIAAISAGLGSILGSPVAG*
Ga0066709_10185701733300009137Grasslands SoilLMLAYFRYRFFQDTFVRALGIVTFAGILIAAISAGLGSVLGAPVGG*
Ga0066709_10263097913300009137Grasslands SoilRFFQDTFVRALGIVTFAGVLIAAISAGLGSLLGAPVGS*
Ga0126309_1108582423300010039Serpentine SoilGLELLLLAYFRWRFFEDTFIRALGIVTFAGVVIAAISAVLGSALGTPVG*
Ga0099796_1053838623300010159Vadose Zone SoilFRYRFFQDTFVRALGIVTFAGVLIAVISAGLGSLLGAPVGS*
Ga0136218_101999733300010229SoilWRFFNDTFVRALGIVTFAGIVIAALSAGLGSLLGNPGAG*
Ga0134082_1015365813300010303Grasslands SoilILAYFRYRFFQDTFLRPLGIVTFAGIIIAAISAGLGSLLGSPTGS*
Ga0134082_1042069023300010303Grasslands SoilVVVAFELLMLAYFRYRFFQDTFVRALGIVTFAGVLIAAISAGLGSLLGAPVGS*
Ga0134067_1025772513300010321Grasslands SoilMLAYFRYRFFQDTFIRALGIVTFACILIAAISAGLGSILGAPVGS*
Ga0134062_1044120213300010337Grasslands SoilLELLILAYFRYRFFQDTFIRALGIVTFAGAIIAAISAGLGSLLGTPTG*
Ga0126376_1154822733300010359Tropical Forest SoilAYLRWKFFQDTFIRALAIVTFAGVIIAGISAGLGSLLGNPVTG*
Ga0126377_1246870123300010362Tropical Forest SoilFAVAVVALELLTLAYFRYRFFQDTFIRALGLVTFAGVLIAAISAGLGSLLGAPVSG*
Ga0126383_1161276433300010398Tropical Forest SoilFQDTFIRALGIVTFAGIIIAGISAGLGSLLGNPVTG*
Ga0126350_1203481013300010880Boreal Forest SoilLAYFRYRFFQDTFVRALGIVTFAGIIIAAISAGLGSLLGAPPSG*
Ga0151489_143440113300011106SoilFFQDTFVRALGIVTFAGVLIAAISAGLGSLLGTPISGG*
Ga0120152_115777613300012011PermafrostFRYRFFQDTFVRALGIVTFAGVIIAAISAGLGSLLGNAGAG*
Ga0120159_110284913300012014PermafrostFFQDTFVRALGIVTFAGIIIAAISAGLGSLLGNPGAG*
Ga0137382_1087443833300012200Vadose Zone SoilVAFELLMLAYFRYRFFQDTFIRALGLVTFAGVLIAAVSAGLGSLLANPVGS*
Ga0137380_1163548313300012206Vadose Zone SoilVVGFELLMLAYFRYRFFQDTFIRALGIVTFAGILIAAISAGLGSVLGAPVGS*
Ga0137376_1129018213300012208Vadose Zone SoilQDTFIRALGIVTFAGVIIAAISAGLGSLLGTPGSG*
Ga0137368_1027214713300012358Vadose Zone SoilQFFQATVVRALGIVTFAGVIIAALIAGLGSLLGTPVAG*
Ga0134041_111281313300012405Grasslands SoilRFFQDTFIRALGIVTFAGIIIAAISAGLGSLLGTPGAS*
Ga0150984_11735300533300012469Avena Fatua RhizosphereLAYLRYRFFQDTFVRALGIVTFAGVLIAAVSAGLGSVLGNPIG*
Ga0157293_1008684333300012898SoilAFELVMLAYFRYRFFQDTFVRALGIVTFAGVLIAAVSAGLGSLLGKPIGG*
Ga0137416_1038626633300012927Vadose Zone SoilFELLLLAYFRYRFFQDTFVRALGIVTFAGIIIAAISAGLGSLLGSPTAG*
Ga0153915_1161687113300012931Freshwater WetlandsLLLLAYFRWRFFEDTFLRALAIVTFAGIAIAAMSTGLGDLLGAPVGG*
Ga0126375_1074020113300012948Tropical Forest SoilDDTFIRALAIVTFAGVVIAGISAGLGSALGSPVS*
Ga0164298_1063602813300012955SoilLRYRFFQDTFIRALGLVTFAGVLIAAISAGLGSLLGSPISG*
Ga0164309_1088721823300012984SoilELLILAYFRWKFFEDTFIRALGIVTCAGIIIAASSAGLGSLLGGAPTN*
Ga0164304_1092800413300012986SoilRYRFFQDTFIRALGLVTFAGVIIAAISAGLGSLLGSPSG*
Ga0164306_1012861843300012988SoilAFELLLLAYFRYRFFQDTFIRALGIVTFAGIIIAVISAGLGSLLGSPTGG*
Ga0157373_1044320743300013100Corn RhizosphereWRFFDDTFVRALGIVTFAGAIIAAVSAGLGSLLGNPGVGG*
