Basic Information | |
---|---|
Family ID | F057569 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 136 |
Average Sequence Length | 45 residues |
Representative Sequence | AYFRYRFFQDTFVRALGIVTFAGVLIAAISAGLGSLLGAPVGG |
Number of Associated Samples | 119 |
Number of Associated Scaffolds | 136 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 2.21 % |
% of genes near scaffold ends (potentially truncated) | 96.32 % |
% of genes from short scaffolds (< 2000 bps) | 97.06 % |
Associated GOLD sequencing projects | 113 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.54 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (95.588 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (7.353 % of family members) |
Environment Ontology (ENVO) | Unclassified (26.471 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.70% β-sheet: 0.00% Coil/Unstructured: 49.30% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 136 Family Scaffolds |
---|---|---|
PF01196 | Ribosomal_L17 | 60.29 |
PF03118 | RNA_pol_A_CTD | 19.12 |
PF01957 | NfeD | 5.15 |
PF00416 | Ribosomal_S13 | 1.47 |
PF01988 | VIT1 | 1.47 |
PF01479 | S4 | 1.47 |
PF08241 | Methyltransf_11 | 0.74 |
PF00557 | Peptidase_M24 | 0.74 |
PF13384 | HTH_23 | 0.74 |
PF03176 | MMPL | 0.74 |
PF00353 | HemolysinCabind | 0.74 |
PF13649 | Methyltransf_25 | 0.74 |
COG ID | Name | Functional Category | % Frequency in 136 Family Scaffolds |
---|---|---|---|
COG0203 | Ribosomal protein L17 | Translation, ribosomal structure and biogenesis [J] | 60.29 |
COG0202 | DNA-directed RNA polymerase, alpha subunit/40 kD subunit | Transcription [K] | 19.12 |
COG0099 | Ribosomal protein S13 | Translation, ribosomal structure and biogenesis [J] | 1.47 |
COG1633 | Rubrerythrin, includes spore coat protein YhjR | Inorganic ion transport and metabolism [P] | 1.47 |
COG1814 | Predicted Fe2+/Mn2+ transporter, VIT1/CCC1 family | Inorganic ion transport and metabolism [P] | 1.47 |
COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 0.74 |
COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 0.74 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 95.59 % |
Unclassified | root | N/A | 4.41 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2124908041|P3_CLC_ConsensusfromContig138308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 610 | Open in IMG/M |
2124908045|KansclcFeb2_ConsensusfromContig537646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 793 | Open in IMG/M |
2166559005|cont_contig87955 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
2209111022|2221217594 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
3300000955|JGI1027J12803_108818347 | Not Available | 561 | Open in IMG/M |
3300002568|C688J35102_118203496 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300003319|soilL2_10145354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1904 | Open in IMG/M |
3300003321|soilH1_10163649 | All Organisms → cellular organisms → Bacteria | 1505 | Open in IMG/M |
3300004479|Ga0062595_101385174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 640 | Open in IMG/M |
3300004479|Ga0062595_102325805 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300005093|Ga0062594_102751649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 546 | Open in IMG/M |
3300005178|Ga0066688_11008243 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300005332|Ga0066388_102499832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 939 | Open in IMG/M |
3300005332|Ga0066388_103764525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 774 | Open in IMG/M |
3300005344|Ga0070661_100793708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 776 | Open in IMG/M |
3300005344|Ga0070661_101274475 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
3300005435|Ga0070714_100952054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 835 | Open in IMG/M |
3300005435|Ga0070714_101370299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 691 | Open in IMG/M |
3300005454|Ga0066687_10646135 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
