| Basic Information | |
|---|---|
| Family ID | F057545 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 136 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MLREDLMNPDLFSEIVLLGSAALIVVALLLIVVAAFTQPAALA |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 136 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 83.21 % |
| % of genes near scaffold ends (potentially truncated) | 22.06 % |
| % of genes from short scaffolds (< 2000 bps) | 66.18 % |
| Associated GOLD sequencing projects | 83 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (83.088 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (26.471 % of family members) |
| Environment Ontology (ENVO) | Unclassified (38.971 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (83.088 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.48% β-sheet: 0.00% Coil/Unstructured: 53.52% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 136 Family Scaffolds |
|---|---|---|
| PF00027 | cNMP_binding | 20.59 |
| PF13545 | HTH_Crp_2 | 18.38 |
| PF12779 | WXXGXW | 3.68 |
| PF00072 | Response_reg | 1.47 |
| PF00196 | GerE | 1.47 |
| PF13481 | AAA_25 | 0.74 |
| PF05532 | CsbD | 0.74 |
| PF04909 | Amidohydro_2 | 0.74 |
| PF02684 | LpxB | 0.74 |
| PF11999 | Ice_binding | 0.74 |
| PF13490 | zf-HC2 | 0.74 |
| PF00069 | Pkinase | 0.74 |
| COG ID | Name | Functional Category | % Frequency in 136 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.94 |
| COG0763 | Lipid A disaccharide synthetase | Cell wall/membrane/envelope biogenesis [M] | 0.74 |
| COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 0.74 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 83.09 % |
| Unclassified | root | N/A | 16.91 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001082|JGI12664J13189_1000531 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 5356 | Open in IMG/M |
| 3300001593|JGI12635J15846_10012981 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6973 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100093417 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2810 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100622724 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100913704 | Not Available | 760 | Open in IMG/M |
| 3300003370|JGI26337J50220_1025518 | Not Available | 678 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10025183 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2123 | Open in IMG/M |
| 3300004099|Ga0058900_1414469 | Not Available | 589 | Open in IMG/M |
| 3300004103|Ga0058903_1473081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 866 | Open in IMG/M |
| 3300004120|Ga0058901_1000606 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300004135|Ga0058884_1061567 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 779 | Open in IMG/M |
| 3300004135|Ga0058884_1405353 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1470 | Open in IMG/M |
| 3300004468|Ga0068977_1216364 | Not Available | 831 | Open in IMG/M |
| 3300004631|Ga0058899_10072511 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1266 | Open in IMG/M |
| 3300004631|Ga0058899_12194411 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300004631|Ga0058899_12302380 | Not Available | 549 | Open in IMG/M |
| 3300005538|Ga0070731_10045917 | All Organisms → cellular organisms → Bacteria | 2918 | Open in IMG/M |
| 3300005602|Ga0070762_10120040 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1544 | Open in IMG/M |
| 3300005602|Ga0070762_10292229 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1024 | Open in IMG/M |
