| Basic Information | |
|---|---|
| Family ID | F057557 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 136 |
| Average Sequence Length | 47 residues |
| Representative Sequence | PNLALMCRFLNSIARSLRAQPEARDACLAIEDAIGKAGMPSTWQSGI |
| Number of Associated Samples | 124 |
| Number of Associated Scaffolds | 136 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.79 % |
| % of genes from short scaffolds (< 2000 bps) | 84.56 % |
| Associated GOLD sequencing projects | 119 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.118 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (23.529 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.794 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.853 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 68.09% β-sheet: 0.00% Coil/Unstructured: 31.91% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 136 Family Scaffolds |
|---|---|---|
| PF00999 | Na_H_Exchanger | 55.15 |
| PF00072 | Response_reg | 9.56 |
| PF12900 | Pyridox_ox_2 | 8.09 |
| PF02254 | TrkA_N | 8.09 |
| PF02518 | HATPase_c | 5.15 |
| PF00311 | PEPcase | 2.94 |
| PF07690 | MFS_1 | 1.47 |
| PF04972 | BON | 0.74 |
| PF08447 | PAS_3 | 0.74 |
| PF00583 | Acetyltransf_1 | 0.74 |
| PF04963 | Sigma54_CBD | 0.74 |
| PF04831 | Popeye | 0.74 |
| COG ID | Name | Functional Category | % Frequency in 136 Family Scaffolds |
|---|---|---|---|
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 55.15 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 55.15 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 55.15 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 55.15 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 55.15 |
| COG2352 | Phosphoenolpyruvate carboxylase | Energy production and conversion [C] | 2.94 |
| COG1508 | DNA-directed RNA polymerase specialized sigma subunit, sigma54 homolog | Transcription [K] | 0.74 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.12 % |
| Unclassified | root | N/A | 5.88 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001154|JGI12636J13339_1048082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 531 | Open in IMG/M |
| 3300001593|JGI12635J15846_10204070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1304 | Open in IMG/M |
| 3300001661|JGI12053J15887_10292956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 798 | Open in IMG/M |
| 3300004092|Ga0062389_101389996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 887 | Open in IMG/M |
| 3300004633|Ga0066395_10584337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 653 | Open in IMG/M |
| 3300005167|Ga0066672_10162713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1405 | Open in IMG/M |
| 3300005336|Ga0070680_100269250 | All Organisms → cellular organisms → Bacteria | 1442 | Open in IMG/M |
| 3300005336|Ga0070680_100352383 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1252 | Open in IMG/M |
| 3300005434|Ga0070709_11641762 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300005529|Ga0070741_10841564 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 798 | Open in IMG/M |
| 3300005531|Ga0070738_10405940 | Not Available | 536 | Open in IMG/M |
| 3300005533|Ga0070734_10061218 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2254 | Open in IMG/M |
| 3300005534|Ga0070735_10530968 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 700 | Open in IMG/M |
| 3300005536|Ga0070697_101418255 | Not Available | 620 | Open in IMG/M |
| 3300005538|Ga0070731_11145172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 514 | Open in IMG/M |
| 3300005563|Ga0068855_101682982 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 647 | Open in IMG/M |
| 3300005616|Ga0068852_100591851 | All Organisms → cellular organisms → Bacteria | 1113 | Open in IMG/M |
| 3300005764|Ga0066903_103038986 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 909 | Open in IMG/M |
| 3300006175|Ga0070712_101461164 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 597 | Open in IMG/M |