3300005471|Ga0070698_101278821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 683 | Open in IMG/M |
3300005530|Ga0070679_100714986 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
3300005539|Ga0068853_102087310 | Not Available | 549 | Open in IMG/M |
3300005543|Ga0070672_102041769 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300005563|Ga0068855_100935658 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
3300005566|Ga0066693_10309660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 632 | Open in IMG/M |
3300005578|Ga0068854_100457139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1068 | Open in IMG/M |
3300005587|Ga0066654_10256297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 924 | Open in IMG/M |
3300005616|Ga0068852_101202883 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
3300005764|Ga0066903_104466779 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 746 | Open in IMG/M |
3300005892|Ga0075275_1039054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 731 | Open in IMG/M |
3300005901|Ga0075274_1028725 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 786 | Open in IMG/M |
3300006057|Ga0075026_100793728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 574 | Open in IMG/M |
3300006163|Ga0070715_10001255 | All Organisms → cellular organisms → Bacteria | 7272 | Open in IMG/M |
3300006175|Ga0070712_100362251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1189 | Open in IMG/M |
3300006606|Ga0074062_10001568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 691 | Open in IMG/M |
3300006755|Ga0079222_10861653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 752 | Open in IMG/M |
3300006794|Ga0066658_10318294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 831 | Open in IMG/M |
3300006794|Ga0066658_10908272 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300006800|Ga0066660_10838234 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
3300006852|Ga0075433_10076754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2942 | Open in IMG/M |
3300006954|Ga0079219_11935556 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300009090|Ga0099827_11565936 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
3300009093|Ga0105240_11412051 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
3300009098|Ga0105245_11311100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 773 | Open in IMG/M |
3300009137|Ga0066709_101857017 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
3300009137|Ga0066709_102630979 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
3300010039|Ga0126309_11085824 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300010159|Ga0099796_10538386 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300010229|Ga0136218_1019997 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
3300010303|Ga0134082_10153658 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
3300010303|Ga0134082_10420690 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
3300010321|Ga0134067_10257725 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
3300010337|Ga0134062_10441202 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300010359|Ga0126376_11548227 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
3300010362|Ga0126377_12468701 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300010398|Ga0126383_11612764 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 738 | Open in IMG/M |
3300010880|Ga0126350_12034810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 655 | Open in IMG/M |
3300011106|Ga0151489_1434401 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
3300012011|Ga0120152_1157776 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300012014|Ga0120159_1102849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 817 | Open in IMG/M |
3300012200|Ga0137382_10874438 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300012206|Ga0137380_11635483 | Not Available | 528 | Open in IMG/M |
3300012208|Ga0137376_11290182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 620 | Open in IMG/M |
3300012358|Ga0137368_10272147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1159 | Open in IMG/M |