Ga0157369_1086872233300013105Corn RhizosphereGLELLLLAYFRYRFFQDTFIRALGIVTFAGVIIAAISAGLGSLLGTPVGG*
Ga0120158_1011872013300013772PermafrostRLLLAYFRYRFFQDTFVRALGIVTFAGIIIAAISAGLGSLLGNPGAG*
Ga0182008_1018866443300014497RhizosphereFELLVLAYFRYRFFQDTFIRALGIVTFAGIIIAAISAGLGSLLGSPTGG*
Ga0182008_1089052023300014497RhizosphereAYLRWRFFQDTFIRALGIVTFAGVIIAAGSAGLGSVLGNPISG*
Ga0134072_1014165633300015357Grasslands SoilELLMLAYFRYRFFQDTFIRALGIVTFAGILIAAISAGLGSILGAPVGS*
Ga0187820_126966223300017924Freshwater SedimentFQDTFVRALAIVTFAGILIAAIAAGLGSLLGAPVGS
Ga0187809_1016859713300017937Freshwater SedimentYFRWRFFEDTFFRALGIVTFAGIIIAAVSAGLGSILGTPVGH
Ga0187786_1052765923300017944Tropical PeatlandAVAVVALELLALAYFRYRFFQDTFIRALGLVTFAGILIVAISAGLGSILGSPVAS
Ga0187785_1004691213300017947Tropical PeatlandFFQDTFIRALAIVTFAGVLIVAISAGLGSLLGKPIGG
Ga0187785_1062101523300017947Tropical PeatlandFLISDYRAALFFAVAVVALELLALAYFRYRFFQDTFIRALGLVTFAGILIVAISAGLGSILGSPVAS
Ga0187777_1092956133300017974Tropical PeatlandLLMLAYFRWRFFEDTFVRALGIVTFAGVLIVGISAGLGSLLGTPGGG
Ga0187777_1141442423300017974Tropical PeatlandALSFAVAVVGVELLTLAYLRWKFFSDTFVRALGIVTFAGMIIAGISAGLGSLLGTPGG
Ga0066655_1093240613300018431Grasslands SoilKSFADRFVRDIGIVLFAGLIIAGISVALGSALGTPGG
Ga0066667_1150590233300018433Grasslands SoilYRFFQDTFIRALGIVTFAGILIAAISAGLGSILGAPVGS
Ga0066667_1207811413300018433Grasslands SoilRFFQDTFVRALGIVTFAGVLIAAVSAGLGSLLGAPVGS
Ga0066662_1080509733300018468Grasslands SoilFFEGTFVRALGIVTFAGIIIAAISAGLGSLLGGTS
Ga0066662_1217830123300018468Grasslands SoilAYFRYRFFQDTFIRALGIVTFAGVLIAAISAGLGSLLGNPISG
Ga0066669_1157424333300018482Grasslands SoilYFRWRFFEDTFIRALGIVTFAGIVIAGISAGLGSVLGNPVS
Ga0066669_1211773523300018482Grasslands SoilFAVAVVAFELLMLAYFRYRFFQDTFIRALGLVTFAGVLIAAVSAGLGSLLANPVGS
Ga0206356_1129568013300020070Corn, Switchgrass And Miscanthus RhizosphereRYRFFQDTFIRALGIVTFAGIIIAVISAGLGSLLGSPTGG
Ga0213871_1029256213300021441RhizosphereVVAAELLTLAYFRYRFFQDTFVRALGIVTFAGILIAAVSAGLGSVLGAPVGG
Ga0182009_1067222133300021445SoilVLAYLRGRFFADTFVRALGIVTFAGVVIAAVAAGLGSLLGTPTAG
Ga0210402_1019923913300021478SoilFQDTFVRALGLVTFAGVLIAAISAGLGSLLGSPISS
Ga0126371_1022329813300021560Tropical Forest SoilGFELLMLAYFRYRFFQDTFIRALGIVTFAGVIIAGISAGLGSLLGNPVTG
Ga0213851_134539733300021860WatershedsADTFVRALGIVTFAGMIIAGISVALGSALGTPGGG
Ga0247679_105366833300024251SoilAVVAFELLMLAYFRYRFFQDTFVRALGIVTFAGVLIVAISAGLGSLLGAPVGS
Ga0207692_1046422113300025898Corn, Switchgrass And Miscanthus RhizosphereYLRYRFFQDTFIRALGIVTFAGIIIAVISAGLGSLLGSPTGG
Ga0207693_1124691413300025915Corn, Switchgrass And Miscanthus RhizosphereQDTFVRALGIVTFAGILIAAISAGLGSLLGAPVGS
Ga0207649_1115338423300025920Corn RhizosphereRYRFFADTFIRALAIVTFAGVVIAAVAAGLGSLLGTPASG
Ga0207649_1154183513300025920Corn RhizosphereRFFSDTFVRALGIVTFAGILIAAISAGLGSLLGAPVGS