| 3300006577|Ga0074050_10615367 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300006797|Ga0066659_10136508 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1725 | Open in IMG/M |
| 3300006800|Ga0066660_11062471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 645 | Open in IMG/M |
| 3300006854|Ga0075425_101138415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 888 | Open in IMG/M |
| 3300007258|Ga0099793_10699417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 511 | Open in IMG/M |
| 3300009156|Ga0111538_10218053 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2418 | Open in IMG/M |
| 3300009792|Ga0126374_10240709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1174 | Open in IMG/M |
| 3300009826|Ga0123355_10978324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 903 | Open in IMG/M |
| 3300010047|Ga0126382_10227705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1348 | Open in IMG/M |
| 3300010048|Ga0126373_11146647 | Not Available | 843 | Open in IMG/M |
| 3300010320|Ga0134109_10124362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 913 | Open in IMG/M |
| 3300010321|Ga0134067_10254614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 663 | Open in IMG/M |
| 3300010361|Ga0126378_10766267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1075 | Open in IMG/M |
| 3300010361|Ga0126378_11706949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 716 | Open in IMG/M |
| 3300010361|Ga0126378_13455837 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 501 | Open in IMG/M |
| 3300010362|Ga0126377_10886607 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
| 3300010375|Ga0105239_11843243 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 701 | Open in IMG/M |
| 3300010376|Ga0126381_101152593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1120 | Open in IMG/M |
| 3300010403|Ga0134123_10026179 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4194 | Open in IMG/M |
| 3300011271|Ga0137393_11708128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 518 | Open in IMG/M |
| 3300012925|Ga0137419_10923017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 720 | Open in IMG/M |
| 3300012925|Ga0137419_11505065 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 570 | Open in IMG/M |
| 3300012930|Ga0137407_11443688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 654 | Open in IMG/M |
| 3300012971|Ga0126369_10334192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1530 | Open in IMG/M |
| 3300014157|Ga0134078_10033399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1703 | Open in IMG/M |
| 3300016404|Ga0182037_12017416 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 518 | Open in IMG/M |
| 3300016445|Ga0182038_11839136 | Not Available | 547 | Open in IMG/M |
| 3300017937|Ga0187809_10052035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1323 | Open in IMG/M |
| 3300017961|Ga0187778_10179657 | All Organisms → cellular organisms → Bacteria | 1343 | Open in IMG/M |
| 3300017961|Ga0187778_10852929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 624 | Open in IMG/M |
| 3300017970|Ga0187783_10002583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 13418 | Open in IMG/M |
| 3300017970|Ga0187783_10741947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 709 | Open in IMG/M |
| 3300017972|Ga0187781_10432003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 942 | Open in IMG/M |
| 3300017972|Ga0187781_10863866 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 658 | Open in IMG/M |
| 3300017974|Ga0187777_10176504 | All Organisms → cellular organisms → Bacteria | 1433 | Open in IMG/M |
| 3300017999|Ga0187767_10020674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1420 | Open in IMG/M |
| 3300018001|Ga0187815_10094688 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1258 | Open in IMG/M |
| 3300018058|Ga0187766_10044859 | All Organisms → cellular organisms → Bacteria | 2588 | Open in IMG/M |
| 3300018060|Ga0187765_10184569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1197 | Open in IMG/M |