3300012405|Ga0134041_1112813 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
3300012469|Ga0150984_117353005 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
3300012898|Ga0157293_10086843 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
3300012927|Ga0137416_10386266 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1183 | Open in IMG/M |
3300012931|Ga0153915_11616871 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
3300012948|Ga0126375_10740201 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
3300012955|Ga0164298_10636028 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
3300012984|Ga0164309_10887218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 725 | Open in IMG/M |
3300012986|Ga0164304_10928004 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
3300012988|Ga0164306_10128618 | All Organisms → cellular organisms → Bacteria | 1697 | Open in IMG/M |
3300013100|Ga0157373_10443207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 934 | Open in IMG/M |
3300013105|Ga0157369_10868722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 925 | Open in IMG/M |
3300013772|Ga0120158_10118720 | All Organisms → cellular organisms → Bacteria | 1538 | Open in IMG/M |
3300014497|Ga0182008_10188664 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
3300014497|Ga0182008_10890520 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300015357|Ga0134072_10141656 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
3300017924|Ga0187820_1269662 | Not Available | 552 | Open in IMG/M |
3300017937|Ga0187809_10168597 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
3300017944|Ga0187786_10527659 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300017947|Ga0187785_10046912 | All Organisms → cellular organisms → Bacteria | 1610 | Open in IMG/M |
3300017947|Ga0187785_10621015 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300017974|Ga0187777_10929561 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
3300017974|Ga0187777_11414424 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300018431|Ga0066655_10932406 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300018433|Ga0066667_11505902 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300018433|Ga0066667_12078114 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300018468|Ga0066662_10805097 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
3300018468|Ga0066662_12178301 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300018482|Ga0066669_11574243 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
3300018482|Ga0066669_12117735 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300020070|Ga0206356_11295680 | All Organisms → cellular organisms → Bacteria | 2049 | Open in IMG/M |
3300021441|Ga0213871_10292562 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300021445|Ga0182009_10672221 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300021478|Ga0210402_10199239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1840 | Open in IMG/M |
3300021560|Ga0126371_10223298 | All Organisms → cellular organisms → Bacteria | 1989 | Open in IMG/M |
3300021860|Ga0213851_1345397 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300024251|Ga0247679_1053668 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300025898|Ga0207692_10464221 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
3300025915|Ga0207693_11246914 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300025920|Ga0207649_11153384 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
3300025920|Ga0207649_11541835 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300025921|Ga0207652_11822831 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300025927|Ga0207687_10863926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 773 | Open in IMG/M |
3300025928|Ga0207700_10471171 | All Organisms → cellular organisms → Bacteria | 1109 | Open in IMG/M |
3300025928|Ga0207700_11057306 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