| 3300005602|Ga0070762_11160291 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300005602|Ga0070762_11160292 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300005610|Ga0070763_10207764 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1046 | Open in IMG/M |
| 3300006176|Ga0070765_100045209 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3554 | Open in IMG/M |
| 3300006176|Ga0070765_100112364 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2375 | Open in IMG/M |
| 3300006893|Ga0073928_10031967 | All Organisms → cellular organisms → Bacteria | 5040 | Open in IMG/M |
| 3300009520|Ga0116214_1019777 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2400 | Open in IMG/M |
| 3300009521|Ga0116222_1434820 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300009522|Ga0116218_1033921 | All Organisms → cellular organisms → Bacteria | 2299 | Open in IMG/M |
| 3300009525|Ga0116220_10414033 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
| 3300009623|Ga0116133_1004796 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3448 | Open in IMG/M |
| 3300009628|Ga0116125_1005737 | All Organisms → cellular organisms → Bacteria | 3606 | Open in IMG/M |
| 3300009700|Ga0116217_10374386 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 906 | Open in IMG/M |
| 3300010343|Ga0074044_10013179 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6171 | Open in IMG/M |
| 3300010379|Ga0136449_100450597 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2258 | Open in IMG/M |
| 3300010379|Ga0136449_104442302 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300011072|Ga0138563_1046802 | Not Available | 656 | Open in IMG/M |
| 3300011078|Ga0138565_1033713 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 684 | Open in IMG/M |
| 3300011120|Ga0150983_10274312 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
| 3300011120|Ga0150983_10276010 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300011120|Ga0150983_12315369 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1233 | Open in IMG/M |
| 3300011120|Ga0150983_13706282 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1715 | Open in IMG/M |
| 3300011120|Ga0150983_14577327 | Not Available | 853 | Open in IMG/M |
| 3300011120|Ga0150983_15531906 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
| 3300011120|Ga0150983_15535190 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300014489|Ga0182018_10079769 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1943 | Open in IMG/M |
| 3300014501|Ga0182024_10066064 | All Organisms → cellular organisms → Bacteria | 5530 | Open in IMG/M |
| 3300014501|Ga0182024_10120347 | All Organisms → cellular organisms → Bacteria | 3758 | Open in IMG/M |
| 3300014501|Ga0182024_10446337 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1660 | Open in IMG/M |
| 3300014501|Ga0182024_10505406 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1536 | Open in IMG/M |
| 3300017822|Ga0187802_10084612 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1184 | Open in IMG/M |
| 3300017822|Ga0187802_10115422 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300017942|Ga0187808_10603495 | Not Available | 510 | Open in IMG/M |
| 3300017943|Ga0187819_10131149 | All Organisms → cellular organisms → Bacteria | 1494 | Open in IMG/M |
| 3300017946|Ga0187879_10064844 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2128 | Open in IMG/M |