| 3300018090|Ga0187770_11796335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300018422|Ga0190265_12574746 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 607 | Open in IMG/M |
| 3300018468|Ga0066662_10194509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1595 | Open in IMG/M |
| 3300020082|Ga0206353_10816561 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1374 | Open in IMG/M |
| 3300020170|Ga0179594_10085306 | All Organisms → cellular organisms → Bacteria | 1119 | Open in IMG/M |
| 3300021088|Ga0210404_10218070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1028 | Open in IMG/M |
| 3300021402|Ga0210385_11130915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 601 | Open in IMG/M |
| 3300021432|Ga0210384_10909243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 780 | Open in IMG/M |
| 3300021441|Ga0213871_10154607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 699 | Open in IMG/M |
| 3300021477|Ga0210398_10949742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 687 | Open in IMG/M |
| 3300021559|Ga0210409_11138497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 655 | Open in IMG/M |
| 3300024279|Ga0247692_1024880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 916 | Open in IMG/M |
| 3300024330|Ga0137417_1460612 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2804 | Open in IMG/M |
| 3300025906|Ga0207699_10094859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1880 | Open in IMG/M |
| 3300025912|Ga0207707_10114262 | All Organisms → cellular organisms → Bacteria | 2360 | Open in IMG/M |
| 3300026089|Ga0207648_11970598 | Not Available | 545 | Open in IMG/M |
| 3300026298|Ga0209236_1161368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 928 | Open in IMG/M |
| 3300026317|Ga0209154_1225877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 694 | Open in IMG/M |
| 3300026530|Ga0209807_1017821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3476 | Open in IMG/M |
| 3300027765|Ga0209073_10280435 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 655 | Open in IMG/M |
| 3300027826|Ga0209060_10487634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 559 | Open in IMG/M |
| 3300027853|Ga0209274_10180019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1072 | Open in IMG/M |
| 3300027869|Ga0209579_10583820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 606 | Open in IMG/M |
| 3300027889|Ga0209380_10228851 | All Organisms → cellular organisms → Bacteria | 1092 | Open in IMG/M |
| 3300027889|Ga0209380_10229649 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1090 | Open in IMG/M |
| 3300027915|Ga0209069_10759348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 575 | Open in IMG/M |
| 3300030490|Ga0302184_10215988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 798 | Open in IMG/M |
| 3300030520|Ga0311372_12536761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 574 | Open in IMG/M |
| 3300030862|Ga0265753_1074431 | Not Available | 647 | Open in IMG/M |
| 3300031231|Ga0170824_115616514 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 687 | Open in IMG/M |
| 3300031474|Ga0170818_108107856 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 647 | Open in IMG/M |
| 3300031544|Ga0318534_10877846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 502 | Open in IMG/M |
| 3300031572|Ga0318515_10008222 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4521 | Open in IMG/M |
| 3300031640|Ga0318555_10264591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 929 | Open in IMG/M |
| 3300031679|Ga0318561_10013996 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3576 | Open in IMG/M |
| 3300031682|Ga0318560_10643871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 574 | Open in IMG/M |
| 3300031713|Ga0318496_10727865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 547 | Open in IMG/M |
| 3300031719|Ga0306917_10548660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 908 | Open in IMG/M |
| 3300031720|Ga0307469_10150724 | All Organisms → cellular organisms → Bacteria | 1740 | Open in IMG/M |
| 3300031720|Ga0307469_11076463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 754 | Open in IMG/M |