3300025929|Ga0207664_11860078 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300025929|Ga0207664_12011608 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300025931|Ga0207644_10349307 | All Organisms → cellular organisms → Bacteria | 1200 | Open in IMG/M |
3300025938|Ga0207704_11957655 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300025949|Ga0207667_10481908 | All Organisms → cellular organisms → Bacteria | 1259 | Open in IMG/M |
3300026078|Ga0207702_11479079 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
3300026078|Ga0207702_11669390 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
3300026315|Ga0209686_1133639 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
3300026550|Ga0209474_10505168 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
3300026816|Ga0207509_100020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3867 | Open in IMG/M |
3300027826|Ga0209060_10276489 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
3300027903|Ga0209488_10955202 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
3300028577|Ga0265318_10271380 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
3300028653|Ga0265323_10166807 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
3300028792|Ga0307504_10427267 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300028819|Ga0307296_10260807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 943 | Open in IMG/M |
3300031022|Ga0138301_1497578 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
3300031170|Ga0307498_10183020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 719 | Open in IMG/M |
3300031720|Ga0307469_11115664 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
3300031792|Ga0318529_10541281 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300031945|Ga0310913_11084597 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300032074|Ga0308173_11520040 | Not Available | 629 | Open in IMG/M |
3300032783|Ga0335079_11493090 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
3300032828|Ga0335080_12035651 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300033158|Ga0335077_11668794 | Not Available | 604 | Open in IMG/M |
3300033550|Ga0247829_11174976 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
3300034268|Ga0372943_1039299 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.35% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 6.62% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.88% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.88% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.15% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 5.15% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.41% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.41% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.68% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.68% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.94% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 2.94% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.21% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 2.21% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.21% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.21% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.47% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.47% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.47% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.47% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.47% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.47% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.47% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.47% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.47% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.47% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.47% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.74% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.74% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.74% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.74% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.74% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.74% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.74% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.74% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.74% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.74% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.74% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.74% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.74% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.74% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.74% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.74% |