| 3300018012|Ga0187810_10308676 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300018038|Ga0187855_10023215 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4031 | Open in IMG/M |
| 3300018038|Ga0187855_10902413 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300018043|Ga0187887_10010241 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6385 | Open in IMG/M |
| 3300018046|Ga0187851_10015343 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5500 | Open in IMG/M |
| 3300019182|Ga0184598_133954 | Not Available | 781 | Open in IMG/M |
| 3300019186|Ga0184588_142442 | Not Available | 739 | Open in IMG/M |
| 3300019188|Ga0184599_145956 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 697 | Open in IMG/M |
| 3300019786|Ga0182025_1127350 | Not Available | 831 | Open in IMG/M |
| 3300020579|Ga0210407_10384219 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1099 | Open in IMG/M |
| 3300020579|Ga0210407_10741809 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300020579|Ga0210407_11072176 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300020580|Ga0210403_10008994 | All Organisms → cellular organisms → Bacteria | 8203 | Open in IMG/M |
| 3300020580|Ga0210403_10121782 | All Organisms → cellular organisms → Bacteria | 2123 | Open in IMG/M |
| 3300020580|Ga0210403_10374720 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1164 | Open in IMG/M |
| 3300020580|Ga0210403_10775465 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 764 | Open in IMG/M |
| 3300020581|Ga0210399_10287873 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1371 | Open in IMG/M |
| 3300020581|Ga0210399_10511947 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 997 | Open in IMG/M |
| 3300020581|Ga0210399_10847860 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 744 | Open in IMG/M |
| 3300020581|Ga0210399_11126027 | Not Available | 627 | Open in IMG/M |
| 3300020582|Ga0210395_10017142 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 5323 | Open in IMG/M |
| 3300020582|Ga0210395_10241167 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1358 | Open in IMG/M |
| 3300020582|Ga0210395_11084967 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300020583|Ga0210401_10445144 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
| 3300020583|Ga0210401_11079393 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 661 | Open in IMG/M |
| 3300021168|Ga0210406_10127882 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2144 | Open in IMG/M |
| 3300021170|Ga0210400_10044577 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3445 | Open in IMG/M |
| 3300021170|Ga0210400_10078274 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2596 | Open in IMG/M |
| 3300021171|Ga0210405_10131731 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1978 | Open in IMG/M |
| 3300021171|Ga0210405_10174499 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1703 | Open in IMG/M |
| 3300021178|Ga0210408_11130499 | Not Available | 601 | Open in IMG/M |
| 3300021404|Ga0210389_10089484 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2366 | Open in IMG/M |
| 3300021404|Ga0210389_10402396 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1076 | Open in IMG/M |
| 3300021405|Ga0210387_10889268 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 784 | Open in IMG/M |
| 3300021407|Ga0210383_10077107 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2789 | Open in IMG/M |
| 3300021407|Ga0210383_11511386 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300021420|Ga0210394_10002649 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 24197 | Open in IMG/M |