| 3300031723|Ga0318493_10778600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 538 | Open in IMG/M |
| 3300031736|Ga0318501_10740507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 543 | Open in IMG/M |
| 3300031740|Ga0307468_100383258 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
| 3300031747|Ga0318502_10913067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 534 | Open in IMG/M |
| 3300031747|Ga0318502_10957506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 521 | Open in IMG/M |
| 3300031751|Ga0318494_10048899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2230 | Open in IMG/M |
| 3300031753|Ga0307477_10033498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3521 | Open in IMG/M |
| 3300031754|Ga0307475_10575736 | Not Available | 902 | Open in IMG/M |
| 3300031763|Ga0318537_10268322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 632 | Open in IMG/M |
| 3300031778|Ga0318498_10378038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 631 | Open in IMG/M |
| 3300031794|Ga0318503_10324309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 500 | Open in IMG/M |
| 3300031799|Ga0318565_10029822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2461 | Open in IMG/M |
| 3300031805|Ga0318497_10127890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1379 | Open in IMG/M |
| 3300031823|Ga0307478_10125769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2014 | Open in IMG/M |
| 3300031832|Ga0318499_10403154 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 523 | Open in IMG/M |
| 3300031837|Ga0302315_10707164 | Not Available | 528 | Open in IMG/M |
| 3300031879|Ga0306919_10082789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2217 | Open in IMG/M |
| 3300031912|Ga0306921_11559911 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 719 | Open in IMG/M |
| 3300031942|Ga0310916_10006439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 7568 | Open in IMG/M |
| 3300032035|Ga0310911_10831101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 533 | Open in IMG/M |
| 3300032043|Ga0318556_10023524 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2786 | Open in IMG/M |
| 3300032054|Ga0318570_10015005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2820 | Open in IMG/M |
| 3300032054|Ga0318570_10411552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 617 | Open in IMG/M |
| 3300032064|Ga0318510_10555469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 501 | Open in IMG/M |
| 3300032066|Ga0318514_10579396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 597 | Open in IMG/M |
| 3300032091|Ga0318577_10358157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 697 | Open in IMG/M |
| 3300032160|Ga0311301_11758225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 742 | Open in IMG/M |
| 3300032174|Ga0307470_10065649 | All Organisms → cellular organisms → Bacteria | 1934 | Open in IMG/M |
| 3300032174|Ga0307470_11757587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 524 | Open in IMG/M |
| 3300032783|Ga0335079_10125768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2892 | Open in IMG/M |
| 3300032805|Ga0335078_11505099 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 752 | Open in IMG/M |
| 3300032828|Ga0335080_12333277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 511 | Open in IMG/M |
| 3300032892|Ga0335081_10057694 | All Organisms → cellular organisms → Bacteria | 6038 | Open in IMG/M |
| 3300032896|Ga0335075_10614322 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1071 | Open in IMG/M |
| 3300032898|Ga0335072_10111765 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3460 | Open in IMG/M |
| 3300032954|Ga0335083_10508572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1007 | Open in IMG/M |
| 3300033290|Ga0318519_10368929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 851 | Open in IMG/M |