Soil | Engineered → Lab Enrichment → Unclassified → Unclassified → Unclassified → Soil | 0.74% |
Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.74% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.74% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2124908041 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P3 | Environmental | Open in IMG/M |
2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
2209111022 | Grass soil microbial communities from Rothamsted Park, UK - Chitin enrichment | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005892 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_305 | Environmental | Open in IMG/M |
3300005901 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_201 | Environmental | Open in IMG/M |
3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010229 | Soil microbial communities from Bangor area, North Wales, UK, treated with sorgoleone, replicate 1 | Engineered | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011106 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300012011 | Permafrost microbial communities from Nunavut, Canada - A30_65cm_6M | Environmental | Open in IMG/M |
3300012014 | Permafrost microbial communities from Nunavut, Canada - A10_80cm_6M | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
3300012405 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1 | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Host-Associated | Open in IMG/M |
3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024251 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20 | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300026816 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-SCHO21-B (SPAdes) | Environmental | Open in IMG/M |
3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Host-Associated | Open in IMG/M |
3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Host-Associated | Open in IMG/M |
3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
3300031022 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
P3_CLC_00665860 | 2124908041 | Soil | FFEDTFIRALGIVTFAGIIIAAISAGLGSLLGTAS |
KansclcFeb2_10089810 | 2124908045 | Soil | VLAYLRWRFFKDTFVRALGIVTFAGVVIAAISAGLGSLLGSPVSG |
cont_0955.00005630 | 2166559005 | Simulated | FFQDTFVRALGIVTFAGVLIAAVSAGIGSLLGAPVAS |
2222062985 | 2209111022 | Grass Soil | MLAYFRYRFFQDTFVRALGIVTFAGVLIAAVSAGIGSLLGAPVAS |
JGI1027J12803_1088183471 | 3300000955 | Soil | FAIAVVAFELVMLAYFRYRFFQDTFIRALGLVTFAGVLIAAISAGLGSILGSPVAS* |
C688J35102_1182034962 | 3300002568 | Soil | AYLRWRFFADTFVRALGIVTFAGVIIAAVSAGLGSLLGSPVG* |
soilL2_101453543 | 3300003319 | Sugarcane Root And Bulk Soil | LAYLRWRFFEDTFVRALGIVTFAGIIIAAVSAGLGSALGNAT* |
soilH1_101636494 | 3300003321 | Sugarcane Root And Bulk Soil | VLAYLRWRFFADTFVRALGIVTFAGIVIAAVAAGLGSLLGTPTG* |
Ga0062595_1013851741 | 3300004479 | Soil | ELLMLAYFRYRFFQDTFIRALGIVTFAGILIAAISAGLGSVLGAPVGS* |
Ga0062595_1023258051 | 3300004479 | Soil | AYFRYRFFQDTFIRALGIVTFAGIIIAAISAGLGSLLGSPSG* |
Ga0062594_1027516491 | 3300005093 | Soil | LAYLRWRFFQDTFVRALGIVTFAGVIIAAVSAGLGSLLGSPV* |
Ga0066688_110082431 | 3300005178 | Soil | AFELLILAYFRYRFFQDTFLRALGIVTFAGIIIAAISAGLGSLLGSPTGS* |
Ga0066388_1024998321 | 3300005332 | Tropical Forest Soil | FELLTLAYLRWKFFQDTFVRALGIVTFAGIIIAGISAGLGSLLGNPVTG* |
Ga0066388_1037645252 | 3300005332 | Tropical Forest Soil | VTLAYLRWRFFEDTFVRALGIVTFAGVIIAAVSAGLGSLLGSPV* |
Ga0070661_1007937083 | 3300005344 | Corn Rhizosphere | AFELLMLAYFRYRFFQDTFVRALGIVTFAGVLIVAISAGLGSLLGAPVGS* |