| 3300021420|Ga0210394_11349970 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300021474|Ga0210390_10642260 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 887 | Open in IMG/M |
| 3300021474|Ga0210390_11043235 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300021478|Ga0210402_11268780 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 664 | Open in IMG/M |
| 3300021479|Ga0210410_10060541 | All Organisms → cellular organisms → Bacteria | 3307 | Open in IMG/M |
| 3300021559|Ga0210409_10064570 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3413 | Open in IMG/M |
| 3300022557|Ga0212123_10689258 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
| 3300022726|Ga0242654_10374187 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300022881|Ga0224545_1035880 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300024225|Ga0224572_1092215 | Not Available | 559 | Open in IMG/M |
| 3300026335|Ga0209804_1000909 | All Organisms → cellular organisms → Bacteria | 20931 | Open in IMG/M |
| 3300027370|Ga0209010_1000007 | All Organisms → cellular organisms → Bacteria | 230472 | Open in IMG/M |
| 3300027565|Ga0209219_1114523 | Not Available | 660 | Open in IMG/M |
| 3300027604|Ga0208324_1019109 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2128 | Open in IMG/M |
| 3300027641|Ga0208827_1174824 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300027660|Ga0209736_1011519 | All Organisms → cellular organisms → Bacteria | 2826 | Open in IMG/M |
| 3300027729|Ga0209248_10002148 | All Organisms → cellular organisms → Bacteria | 6327 | Open in IMG/M |
| 3300027768|Ga0209772_10215864 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300027854|Ga0209517_10286869 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 968 | Open in IMG/M |
| 3300027854|Ga0209517_10523973 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 641 | Open in IMG/M |
| 3300027854|Ga0209517_10637327 | Not Available | 558 | Open in IMG/M |
| 3300027855|Ga0209693_10006777 | All Organisms → cellular organisms → Bacteria | 5264 | Open in IMG/M |
| 3300027855|Ga0209693_10447815 | Not Available | 621 | Open in IMG/M |
| 3300027889|Ga0209380_10315899 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300027895|Ga0209624_10387452 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 932 | Open in IMG/M |
| 3300028016|Ga0265354_1004664 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1426 | Open in IMG/M |
| 3300028037|Ga0265349_1027787 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300028047|Ga0209526_10832663 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300028906|Ga0308309_10004798 | All Organisms → cellular organisms → Bacteria | 8158 | Open in IMG/M |
| 3300030862|Ga0265753_1051784 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300030991|Ga0073994_10021940 | Not Available | 679 | Open in IMG/M |
| 3300031231|Ga0170824_112389926 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300031446|Ga0170820_11352896 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300031708|Ga0310686_111827034 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1902 | Open in IMG/M |
| 3300031708|Ga0310686_115432940 | All Organisms → cellular organisms → Bacteria | 2131 | Open in IMG/M |
| 3300031715|Ga0307476_10005016 | All Organisms → cellular organisms → Bacteria | 7980 | Open in IMG/M |
| 3300031718|Ga0307474_10397955 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
| 3300031962|Ga0307479_10555196 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1131 | Open in IMG/M |