| 3300033807|Ga0314866_076934 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.53% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 8.09% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.62% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.88% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.15% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 5.15% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.15% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.68% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.21% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.21% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.21% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.21% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.21% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.47% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.47% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.47% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.47% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.47% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.47% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.74% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.74% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.74% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.74% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.74% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.74% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.74% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.74% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.74% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.74% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.74% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001154 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005531 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006577 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Host-Associated | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Host-Associated | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300024279 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK33 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300030490 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031837 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033807 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12636J13339_10480822 | 3300001154 | Forest Soil | SIARSLRAQPEAREACLVIEDAIGKAGMPSTWQSGI* |
| JGI12635J15846_102040701 | 3300001593 | Forest Soil | LNSIARSLRAQPEARDACLAIEDAIGKAGMPSTWQSGI* |
| JGI12053J15887_102929561 | 3300001661 | Forest Soil | QLHVNHPNVALMCRFLNSIARSLRAQPEARQACLAIEDAIGKAGMPSTWQSGI* |
| Ga0062389_1013899961 | 3300004092 | Bog Forest Soil | HPNFALMCRFLNSIARSLRAQPEARDACLAIEDAIGKAGMPSTWQSGI* |
| Ga0066395_105843372 | 3300004633 | Tropical Forest Soil | NHPNLALMCRFLNSIARSLRAQPEARDACLLIEDAIGKAGMPSTWQSGI* |
| Ga0066672_101627132 | 3300005167 | Soil | FLNSIARSLRAQPEARDACLAIEDAIGKAGMPSTWQSGI* |
| Ga0070680_1002692503 | 3300005336 | Corn Rhizosphere | DQIEEQLHTNHPNLALMCRFLNSVARSLRAQPEARDACLAIEDAIGKAGMPSTWQSGI* |
| Ga0070680_1003523832 | 3300005336 | Corn Rhizosphere | FLNSIARSLRAQPEAREVCLVIEDAIGTAGIASTWQSGI* |
| Ga0070709_116417621 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | ELHSAHPNVSLLGTFLNSIARSLRAQPEARDVCLVIEDAIGAAGITSTWQSGI* |
| Ga0070741_108415642 | 3300005529 | Surface Soil | ARSLRAQPEAREACLTIEQAIEAAGMPSTWQSGI* |
| Ga0070738_104059401 | 3300005531 | Surface Soil | DSVEGELHTSHPNLAVMCRFLNSIARSLRAQPEARAACLAIEDAIGKSGMPSTWQSGI* |
| Ga0070734_100612182 | 3300005533 | Surface Soil | MCRFLNSIARSLRAQPEARDACLLIEDAIGKAGMPSTWQSGI* |
| Ga0070735_105309681 | 3300005534 | Surface Soil | ALMCNFLNSIARSLRARPEAREACLTIEQAIEAAGMPSTWQSGI* |
| Ga0070697_1014182551 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VEEQLHTAHPNLALMCRFLNSIARSLRAQPEARDACLAIEDAIGKAGMPSTWQSGI* |
| Ga0070731_111451722 | 3300005538 | Surface Soil | PNLALMCRFLNSIARSLRAQPEARDACLAIEDAIGKAGMPSTWQSGI* |
| Ga0068855_1016829822 | 3300005563 | Corn Rhizosphere | FLNSIARSLRAQPEARDVCLLIEDAIGAAGIASTWQSGI* |
| Ga0068852_1005918511 | 3300005616 | Corn Rhizosphere | HTAHPNLALMCRFLNSIARSLRAQPEARDACLAIEDAIGKAGMPSTWQSGI* |