Ga0070661_1012744753 | 3300005344 | Corn Rhizosphere | LAYFRYRFFQDTFIRALGIVTFAGVIIAAISAGLGSLLGTPVGG* |
Ga0070714_1009520543 | 3300005435 | Agricultural Soil | ELLTLAYLRYRFFQDTFVRALGLVTFAGILIAAISAGLGSLLGSPIS* |
Ga0070714_1013702991 | 3300005435 | Agricultural Soil | VVAFELLMLAYFRYRFFQDTFIRALGIVTFAGILIAAISAGLGSVLGAPVGG* |
Ga0066687_106461351 | 3300005454 | Soil | YFRWRFFQDTFVRALAIVTFAGILIAAVRAGLGSVLGTPVGH* |
Ga0070698_1012788212 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | AAGVVAFELLVLAYFRYRFFQDTFVRALGIVTFAGVLIAAISAGLGSLLGTPAGG* |
Ga0070679_1007149861 | 3300005530 | Corn Rhizosphere | TLAWLRWKFFEDTFVRALGIVTFAGIVIAAVSAGLGSVLGTPGG* |
Ga0068853_1020873102 | 3300005539 | Corn Rhizosphere | VALSFAIAVVGLELLTLAYLRWKFFSDTFVRALGIVTFAGVVIAAVAAGLGSILGTPGGG |
Ga0070672_1020417692 | 3300005543 | Miscanthus Rhizosphere | FFQDTFIRALGLVTFAGVLIAAISAGLGSLLGSPISG* |
Ga0068855_1009356581 | 3300005563 | Corn Rhizosphere | YFRYRFFQDTFIRALGIVTFAGVIIAAISAGLGSLLGTPVGG* |
Ga0066693_103096602 | 3300005566 | Soil | FFADTFIRALGIVTFAGLIIAAVSAGLGSLLGSPTGG* |
Ga0068854_1004571391 | 3300005578 | Corn Rhizosphere | MLAYFRYRFFQDTFIRALGIVTFAGVIIAAISAGLGSLLGTPVGG* |
Ga0066654_102562971 | 3300005587 | Soil | AYFRWRFFKDTFVRALAIVTFAGILIAAISAGLGSLLGTPVGS* |
Ga0068852_1012028831 | 3300005616 | Corn Rhizosphere | FLISNYSVALSFAIAVVGLELLTLAFLRWKFFSDTFIRALGIVTFAGVVIAAVAAGLGSILGTPGGG* |
Ga0066903_1044667793 | 3300005764 | Tropical Forest Soil | RYRFFQDTFVRALGIVTFAGVLIAAVSAGLGSLLGKPIGG* |
Ga0075275_10390543 | 3300005892 | Rice Paddy Soil | RWKFFEDTFVRALGIVTFAGLAIAGISALLGTLLGSPTG* |
Ga0075274_10287253 | 3300005901 | Rice Paddy Soil | YHVALFFAVAIVAFELLMLAYFRYRFFQDTFIRALGIVTFAGILIAAISAGLGSILGAPVGS* |
Ga0075026_1007937282 | 3300006057 | Watersheds | LTLAYLRWKFFADTFVRALGIVTFAGMIIAGISVALGSALGTPGGG* |
Ga0070715_1000125512 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | FQDTFIRALGIVTFAGIVIAGISAGLGSTLGSPVG* |
Ga0070712_1003622513 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | AYFRYRFFQDTFVRALGIVTFAGVLIAAISAGLGSLLGAPVGG* |
Ga0074062_100015683 | 3300006606 | Soil | PGAPLPHGLDQAELLMLAYLRYRFFHDTFIRALGIVTFAGVLIAAISAGLGSLLGNPISG |
Ga0079222_108616531 | 3300006755 | Agricultural Soil | LLMLAYFRYRFFQDTFIRALGIVTFAGILIAAISAGLGSVLGAPVGS* |
Ga0066658_103182941 | 3300006794 | Soil | FFQDTFVRALAIVTFAGILIAAVSAGLGSVLGTPVGH* |
Ga0066658_109082722 | 3300006794 | Soil | FFHDTFIRALGIVTFAGVVIVAIAAGLGSLLGAPVGG* |
Ga0066660_108382341 | 3300006800 | Soil | AYFRWRFFQDTFVRALGIVTFAGVVIVTISAGLGSLLGSPVGG* |
Ga0075433_100767541 | 3300006852 | Populus Rhizosphere | AFELLALAYLRYRFFQDTFIRALGLVTFAGVLIAAISAGLGSLLGSPISG* |
Ga0079219_119355562 | 3300006954 | Agricultural Soil | LLLAYFRWRFFEDTFIRALGIVTFAGVVIAGISAGLGSALGSPVS* |
Ga0099827_115659362 | 3300009090 | Vadose Zone Soil | WFELLLLAYFRYRFFQDTFVRALGIVTFAGMIIAAISAGLGSLLGAPPGG* |
Ga0105240_114120512 | 3300009093 | Corn Rhizosphere | YFRWRFFSDTFVRALGIVTFAGMLIAAISAGLGSLLGAPVGG* |
Ga0105245_113111001 | 3300009098 | Miscanthus Rhizosphere | DYRVALFFAIAVVAFELVMLAYFRYRFFQDTFIRALGLVTFAGVLIAAISAGLGSILGSPVAG* |
Ga0066709_1018570173 | 3300009137 | Grasslands Soil | LMLAYFRYRFFQDTFVRALGIVTFAGILIAAISAGLGSVLGAPVGG* |
Ga0066709_1026309791 | 3300009137 | Grasslands Soil | RFFQDTFVRALGIVTFAGVLIAAISAGLGSLLGAPVGS* |
Ga0126309_110858242 | 3300010039 | Serpentine Soil | GLELLLLAYFRWRFFEDTFIRALGIVTFAGVVIAAISAVLGSALGTPVG* |
Ga0099796_105383862 | 3300010159 | Vadose Zone Soil | FRYRFFQDTFVRALGIVTFAGVLIAVISAGLGSLLGAPVGS* |
Ga0136218_10199973 | 3300010229 | Soil | WRFFNDTFVRALGIVTFAGIVIAALSAGLGSLLGNPGAG* |
Ga0134082_101536581 | 3300010303 | Grasslands Soil | ILAYFRYRFFQDTFLRPLGIVTFAGIIIAAISAGLGSLLGSPTGS* |
Ga0134082_104206902 | 3300010303 | Grasslands Soil | VVVAFELLMLAYFRYRFFQDTFVRALGIVTFAGVLIAAISAGLGSLLGAPVGS* |
Ga0134067_102577251 | 3300010321 | Grasslands Soil | MLAYFRYRFFQDTFIRALGIVTFACILIAAISAGLGSILGAPVGS* |
Ga0134062_104412021 | 3300010337 | Grasslands Soil | LELLILAYFRYRFFQDTFIRALGIVTFAGAIIAAISAGLGSLLGTPTG* |
Ga0126376_115482273 | 3300010359 | Tropical Forest Soil | AYLRWKFFQDTFIRALAIVTFAGVIIAGISAGLGSLLGNPVTG* |