Ga0207652_1182283123300025921Corn RhizosphereYFRWKFFEDTFVRALGIVTFAGIIIAAISAGLGSLLGGTPTN
Ga0207687_1086392613300025927Miscanthus RhizosphereDYRVALFFAIAVVAFELVMLAYFRYRFFQDTFIRALGLVTFAGVLIAAISAGLGSILGSPVAG
Ga0207700_1047117133300025928Corn, Switchgrass And Miscanthus RhizosphereFQDTFIRALGIVTFAGILIAAISAGLGSVLGAPVGS
Ga0207700_1105730633300025928Corn, Switchgrass And Miscanthus RhizosphereLAYFRWRFFQDTFIRALGIVTFAGIVIAGISAGLGSTLGSPVG
Ga0207664_1186007813300025929Agricultural SoilWRFFQDTFIRALGIVTFAGIVIAGISAGLGSTLGSPVG
Ga0207664_1201160813300025929Agricultural SoilAYFRYRFFQDTFIRALGIVTFAGILIAAISAGLGSVLGAPVGG
Ga0207644_1034930713300025931Switchgrass RhizosphereLRWRFFQDTFIRALGIVTFAGMIIVGISVALGSLLGTPAGS
Ga0207704_1195765513300025938Miscanthus RhizosphereQDTFIRALGLVTFAGVLIAAISAGLGSLLGSPISG
Ga0207667_1048190843300025949Corn RhizosphereFFQDTFVRALGIVTFAGIVIAAVAAGLGSLLGTPGG
Ga0207702_1147907933300026078Corn RhizosphereLSFAVAVVAFELLMLAYFRYRFFQDTFIRALGIVTFAGILIAAISAGLGSVLGAPVGG
Ga0207702_1166939033300026078Corn RhizosphereFRYRFFQDTFIRALGIVTFAGIIIAAISAGLGSLLGSPTGG
Ga0209686_113363913300026315SoilQDTFIRALGIVTFAGILIAAISAGLGSILGAPVGS
Ga0209474_1050516823300026550SoilLRWKFFEDSFVRALGIVTFAGIIIAAVSAGLGNQLGG
Ga0207509_10002013300026816SoilAIAVVAFELVMLAYFRYRFFQDTFIRALGLVTFAGVLIAAISAGLGSILGSPVAG
Ga0209060_1027648933300027826Surface SoilNYRVALFTAVGVVAFELLMLAYFRYRFFQDTFVRALGIVTFAGVLIAAISAGLGSLLGAPIGG
Ga0209488_1095520213300027903Vadose Zone SoilYLRYRFFADTFVRALGIVTFAGVIIAAVAAGLGSILGTPGGG
Ga0265318_1027138023300028577RhizosphereIVGVELLTLAYLRWKFFSDTFVRALGIVTFAGMIIAGISAGLGSLLGTPGG
Ga0265323_1016680723300028653RhizosphereQVALSFAIAVVGVELLTLAYLRWKFFSDTFVRALGIVTFAGMIIAGISAGLGSLLGTPGG
Ga0307504_1042726723300028792SoilAYFRLRFFKDTFVRALGIVTFAGVIIAAISAGLGSLLGAPAG
Ga0307296_1026080713300028819SoilRYRFFQDTFIRALGIVTFAGIIIAAISAGLGSLLGSPAGG
Ga0138301_149757833300031022SoilAFELVMLAYFRYRFFQDTFVRALGIVTFAGVLIAAVSAGLGSLLGSPISS
Ga0307498_1018302033300031170SoilFFQDTFIRALGIVTFAGVLIVAISAGLGSLLGAPVAS
Ga0307469_1111566413300031720Hardwood Forest SoilRWRFFQDTFIRALGIVTFAGIVIAGISAGLGSTLGSPVG
Ga0318529_1054128123300031792SoilVGFELLMLAYFRYRFFQDTFIRALAIVTFAGVLIVAISAGLGSLLGKPIGG
Ga0310913_1108459723300031945SoilKFFADTFVRALGIVTFAGMIIAGISAALGSALGTPGG
Ga0308173_1152004033300032074SoilRWRFFEDTFVRALGIVTFAGIVIAAVSAGLGSILGTPGGGG
Ga0335079_1149309033300032783SoilFAVAVVGVELLTLAYLRWKFFADTFVRALGIVTFAGMIIAGISAGLGSVLGTPGG
Ga0335080_1203565123300032828SoilLRWRFFKDTFIRALAIVTFAGMLIAAISAGLGSLLGTPVSG
Ga0335077_1166879413300033158SoilHYEVALLFAVAVVAFELLMLAYFRYRFFQDTFVRALSIVTFAGVLIAAISAGLGSLLGSPISG
Ga0247829_1117497613300033550SoilAYLRYRFFQDTFIRALGLVTFAGVLIAAISAGLGSLLGSPISGG
Ga0372943_1039299_1_2013300034268SoilFLIPNYKVALSFAVAVVGVELLTLAYLRWKFFSDTFVRALGIVTFAGMIIAGISAGLGAWLGTPGG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.