| Ga0066903_1030389861 | 3300005764 | Tropical Forest Soil | LNSIARSLRAQPEAREVCLVIEDAIGTAGIASTWQSGI* |
| Ga0070712_1014611642 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | TFLNSIARSLRAQPEARDVCLVIEDAIGAAGITSTWQSGI* |
| Ga0074050_106153672 | 3300006577 | Soil | PNVQVITTFLNSIARSLRAQPEAREACLVIEDAIEHAGIPSTWQTGI* |
| Ga0066659_101365082 | 3300006797 | Soil | PNVALVCTFLNSIARSLRAQPEARHACLAIEDAIGKAGMPSTWQSGI* |
| Ga0066660_110624711 | 3300006800 | Soil | RFLNSIARSLRAQPEARDACLAIEDAIGKAGMPSTWQSGI* |
| Ga0075425_1011384151 | 3300006854 | Populus Rhizosphere | HPNLALMCRFLNSIARSLRAQPEARDACLLIEDAIGKAGMPSTWQSGI* |
| Ga0099793_106994171 | 3300007258 | Vadose Zone Soil | NVALMCRFLNSIARSLRAQPEARDACLAIEDAISKAGMPSTWQSGI* |
| Ga0111538_102180531 | 3300009156 | Populus Rhizosphere | NIQVIDTFLNSIARSLRAQPEAREACLRIEDVLERTGLPSTWQAGI* |
| Ga0126374_102407091 | 3300009792 | Tropical Forest Soil | IDQVEEQLHNHHPNLALMCRFLNSIARSLRAQPEARDACLLIEDAIGKAGMPSTWQSGI* |
| Ga0123355_109783242 | 3300009826 | Termite Gut | LMCRFLNSIARSLRAQPEARDACLAIEDAIGKAGMPSTWQSGI* |
| Ga0126382_102277051 | 3300010047 | Tropical Forest Soil | HHPNLAVMCRFLNSIARSLRAQPEARDACLLIEDAIGKAGMPSTWQSGI* |
| Ga0126373_111466471 | 3300010048 | Tropical Forest Soil | NVALMCRFLNSIARSLRAQPEARDACLLIEDAIGKAGIPSTWQSGI* |
| Ga0134109_101243621 | 3300010320 | Grasslands Soil | LMCRFLNSIARSLRAQPEARDACLAIEDAISRAGMPSTWQSGI* |
| Ga0134067_102546141 | 3300010321 | Grasslands Soil | SIARSLRAQPEARDACLAIEDAISKAGMPSTWQSGI* |
| Ga0126378_107662672 | 3300010361 | Tropical Forest Soil | HTSHPNLALMCRFLNSIARSLRAQPEARDACLQIEDAIGKAGMPSTWQSGI* |
| Ga0126378_117069491 | 3300010361 | Tropical Forest Soil | QLHTSHPNLALMCRFLNSIARSLRAQPEARDTCLLIEDAIGKAGMPSTWQSGI* |
| Ga0126378_134558371 | 3300010361 | Tropical Forest Soil | DRVEEELHSAHPNVGLLGTFLNSIARSLRAQPEAREVCLAIEDAIGTAGITSTWQSGI* |
| Ga0126377_108866071 | 3300010362 | Tropical Forest Soil | NSIARSLRAQPEAREACLVIEDALEPAGLPSTWQTGI* |
| Ga0105239_118432432 | 3300010375 | Corn Rhizosphere | LHSAHPAVSQMGTFLSSIARSLRAQPEAREVCLVIEDAIGTAGIASTWQSGI* |
| Ga0126381_1011525932 | 3300010376 | Tropical Forest Soil | DSVEEQLHTSHPNLALMCRFLNSIARSLRAQPEARDTCLLIEDAIGKAGMPSTWQSGI* |
| Ga0134123_100261791 | 3300010403 | Terrestrial Soil | HPNVPVMCTFLNSIARSLRNQPEAREACLVIEDAIEGAGLPSTWQSGI* |
| Ga0137393_117081282 | 3300011271 | Vadose Zone Soil | EEQLHTTHPNVALMCRFLNSIARSLRAQPEARHACLAIEDAIGKAGMPSTWQSGI* |
| Ga0137419_109230171 | 3300012925 | Vadose Zone Soil | MCRFLNSIARSLRAQPEARHACLAIEDAISKAGMPSTWQTGI* |
| Ga0137419_115050651 | 3300012925 | Vadose Zone Soil | DRVEEQLHTHHPNIALMCTFLNSIARSLRAQPEARHACLAIEDAIGTAGMPSTWQSGI* |
| Ga0137407_114436881 | 3300012930 | Vadose Zone Soil | NVALMCRFLNSIARSLRAQPEARDACLVIEDAIGKAGMPSTWQSGI* |
| Ga0126369_103341922 | 3300012971 | Tropical Forest Soil | CRFLNSIARSLRAQPEARDACLLIEDAIGKAGMTSTWQSGI* |
| Ga0134078_100333992 | 3300014157 | Grasslands Soil | ALMCRFLNSIARSLRAQPEARDACLAIEDAISKAGMPSTWQSGI* |
| Ga0182037_120174161 | 3300016404 | Soil | LNSIARSLRAQPEARDACLTIEGALGAAGVPSTWQSGI |
| Ga0182038_118391361 | 3300016445 | Soil | EEQLHHLHPNLALMCRYLNSIARSLRAQPEARDACLVIEDAIGKAGMPSTWQSGI |
| Ga0187809_100520352 | 3300017937 | Freshwater Sediment | MCRFLNSIARSLRAQPEARDACLLIEDAIGKAGMPSTWQSGI |
| Ga0187778_101796571 | 3300017961 | Tropical Peatland | EQLHTHHPNLALMCRFLNSIARSLRAQPEARDACLLIEDAIGKAGMPSTWQSGI |
| Ga0187778_108529292 | 3300017961 | Tropical Peatland | EQLHAGHPNLALMCRFLNSIARSLRAQPEAREACLLIEDAIGRAGMPSTWQSGI |
| Ga0187783_100025839 | 3300017970 | Tropical Peatland | NSIARSLRAQPEARHACLAIEDAIGKAGMPSTWQSGI |
| Ga0187783_107419471 | 3300017970 | Tropical Peatland | LALMCRLLNSIARSLRAQPEARDCCLVIEDAIGKAGMPSTWQSGI |
| Ga0187781_104320031 | 3300017972 | Tropical Peatland | SVEEQLHTVHPNLALMCRFLNSIARSLRAQPEAREACLAIEDAIGKAGMPSTWQSGI |
| Ga0187781_108638661 | 3300017972 | Tropical Peatland | HLHPNITLMCRFLNSIARSLRAQPEARDACLLIEDAIGKAGMPSTWQSGI |
| Ga0187777_101765041 | 3300017974 | Tropical Peatland | HPNLALMCRFLNSIARSLRAQPEARDACLLIEDAIGKAGMPSTWQSGI |
| Ga0187767_100206742 | 3300017999 | Tropical Peatland | FLNSIARSLRAQPEARDACLLIEDAIGKAGMPSTWQSGI |