Ga0126377_124687012 | 3300010362 | Tropical Forest Soil | FAVAVVALELLTLAYFRYRFFQDTFIRALGLVTFAGVLIAAISAGLGSLLGAPVSG* |
Ga0126383_116127643 | 3300010398 | Tropical Forest Soil | FQDTFIRALGIVTFAGIIIAGISAGLGSLLGNPVTG* |
Ga0126350_120348101 | 3300010880 | Boreal Forest Soil | LAYFRYRFFQDTFVRALGIVTFAGIIIAAISAGLGSLLGAPPSG* |
Ga0151489_14344011 | 3300011106 | Soil | FFQDTFVRALGIVTFAGVLIAAISAGLGSLLGTPISGG* |
Ga0120152_11577761 | 3300012011 | Permafrost | FRYRFFQDTFVRALGIVTFAGVIIAAISAGLGSLLGNAGAG* |
Ga0120159_11028491 | 3300012014 | Permafrost | FFQDTFVRALGIVTFAGIIIAAISAGLGSLLGNPGAG* |
Ga0137382_108744383 | 3300012200 | Vadose Zone Soil | VAFELLMLAYFRYRFFQDTFIRALGLVTFAGVLIAAVSAGLGSLLANPVGS* |
Ga0137380_116354831 | 3300012206 | Vadose Zone Soil | VVGFELLMLAYFRYRFFQDTFIRALGIVTFAGILIAAISAGLGSVLGAPVGS* |
Ga0137376_112901821 | 3300012208 | Vadose Zone Soil | QDTFIRALGIVTFAGVIIAAISAGLGSLLGTPGSG* |
Ga0137368_102721471 | 3300012358 | Vadose Zone Soil | QFFQATVVRALGIVTFAGVIIAALIAGLGSLLGTPVAG* |
Ga0134041_11128131 | 3300012405 | Grasslands Soil | RFFQDTFIRALGIVTFAGIIIAAISAGLGSLLGTPGAS* |
Ga0150984_1173530053 | 3300012469 | Avena Fatua Rhizosphere | LAYLRYRFFQDTFVRALGIVTFAGVLIAAVSAGLGSVLGNPIG* |
Ga0157293_100868433 | 3300012898 | Soil | AFELVMLAYFRYRFFQDTFVRALGIVTFAGVLIAAVSAGLGSLLGKPIGG* |
Ga0137416_103862663 | 3300012927 | Vadose Zone Soil | FELLLLAYFRYRFFQDTFVRALGIVTFAGIIIAAISAGLGSLLGSPTAG* |
Ga0153915_116168711 | 3300012931 | Freshwater Wetlands | LLLLAYFRWRFFEDTFLRALAIVTFAGIAIAAMSTGLGDLLGAPVGG* |
Ga0126375_107402011 | 3300012948 | Tropical Forest Soil | DDTFIRALAIVTFAGVVIAGISAGLGSALGSPVS* |
Ga0164298_106360281 | 3300012955 | Soil | LRYRFFQDTFIRALGLVTFAGVLIAAISAGLGSLLGSPISG* |
Ga0164309_108872182 | 3300012984 | Soil | ELLILAYFRWKFFEDTFIRALGIVTCAGIIIAASSAGLGSLLGGAPTN* |
Ga0164304_109280041 | 3300012986 | Soil | RYRFFQDTFIRALGLVTFAGVIIAAISAGLGSLLGSPSG* |
Ga0164306_101286184 | 3300012988 | Soil | AFELLLLAYFRYRFFQDTFIRALGIVTFAGIIIAVISAGLGSLLGSPTGG* |
Ga0157373_104432074 | 3300013100 | Corn Rhizosphere | WRFFDDTFVRALGIVTFAGAIIAAVSAGLGSLLGNPGVGG* |
Ga0157369_108687223 | 3300013105 | Corn Rhizosphere | GLELLLLAYFRYRFFQDTFIRALGIVTFAGVIIAAISAGLGSLLGTPVGG* |
Ga0120158_101187201 | 3300013772 | Permafrost | RLLLAYFRYRFFQDTFVRALGIVTFAGIIIAAISAGLGSLLGNPGAG* |
Ga0182008_101886644 | 3300014497 | Rhizosphere | FELLVLAYFRYRFFQDTFIRALGIVTFAGIIIAAISAGLGSLLGSPTGG* |
Ga0182008_108905202 | 3300014497 | Rhizosphere | AYLRWRFFQDTFIRALGIVTFAGVIIAAGSAGLGSVLGNPISG* |
Ga0134072_101416563 | 3300015357 | Grasslands Soil | ELLMLAYFRYRFFQDTFIRALGIVTFAGILIAAISAGLGSILGAPVGS* |
Ga0187820_12696622 | 3300017924 | Freshwater Sediment | FQDTFVRALAIVTFAGILIAAIAAGLGSLLGAPVGS |
Ga0187809_101685971 | 3300017937 | Freshwater Sediment | YFRWRFFEDTFFRALGIVTFAGIIIAAVSAGLGSILGTPVGH |
Ga0187786_105276592 | 3300017944 | Tropical Peatland | AVAVVALELLALAYFRYRFFQDTFIRALGLVTFAGILIVAISAGLGSILGSPVAS |
Ga0187785_100469121 | 3300017947 | Tropical Peatland | FFQDTFIRALAIVTFAGVLIVAISAGLGSLLGKPIGG |
Ga0187785_106210152 | 3300017947 | Tropical Peatland | FLISDYRAALFFAVAVVALELLALAYFRYRFFQDTFIRALGLVTFAGILIVAISAGLGSILGSPVAS |
Ga0187777_109295613 | 3300017974 | Tropical Peatland | LLMLAYFRWRFFEDTFVRALGIVTFAGVLIVGISAGLGSLLGTPGGG |
Ga0187777_114144242 | 3300017974 | Tropical Peatland | ALSFAVAVVGVELLTLAYLRWKFFSDTFVRALGIVTFAGMIIAGISAGLGSLLGTPGG |
Ga0066655_109324061 | 3300018431 | Grasslands Soil | KSFADRFVRDIGIVLFAGLIIAGISVALGSALGTPGG |
Ga0066667_115059023 | 3300018433 | Grasslands Soil | YRFFQDTFIRALGIVTFAGILIAAISAGLGSILGAPVGS |
Ga0066667_120781141 | 3300018433 | Grasslands Soil | RFFQDTFVRALGIVTFAGVLIAAVSAGLGSLLGAPVGS |
Ga0066662_108050973 | 3300018468 | Grasslands Soil | FFEGTFVRALGIVTFAGIIIAAISAGLGSLLGGTS |
Ga0066662_121783012 | 3300018468 | Grasslands Soil | AYFRYRFFQDTFIRALGIVTFAGVLIAAISAGLGSLLGNPISG |
Ga0066669_115742433 | 3300018482 | Grasslands Soil | YFRWRFFEDTFIRALGIVTFAGIVIAGISAGLGSVLGNPVS |
Ga0066669_121177352 | 3300018482 | Grasslands Soil | FAVAVVAFELLMLAYFRYRFFQDTFIRALGLVTFAGVLIAAVSAGLGSLLANPVGS |
Ga0206356_112956801 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | RYRFFQDTFIRALGIVTFAGIIIAVISAGLGSLLGSPTGG |