| 3300031962|Ga0307479_10588565 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1095 | Open in IMG/M |
| 3300032160|Ga0311301_10358858 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2271 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 26.47% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 20.59% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 11.76% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 9.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.15% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.68% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.68% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 3.68% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.94% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.21% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.47% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.47% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.47% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.74% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.74% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.74% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.74% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.74% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.74% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.74% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001082 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 | Environmental | Open in IMG/M |
| 3300001084 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003370 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004099 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF236 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004103 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF242 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004120 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF238 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004135 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF204 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004468 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 74 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011072 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 48 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011078 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 50 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300019182 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZE1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019186 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSE3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019188 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZE2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022881 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 20-24 | Environmental | Open in IMG/M |
| 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5 | Host-Associated | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300027370 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Host-Associated | Open in IMG/M |
| 3300028037 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12664J13189_10005317 | 3300001082 | Forest Soil | MSREDLMKPDLLSEIVLLGSAAVIVVVLLLIVVAALTQPTALA* |
| JGI12648J13191_10302372 | 3300001084 | Forest Soil | MKPDLLSQIVPLGSAAVMVFVLLLILVAALTQATAPA* |
| JGI12635J15846_100129819 | 3300001593 | Forest Soil | MSREDLMKPDLLSEIVLLGSAAVIVVVLLLIAVAALTQPTALA* |