| Ga0187815_100946882 | 3300018001 | Freshwater Sediment | CTFLNSIARSLRAQPEAREACLTIEQAIEAAGMPSTWQSGI |
| Ga0187766_100448593 | 3300018058 | Tropical Peatland | QLHNHHPNLALMCRFLNSIARSLRAQPEARDACLAIEDAIGKAGMPSTWQSGI |
| Ga0187765_101845692 | 3300018060 | Tropical Peatland | RVEEQLHTSHPNLALMCRFLNSIARSLRAQPEARDCCLAIEDAIGKAGMPSTWQSGI |
| Ga0187770_117963351 | 3300018090 | Tropical Peatland | QLHTTHPNLALMCRFLNSIARSLRAQPEARQACLAIEDAIGKAGMPSTWQSGI |
| Ga0190265_125747461 | 3300018422 | Soil | ANHPNVPLMCTFLNSIARSLRAQPEAREACLVIEDAIGVAGMPSTWQSGI |
| Ga0066662_101945092 | 3300018468 | Grasslands Soil | CRFLNSIARSLRAQPEARDACLAIEDAIGKAGMPITWQSGI |
| Ga0206353_108165612 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | PNVSLMGTFLNSIARSLRAQPEAREVCLVIEDAIGTAGIASTWQSGI |
| Ga0179594_100853061 | 3300020170 | Vadose Zone Soil | LNSIARSLRAQPEARDACLAIEDAIGKAGMPSTWQSGI |
| Ga0210404_102180701 | 3300021088 | Soil | QLHVNHPNVALMCRFLNSIARSLRAQPEARDACLAIEDAIGKAGMPSTWQSGI |
| Ga0210385_111309152 | 3300021402 | Soil | DCVEEQMHTSHPNLAVMCRFLNSIARSLRAQAEAREACLLIEDAIGKAGMPSTWQSGI |
| Ga0210384_109092432 | 3300021432 | Soil | EQLHVNHPNLALMCRFLNSIARSLRAQPEAREACLVIEAAIGKAGMPSTWQSGI |
| Ga0213871_101546071 | 3300021441 | Rhizosphere | MMCRFLNSIARSLRAQPEAREACLAIEDAIGRAGMPSTWQSGI |
| Ga0210398_109497422 | 3300021477 | Soil | LHNGHPNFALMCRFLNSIARSLRAQPEARDACLAIEDAIGKAGMPSTWQSGI |
| Ga0210409_111384972 | 3300021559 | Soil | LMCRFLNSIARSLRAQPEARDACLAIEDAIGKAGMPSTWQSGI |
| Ga0247692_10248802 | 3300024279 | Soil | CRFLNSIARSLRAQPEARDACLLIEDAIGKAGMPSTWQSGI |
| Ga0137417_14606124 | 3300024330 | Vadose Zone Soil | VRFLNSIARSLRAQPEARDACLAIEDAIGKAGMPSTWQSGI |
| Ga0207699_100948591 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | FLNSIARSLRAQPEARDACLAIEDAIGKAGMPSTWQSGI |
| Ga0207707_101142623 | 3300025912 | Corn Rhizosphere | SIARSLRAQPEARDVCLLIEDAIGAAGIASTWQSGI |
| Ga0207648_119705982 | 3300026089 | Miscanthus Rhizosphere | VEEQLHTAHPNLALMCRFLNSIARSLRAQPEARDACLAIEDAIGKAGMPSTWQSGI |
| Ga0209236_11613682 | 3300026298 | Grasslands Soil | NSIARSLRAQPEARGACLAIEDAIGKAGMPSTWQSGI |
| Ga0209154_12258772 | 3300026317 | Soil | CRFLNSIARSLRAQPEARDACLAIEDAIGKAGMPSTWQSGI |
| Ga0209807_10178211 | 3300026530 | Soil | NVALMCRFLNSIARSLRAQPEARDACLAIEDAISRAGMPSTWQSGI |
| Ga0209073_102804352 | 3300027765 | Agricultural Soil | FLNSVARSLRAQPEARDACLAIEAAIGQAGMPSTWQSGI |
| Ga0209060_104876342 | 3300027826 | Surface Soil | PNLALMCRFLNSIARSLRAQPEARDACLLIEDAIGKAGMPSTWQSGI |
| Ga0209274_101800191 | 3300027853 | Soil | RVEEQLHTTHPNLALMCRFLNSIARSLRAQPEARDACLAIEDAIGKAGMPSTWQSGI |
| Ga0209579_105838202 | 3300027869 | Surface Soil | QQLHISHPNLALMCRFLNSIARSLRAQPEARDACLAIEDAIGKAGMPSTWQSGI |
| Ga0209380_102288511 | 3300027889 | Soil | VEEQLHTTHPNLALMCRFLNSIARSLRAQPEARDACLAIEDAIGKAGMPSTWQSGI |
| Ga0209380_102296492 | 3300027889 | Soil | VEEQLHTTHPNLALMCRFLNSIARSLRAQPEARHACLAIEDAIGKAGMPSTWQSGI |
| Ga0209069_107593481 | 3300027915 | Watersheds | HTTHPNLALMCQFLNSIARSLRAQPEARDACLAIEDAIDKAGMPSTWQSGI |
| Ga0302184_102159881 | 3300030490 | Palsa | QLHNNHPNLAIMCRFLNSIARSLRAQPEARGACLAIEDAIGKAGMPSTWQSGI |
| Ga0311372_125367611 | 3300030520 | Palsa | SIARSLRAQPEARGACLAIEDAIGKAGMPSTWQSGI |
| Ga0265753_10744311 | 3300030862 | Soil | IDRVEEQLHTSHPNLALMCRFLNSIARSLRAQPEARDACLAIEDAIGKAGMPSTWQSGI |
| Ga0170824_1156165141 | 3300031231 | Forest Soil | VEEELHSARPNVALMGTFLNSIARSLRAQPEARDVCLVIEDAIGAAGITSTWQSGI |
| Ga0170818_1081078563 | 3300031474 | Forest Soil | VALMGTFLNSIARSLRAQPEARDVCLVIEDAIGAAGITSTWQSGI |
| Ga0318534_108778461 | 3300031544 | Soil | VEEQLHANHPNLALMCRFLNSIARSLRAQPEARDACLLIEDAIGKAGMPSTWQSGI |
| Ga0318515_100082224 | 3300031572 | Soil | HANHPNLALMCRFLNSIARSLRAQPEARDACLLIEDAIGKAGMPSTWQSGI |
| Ga0318555_102645911 | 3300031640 | Soil | RFLNSIARSLRAQPEARDACLQIEDAIGKAGMPSTWQSGI |
| Ga0318561_100139964 | 3300031679 | Soil | LALMCRFLNSIARSLRAQPEARDACLLIEDAIGKAGMPSTWQSGI |
| Ga0318560_106438712 | 3300031682 | Soil | LHADHPNLALMCRFLNSIARSLRAQPEARDSCLLIEDAIGKAGMPSTWQSGI |
| Ga0318496_107278652 | 3300031713 | Soil | QLHANHPNLALMCRFLNSIARSLRAQPEARDACLLIEDAIGKAGMPSTWQSGI |