Ga0213871_102925621 | 3300021441 | Rhizosphere | VVAAELLTLAYFRYRFFQDTFVRALGIVTFAGILIAAVSAGLGSVLGAPVGG |
Ga0182009_106722213 | 3300021445 | Soil | VLAYLRGRFFADTFVRALGIVTFAGVVIAAVAAGLGSLLGTPTAG |
Ga0210402_101992391 | 3300021478 | Soil | FQDTFVRALGLVTFAGVLIAAISAGLGSLLGSPISS |
Ga0126371_102232981 | 3300021560 | Tropical Forest Soil | GFELLMLAYFRYRFFQDTFIRALGIVTFAGVIIAGISAGLGSLLGNPVTG |
Ga0213851_13453973 | 3300021860 | Watersheds | ADTFVRALGIVTFAGMIIAGISVALGSALGTPGGG |
Ga0247679_10536683 | 3300024251 | Soil | AVVAFELLMLAYFRYRFFQDTFVRALGIVTFAGVLIVAISAGLGSLLGAPVGS |
Ga0207692_104642211 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | YLRYRFFQDTFIRALGIVTFAGIIIAVISAGLGSLLGSPTGG |
Ga0207693_112469141 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | QDTFVRALGIVTFAGILIAAISAGLGSLLGAPVGS |
Ga0207649_111533842 | 3300025920 | Corn Rhizosphere | RYRFFADTFIRALAIVTFAGVVIAAVAAGLGSLLGTPASG |
Ga0207649_115418351 | 3300025920 | Corn Rhizosphere | RFFSDTFVRALGIVTFAGILIAAISAGLGSLLGAPVGS |
Ga0207652_118228312 | 3300025921 | Corn Rhizosphere | YFRWKFFEDTFVRALGIVTFAGIIIAAISAGLGSLLGGTPTN |
Ga0207687_108639261 | 3300025927 | Miscanthus Rhizosphere | DYRVALFFAIAVVAFELVMLAYFRYRFFQDTFIRALGLVTFAGVLIAAISAGLGSILGSPVAG |
Ga0207700_104711713 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | FQDTFIRALGIVTFAGILIAAISAGLGSVLGAPVGS |
Ga0207700_110573063 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | LAYFRWRFFQDTFIRALGIVTFAGIVIAGISAGLGSTLGSPVG |
Ga0207664_118600781 | 3300025929 | Agricultural Soil | WRFFQDTFIRALGIVTFAGIVIAGISAGLGSTLGSPVG |
Ga0207664_120116081 | 3300025929 | Agricultural Soil | AYFRYRFFQDTFIRALGIVTFAGILIAAISAGLGSVLGAPVGG |
Ga0207644_103493071 | 3300025931 | Switchgrass Rhizosphere | LRWRFFQDTFIRALGIVTFAGMIIVGISVALGSLLGTPAGS |
Ga0207704_119576551 | 3300025938 | Miscanthus Rhizosphere | QDTFIRALGLVTFAGVLIAAISAGLGSLLGSPISG |
Ga0207667_104819084 | 3300025949 | Corn Rhizosphere | FFQDTFVRALGIVTFAGIVIAAVAAGLGSLLGTPGG |
Ga0207702_114790793 | 3300026078 | Corn Rhizosphere | LSFAVAVVAFELLMLAYFRYRFFQDTFIRALGIVTFAGILIAAISAGLGSVLGAPVGG |
Ga0207702_116693903 | 3300026078 | Corn Rhizosphere | FRYRFFQDTFIRALGIVTFAGIIIAAISAGLGSLLGSPTGG |
Ga0209686_11336391 | 3300026315 | Soil | QDTFIRALGIVTFAGILIAAISAGLGSILGAPVGS |
Ga0209474_105051682 | 3300026550 | Soil | LRWKFFEDSFVRALGIVTFAGIIIAAVSAGLGNQLGG |
Ga0207509_1000201 | 3300026816 | Soil | AIAVVAFELVMLAYFRYRFFQDTFIRALGLVTFAGVLIAAISAGLGSILGSPVAG |
Ga0209060_102764893 | 3300027826 | Surface Soil | NYRVALFTAVGVVAFELLMLAYFRYRFFQDTFVRALGIVTFAGVLIAAISAGLGSLLGAPIGG |
Ga0209488_109552021 | 3300027903 | Vadose Zone Soil | YLRYRFFADTFVRALGIVTFAGVIIAAVAAGLGSILGTPGGG |
Ga0265318_102713802 | 3300028577 | Rhizosphere | IVGVELLTLAYLRWKFFSDTFVRALGIVTFAGMIIAGISAGLGSLLGTPGG |
Ga0265323_101668072 | 3300028653 | Rhizosphere | QVALSFAIAVVGVELLTLAYLRWKFFSDTFVRALGIVTFAGMIIAGISAGLGSLLGTPGG |
Ga0307504_104272672 | 3300028792 | Soil | AYFRLRFFKDTFVRALGIVTFAGVIIAAISAGLGSLLGAPAG |
Ga0307296_102608071 | 3300028819 | Soil | RYRFFQDTFIRALGIVTFAGIIIAAISAGLGSLLGSPAGG |
Ga0138301_14975783 | 3300031022 | Soil | AFELVMLAYFRYRFFQDTFVRALGIVTFAGVLIAAVSAGLGSLLGSPISS |
Ga0307498_101830203 | 3300031170 | Soil | FFQDTFIRALGIVTFAGVLIVAISAGLGSLLGAPVAS |
Ga0307469_111156641 | 3300031720 | Hardwood Forest Soil | RWRFFQDTFIRALGIVTFAGIVIAGISAGLGSTLGSPVG |
Ga0318529_105412812 | 3300031792 | Soil | VGFELLMLAYFRYRFFQDTFIRALAIVTFAGVLIVAISAGLGSLLGKPIGG |
Ga0310913_110845972 | 3300031945 | Soil | KFFADTFVRALGIVTFAGMIIAGISAALGSALGTPGG |
Ga0308173_115200403 | 3300032074 | Soil | RWRFFEDTFVRALGIVTFAGIVIAAVSAGLGSILGTPGGGG |
Ga0335079_114930903 | 3300032783 | Soil | FAVAVVGVELLTLAYLRWKFFADTFVRALGIVTFAGMIIAGISAGLGSVLGTPGG |
Ga0335080_120356512 | 3300032828 | Soil | LRWRFFKDTFIRALAIVTFAGMLIAAISAGLGSLLGTPVSG |
Ga0335077_116687941 | 3300033158 | Soil | HYEVALLFAVAVVAFELLMLAYFRYRFFQDTFVRALSIVTFAGVLIAAISAGLGSLLGSPISG |
Ga0247829_111749761 | 3300033550 | Soil | AYLRYRFFQDTFIRALGLVTFAGVLIAAISAGLGSLLGSPISGG |
Ga0372943_1039299_1_201 | 3300034268 | Soil | FLIPNYKVALSFAVAVVGVELLTLAYLRWKFFSDTFVRALGIVTFAGMIIAGISAGLGAWLGTPGG |
⦗Top⦘ |