| JGIcombinedJ26739_1000934174 | 3300002245 | Forest Soil | MRQQDLMNPDLLSEIVLLGSAALLVAGLLLIVVAAVTRSAALA* |
| JGIcombinedJ26739_1006227241 | 3300002245 | Forest Soil | MRCEDLMSPDLISEVVLLGSAVLIVVVLMLIVVAAFT |
| JGIcombinedJ26739_1009137042 | 3300002245 | Forest Soil | MRREDLMSPDLLSEIVLLGSVALMVVTLLLIVVAAFTQPTAHMAGM* |
| JGI26337J50220_10255182 | 3300003370 | Bog Forest Soil | MSREDLMKPDLLSEIVLLGSAAVMVVVLLLIVVAALTQPIALA* |
| JGIcombinedJ51221_100251832 | 3300003505 | Forest Soil | MLREDVMDPDLFSEIVLLGSAALIVVAFLLIVMATFTQPAALA* |
| Ga0058900_14144692 | 3300004099 | Forest Soil | GDLMNPDLFSEIVLLGSAALIVVAFLLIVMATFTQPAALA* |
| Ga0058903_14730812 | 3300004103 | Forest Soil | MRREDLMSPDLLSEIVLLGSAALMIVTLLLIVVAAFTQPTASMAGM* |
| Ga0058901_10006061 | 3300004120 | Forest Soil | MLREDVMDPDLFSEIVLLGSAALIVVAFLLIVVAAFTQPAALA* |
| Ga0058884_10615671 | 3300004135 | Forest Soil | DLMNPDLLSEIVLLGSAALIAVTLLLIVASALTQPAALA* |
| Ga0058884_14053533 | 3300004135 | Forest Soil | MLPEDLMNPDLLSEVVLLGSAALIIVALLLIVAAVLTQPAALA* |
| Ga0068977_12163642 | 3300004468 | Peatlands Soil | RTEMRREDLMSPDLLSEIVLLGSAALIVVAWLLIVVAALTQPAALA* |
| Ga0058899_100725113 | 3300004631 | Forest Soil | MRREDLMNPDLLSEIVLLGSAALLVVGLSLIVAAALAQSAVLA* |
| Ga0058899_121944111 | 3300004631 | Forest Soil | NPGEVRTEMLPEDLMNPDLLSEVVLLGTAALIIVALLLIVAAVLTQPAALA* |
| Ga0058899_123023801 | 3300004631 | Forest Soil | MRQQDLMSPDLLSEIVLLGSAALLVVGLLLIVAAALTQPVALA* |
| Ga0070731_100459172 | 3300005538 | Surface Soil | MCCEDLMSPDLVSEVVLVGSAALMLAVLILVVVAALTQPAALA* |
| Ga0070762_101200403 | 3300005602 | Soil | MLRGDLMNPDLFSEIVLLGSAALIVVAFLLIVVAAFTQPAALA* |
| Ga0070762_102922291 | 3300005602 | Soil | REDLMKPDLFSEVVLLGSAALIVVALLLIVVAAFTQPAALA* |
| Ga0070762_111602912 | 3300005602 | Soil | MLREDLMKPDLFSEVVLLGSAALIVVALLLIVVAAFTQPAA |
| Ga0070762_111602922 | 3300005602 | Soil | MFREDLMKPDLFSEVVLLGSAALIVVALLLIVVAAFTQPAA |
| Ga0070763_100704464 | 3300005610 | Soil | MNRKDLMKPDLLSQIVPLGSAAVMVFVLLLILVAALTQATAPA* |
| Ga0070763_102077642 | 3300005610 | Soil | MFREDLMKPDLFSEVVLLGSAALIVVALLLIVVAAFTQPAALA* |
| Ga0070765_1000452095 | 3300006176 | Soil | MSPDLLSEIVLLGSVGLMVVALLFTVVAALAQPSALA* |
| Ga0070765_1001123646 | 3300006176 | Soil | GKTEMNRKDLMKPDLLSQIVPLGSAAVMVFVLLLILVAALTQATAPA* |
| Ga0073928_100319673 | 3300006893 | Iron-Sulfur Acid Spring | MRREDLMSPDLLSEIVLLGSAALMVVTLLLIVVAAFTQPTASMAGM* |
| Ga0116214_10197772 | 3300009520 | Peatlands Soil | MKPDLFSEIVLLGSAALIVVALLLIVVAAFTQPAALA* |
| Ga0116222_14348202 | 3300009521 | Peatlands Soil | MRREDLMSPDLLSEIVLLGSAALIVVAWLLIVVAALTQPAALA* |
| Ga0116218_10339213 | 3300009522 | Peatlands Soil | MRREDLMSPDLLSEIVLLGSAALIVVTWLLIVVAALTHAAVLA* |
| Ga0116220_104140332 | 3300009525 | Peatlands Soil | MRREDLMSPDLLSKIVLLGRVALMVVALLLIVVAALTQPTALA* |
| Ga0116133_10047963 | 3300009623 | Peatland | MSRKDLMSPDLLSEIVLLGSAAVIVVVWLLIAVAALTQPIALT* |
| Ga0116125_10057375 | 3300009628 | Peatland | MSRKDLMSPDLLSEIVLLGSAAVIVVVWLLIVVAALTQPIALT* |
| Ga0116217_103743861 | 3300009700 | Peatlands Soil | MRREDLMSPDLLSKIVLLGSVALMVVALLLIVVAALTQPTALA* |
| Ga0074044_100131796 | 3300010343 | Bog Forest Soil | MRREDLMSPDLLSEIVLLGSVALMVVALLLIVVAALTQPAALA* |
| Ga0136449_1004505972 | 3300010379 | Peatlands Soil | MRREDLMQPDLLSEIVLLGSAALIVVALLLIAVAAFTQPTALA* |
| Ga0136449_1044423022 | 3300010379 | Peatlands Soil | MLREDLMNPDLFSEIVLLGSAALIVVALLLIVVAAFTQPAALA* |
| Ga0138563_10468021 | 3300011072 | Peatlands Soil | TEMRREDLMSPDLLSEIVLLGSAALIVVAWLLIVVAALTQPAALA* |
| Ga0138565_10337132 | 3300011078 | Peatlands Soil | MRREDLMSPDLLSEIVLLGSVALMVVALLLIVVAALTQPTALA* |