| Ga0306917_105486602 | 3300031719 | Soil | NLALMCRFLNSIARSLRAQPEARDACLLIEDAIGKAGMPSTWQSGI |
| Ga0307469_101507241 | 3300031720 | Hardwood Forest Soil | NSVARSLRAQPEARDACLAIEDAIGKAGMPSTWQSGI |
| Ga0307469_110764632 | 3300031720 | Hardwood Forest Soil | SDEEQLHTSHPNLALMCRFLNSIARSLRAQPEARDACLQIEDAIGKAGMPSTWQSGI |
| Ga0318493_107786002 | 3300031723 | Soil | DRVEEQLHANHPNLALMCRFLNSIARSLRAQPEARDACLLIEDAIGKAGMPSTWQSGI |
| Ga0318501_107405071 | 3300031736 | Soil | VEEQLHHLHPNLALMCRFLNSIARSLRAQPEARDACLAIEDAIGKAGMPSTWQSGI |
| Ga0307468_1003832582 | 3300031740 | Hardwood Forest Soil | NVQVITTFLNSIARSLRAQPEAREACLVIEDAIEHAGIPSTWQTGI |
| Ga0318502_109130671 | 3300031747 | Soil | NHPNLALMCRFLNSIARSLRAQPEARDACLLIEDAIGKAGMPSTWQSGI |
| Ga0318502_109575062 | 3300031747 | Soil | TNHPNLALMCRFLNSIARSLRAQPEARDACLLIEDAIGKAGMPSTWQSGI |
| Ga0318494_100488992 | 3300031751 | Soil | QLHLNHPNLALMCRFLNSIARSLRAQPEARDACLLIEDAIGKAGMPSTWQSGI |
| Ga0307477_100334981 | 3300031753 | Hardwood Forest Soil | NSIARSLRAQPEARDACLAIEDAIGKAGMPSTWQSGI |
| Ga0307475_105757362 | 3300031754 | Hardwood Forest Soil | LHAGHPNLAVMCRFLNSIARSLRAQAEAREACLLIEDAIGKAGMPSTWQSGI |
| Ga0318537_102683221 | 3300031763 | Soil | ALMCRFLNSIARSLRAQPEARDACLLIEDAIGKAGMPSTWQSGI |
| Ga0318498_103780382 | 3300031778 | Soil | LNSIARSLRAQPEARDACLLIEDAIGKAGMPSTWQSGI |
| Ga0318503_103243091 | 3300031794 | Soil | PNLALMCRFLNSIARSLRAQPEARDSCLLIEDAIGKAGMPSTWQSGI |
| Ga0318565_100298223 | 3300031799 | Soil | LHLNHPNLALMCRFLNSIARSLRAQPEARDACLLIEDAIGKAGMPSTWQSGI |
| Ga0318497_101278901 | 3300031805 | Soil | LMCRFLNSIARSLRAQPEARDSCLLIEDAIGKAGMPSTWQSGI |
| Ga0307478_101257691 | 3300031823 | Hardwood Forest Soil | RFLNSIARSLRAQPEARDACLAIEDAIGKAGMPSTWQSGI |
| Ga0318499_104031541 | 3300031832 | Soil | LHAAHPNLALMCTFLNSIARSLRAQPEARDACLTIEGALGAAGVPSTWQSGI |
| Ga0302315_107071642 | 3300031837 | Palsa | LAVMCRFLNSIARSLRAQPEAREACLAIEDAIGKAGMPSTWQSGV |
| Ga0306919_100827891 | 3300031879 | Soil | RFLNSIARSLRAQPEARDACLLIEDAIGKAGMPSTWQSGI |
| Ga0306921_115599111 | 3300031912 | Soil | HPNLALMCTFLNSIARSLRAQPEARDACLTIEGALGAAGVPSTWQSGI |
| Ga0310916_100064391 | 3300031942 | Soil | RVEEQLHANHPNLALMCRFLNSIARSLRAQPEARDACLLIEDAIGKAGMPSTWQSGI |
| Ga0310911_108311011 | 3300032035 | Soil | CRFLNSIARSLRAQPEARDSCLLIEDAIGKAGMPSTWQSGI |
| Ga0318556_100235244 | 3300032043 | Soil | FLNSIARSLRAQPEARDSCLLIEDAIGKAGMPSTWQSGI |
| Ga0318570_100150054 | 3300032054 | Soil | CRFLNSIARSLRAQPEARDACLQIEDAIGKAGMPSTWQSGI |
| Ga0318570_104115521 | 3300032054 | Soil | LALMCRFLNSIARSLRAQPEARDSCLLIEDAIGKAGMPSTWQSGI |
| Ga0318510_105554691 | 3300032064 | Soil | EEQLHADHPNLALMCRFLNSIARSLRAQPEARDSCLLIEDAIGKAGMPSTWQSGI |
| Ga0318514_105793962 | 3300032066 | Soil | EQLHANHPNLALMCRFLNSIARSLRAQPEARDACLLIEDAIGKAGMPSTWQSGI |
| Ga0318577_103581571 | 3300032091 | Soil | EQLHADHPNLALMCRFLNSIARSLRAQPEARDSCLLIEDAIGKAGMPSTWQSGI |
| Ga0311301_117582252 | 3300032160 | Peatlands Soil | NELHNGHPNFALMCRFLNSIARSLRAQPEARYACLAIEDAIGKAGMPSTWQSGI |
| Ga0307470_100656493 | 3300032174 | Hardwood Forest Soil | AGHPNLAVMCRFLNSIARSLRAQAEAREACLLIEDAIGKAGMPSTWQSGI |
| Ga0307470_117575871 | 3300032174 | Hardwood Forest Soil | CRFLNSIARSLRAQPEARNACLLIEDAIGKAGMPSTWQSGI |
| Ga0335079_101257684 | 3300032783 | Soil | RFLNSIARSLRAQPEARDCCLAIEDAIGKAGMPSTWQSGI |
| Ga0335078_115050992 | 3300032805 | Soil | DRVELELHAAHPNVPLMCTFLNSIARSLRAQPEARDACLTIEGAIGVAGMPSTWQSGI |
| Ga0335080_123332772 | 3300032828 | Soil | LMCRFLNSIARSLRAQPEARDACMAIEDAIGKAGMPSTWQSGI |
| Ga0335081_100576941 | 3300032892 | Soil | DSVEEQLHLGHPNLALMCRFLNSIARSLRAQPEARDACLAIEDAIGKAGMPSTWQSGI |
| Ga0335075_106143221 | 3300032896 | Soil | ALMCTFLNSIARSLRAQPEARAACLTIEQAIETAGMPSTWQSGI |
| Ga0335072_101117651 | 3300032898 | Soil | IARSLRAQPEAREACLTIEQAIEAAGMLSTWQSGI |
| Ga0335083_105085721 | 3300032954 | Soil | VENELHVNHPNLALMCRFLNSIARSLRAQPEARDACLAIEDAIGKAGMPSTWQSGI |
| Ga0318519_103689291 | 3300033290 | Soil | EEQLHANHPNLALMCRFLNSIARSLRAQPEARDACLLIEDAIGKAGMPSTWQSGI |
| Ga0314866_076934_402_551 | 3300033807 | Peatland | MHPNLPLMCNFLNSIARSLRAQPEAREACLTIEGAIGVAGMPSTWQSGI |
| ⦗Top⦘ |