| Ga0150983_102743122 | 3300011120 | Forest Soil | HREDLMQPDLLSEIVLVGSVALMVVALALIVVAAFTQPTALA* |
| Ga0150983_102760102 | 3300011120 | Forest Soil | HREDLMQPDLLSEIVLVGSVALMVVALALIVVAAFTQPTAPA* |
| Ga0150983_123153691 | 3300011120 | Forest Soil | MNPDLLSEVVLLGSAALIIVALLLIVAAVLTQPAALA* |
| Ga0150983_137062822 | 3300011120 | Forest Soil | MNPDLFSEIVLLGSAALIVVALLLIAVAAFTQPAALA* |
| Ga0150983_145773271 | 3300011120 | Forest Soil | RHSWGTEMRREDLMNPDLLSEIVLLGSAAVIVVALLLIVVAALTQPTALA* |
| Ga0150983_155319061 | 3300011120 | Forest Soil | MRRDDLMSPDLLSEIVLLGSGALMVVALLLTVAAVLTQPAALA* |
| Ga0150983_155351902 | 3300011120 | Forest Soil | MRQQDLMNPDLLSEVVLVGSAALLVVGLLLVVLAALTQSAALA* |
| Ga0182018_100797691 | 3300014489 | Palsa | MRCEDLMSPDLVSEIVLVGSVALMVAVLIGIVVAALTQPAALA* |
| Ga0182024_100660642 | 3300014501 | Permafrost | MRREDLMSPDLLSEIVLLGSVALMVVTLLLIAVAAFTQPTARIAGM* |
| Ga0182024_101203472 | 3300014501 | Permafrost | MRREDLMSPDLLSEIVLLGSVALIVVTLLLIVVAAFTQPTARIAGM* |
| Ga0182024_104463371 | 3300014501 | Permafrost | MRCDDLMSPDLVSEIVLVGSIALMVAVLVLIVVAALTQPAALA* |
| Ga0182024_105054064 | 3300014501 | Permafrost | MRREDLMSSDLLSEIVLLGSVALMVVTLLLIVVAAFTQPTARMAGM* |
| Ga0187802_100846123 | 3300017822 | Freshwater Sediment | MRREDLMSPDLLSEIVLLGSAALIVVAWLLIVVAALTQPAALA |
| Ga0187802_101154222 | 3300017822 | Freshwater Sediment | MLREDLMNPDLFSEIVLLGSAALIVVALLLIAVAAFTQPAALA |
| Ga0187808_106034951 | 3300017942 | Freshwater Sediment | MLREDLMNPDLFSEIVLLGSAALIVVALLLIVVAAFTQPGALA |
| Ga0187819_101311493 | 3300017943 | Freshwater Sediment | MRHEDLMSPDLLSEIVLLGSVAVLVVGLLLIVLAALAQPAALA |
| Ga0187879_100648442 | 3300017946 | Peatland | MSRKDLMSPDLLSEIVLLGSAAVIVVVWLLIAVAALTQPIALT |
| Ga0187810_103086762 | 3300018012 | Freshwater Sediment | MLREDLMNPDLFSEIVLLGSAALIVVALLLIVVAAF |
| Ga0187855_100232156 | 3300018038 | Peatland | MSRKDLMSPDLLSEIVLLGSAAVIVVVWLLIVVAALTQPIALT |
| Ga0187855_109024132 | 3300018038 | Peatland | DLMSPDLLSEIVLLGSAAVIVVVWLLIAVAALTQPIALT |
| Ga0187887_100102414 | 3300018043 | Peatland | MSPDLLSEIVLLGSAAVIVVVWLLIAVAALTQPIALT |
| Ga0187851_100153435 | 3300018046 | Peatland | MSPDLLSEIVLLGSAAVIVVVWLLIVVAALTQPIALT |
| Ga0184598_1339542 | 3300019182 | Soil | NPDLFSEIVLLGSAALIVVAFLLIVVAAFTQPAALA |
| Ga0184588_1424421 | 3300019186 | Soil | MLREDLMNPDLFSEIVLLGSAALIVVAFLLIVVAAFTQPAALA |
| Ga0184599_1459561 | 3300019188 | Soil | MLREDLMNPDLFSEIVLLGSAALIVVALLLIVVAAFTQPAALA |
| Ga0182025_11273502 | 3300019786 | Permafrost | MRREDLMSPDLLSEIVLLGSVALIVVTLLLIVVAAFTQPTARIAGM |
| Ga0210407_103842192 | 3300020579 | Soil | MLREDLMNPDLFSEIVLLGSAALIAVAWLLIVVAAFIQPAALA |
| Ga0210407_107418092 | 3300020579 | Soil | MLLEDLMKPDLFSEVVLLGSAALIVVALLLIVVAAFTQPAALA |
| Ga0210407_110721761 | 3300020579 | Soil | MLREDLMKPDMLSEIVLLGSAAPFVVAFVLIAVAVLTQPGALA |
| Ga0210403_100089944 | 3300020580 | Soil | MKPDLFSEVVLLGSAALIAVALLVIVVAAFTQPAALA |
| Ga0210403_101217822 | 3300020580 | Soil | MRQQDLMNPDLLSEIVLLGSAALLVVGLLLIVVAAFTQPAALV |
| Ga0210403_103747202 | 3300020580 | Soil | MKPDMLSEIVLLGSAAPFVVAFVLIAVAVLTQPGALA |
| Ga0210403_107754652 | 3300020580 | Soil | RTEMLREDLMNPDLFSEIVLLGSAALIAVAWLLIVVAAFTQPAALA |
| Ga0210399_102878732 | 3300020581 | Soil | VLREDLMKPDLFSEVVLLGSAALIAVALLVIVVAAFTQPAALA |
| Ga0210399_105119472 | 3300020581 | Soil | MLLEDLMKPDLFSEIVLLGSAALIVVALLLIVVAAFTQPAALA |
| Ga0210399_108478602 | 3300020581 | Soil | MLRDDLMKPDLLSEVVLLGSAALIVVALFLIVVAAFTQPVALA |
| Ga0210399_111260272 | 3300020581 | Soil | TEMRREDLMNPDLLSEIVLLGSAAVIVVALLLIVVAALTQPTALA |
| Ga0210395_100171423 | 3300020582 | Soil | MLREDLMNPDLFSEIVLLGSAALIAVAWLLIVVAAFIQPAALV |
| Ga0210395_102411673 | 3300020582 | Soil | MLREDVMDPDLFSEIVLLGSAALIVVAFLLIVMATFTQPAALA |
| Ga0210395_110849672 | 3300020582 | Soil | MLREDLMNPDLFSEIVLLGSAALIVVALLLIAVAAFTQPA |
| Ga0210401_104451445 | 3300020583 | Soil | MLPEDLMRPDLLSEIVLLGSPALIIVVLLLIVAAAFRQPAALA |
| Ga0210401_110793931 | 3300020583 | Soil | PDLLSEIVLLGSGALMVVALLLTVAAVLTQPAALA |
| Ga0210406_101278821 | 3300021168 | Soil | MLREDLMNPDLFSEIVLLGSGALIAVAWLLIVVAAFTQPAALA |
| Ga0210400_100445775 | 3300021170 | Soil | MRQQDLMNPDLLSEILLLGSAALLVVGLLLIVVAAFTQPAALV |
| Ga0210400_100782743 | 3300021170 | Soil | MRQQDLMNPDLLSEVVLVGSAALLVVGLLLVVLAALTQSAALA |
| Ga0210405_101317313 | 3300021171 | Soil | MLRGGLMKPDLLSEIVLLDMGALIVVALLLIVVAAVTQPTALQVAR |
| Ga0210405_101744992 | 3300021171 | Soil | MLREDLMKPDLFSEVVLLGSAALIVVALLLTVVAAFTQPAALA |
| Ga0210408_111304991 | 3300021178 | Soil | MLREDLMKPDLLSEIVLLGSAAAIIVVLLLIVAAALTQPAALA |
| Ga0210389_100894843 | 3300021404 | Soil | MLREGLMKPDLLSEIVLLDMGALIVVALLLIVVAAVTQPTALQVAR |
| Ga0210389_104023962 | 3300021404 | Soil | MLREDLMNPDLFSEIVLLGSAALIAVAWLLIVVAAFTQPAALA |
| Ga0210387_108892681 | 3300021405 | Soil | LMKPDMLSEIVLLGSAAPFVVAFVLIAVAVLTQPGALA |
| Ga0210383_100771075 | 3300021407 | Soil | SRQNWRTEMLREDLMNPDLFSEIVLLGSAALVVVAWLLIVVAAFAQPAALA |
| Ga0210383_115113861 | 3300021407 | Soil | MLREDLMNPDLFSEVVLLGSAALIVVALLLIVVAACTQP |
| Ga0210394_1000264916 | 3300021420 | Soil | MRREDLMSPDLLSEIVLLGSAALMIVTLLLIVVAAFTQPTASMAGM |
| Ga0210394_113499703 | 3300021420 | Soil | MLREDLMNPDLFSEIVLLGSAALVVVALLLIVVAAFAQPAALA |
| Ga0210390_106422601 | 3300021474 | Soil | MLREDLMNPDLFSEIVLLGSAALVVVAWLLIVVAAFAQPAALA |
| Ga0210390_110432351 | 3300021474 | Soil | MLREDVMDPDLFSEIVLLGSAALIVVAFLLIVMATF |
| Ga0210402_112687801 | 3300021478 | Soil | MRQQDLMNRDLLSEIVLLGSAALLVVGLLLIVVAAFTQPAALV |
| Ga0210410_100605411 | 3300021479 | Soil | MQPDLLSEIVLVGSVALMVVALALIVVAAFTQPTALA |
| Ga0210409_100645704 | 3300021559 | Soil | MFREDLMKPDLFSEVVLLGSAALIVVALLLIVVAAFTQPAALA |
| Ga0212123_106892582 | 3300022557 | Iron-Sulfur Acid Spring | MRREDLMSPDLLSEIVLLGSAALMVVTLLLIVVAAFTQPTASMAGM |
| Ga0242654_103741871 | 3300022726 | Soil | REDLMNPDLLSEIVLLGSAAVIVVALLLIVVAALTQPTALA |
| Ga0224545_10358802 | 3300022881 | Soil | MRREDLMSSDLLSEIVLLGSVALMVVTLLLIVVAAFTQPTARMAGM |
| Ga0224572_10922152 | 3300024225 | Rhizosphere | MLREDLMKPDLFSEIVLLGSAALIVVALLLIVVAAFTQPAALA |
| Ga0209804_10009093 | 3300026335 | Soil | MHPEELMKPDLFSEIMLLGIGELIFVALLLIVVAALTRS |
| Ga0209010_1000007151 | 3300027370 | Forest Soil | MSREDLMKPDLLSEIVLLGSAAVIVVVLLLIVVAALTQPTALA |
| Ga0209219_11145232 | 3300027565 | Forest Soil | MKPDLLSEIVLLGSAALLVAGLLLIVAAALIQPAALA |
| Ga0209116_10343501 | 3300027590 | Forest Soil | RGKTEMNRKDLMKPDLLSQIVPLGSAAVMVFVLLLILVAALTQATAPA |
| Ga0208324_10191093 | 3300027604 | Peatlands Soil | MPREDLMKPDLFSEIVLLGSAALIVVALLLIVVAAFTQPAALA |
| Ga0208827_11748242 | 3300027641 | Peatlands Soil | MRREDLMSPDLLSEIVLLGSAALIVVTWLLIVVAALTHAAVLA |
| Ga0209736_10115192 | 3300027660 | Forest Soil | MRQEDLMSPDLLSEIVLLGSAALLVVGLLLIVAAALTQPVALA |
| Ga0209248_100021482 | 3300027729 | Bog Forest Soil | MSREDLMKPDLLSEIVLLGSAAVMVVVLLLIVVAALTQPIALA |
| Ga0209772_102158641 | 3300027768 | Bog Forest Soil | MSREDLMKPDLLSEIVLLGSAAVMVVVLLLIVVAALTQPI |
| Ga0209517_102868693 | 3300027854 | Peatlands Soil | MRREDLMSPDLLSKIVLLGSVALMVVALLLIVVAALTQPTALA |
| Ga0209517_105239732 | 3300027854 | Peatlands Soil | MKPDLFSEIVLLGSAALIVVALLLIVVAAFTQPAALA |
| Ga0209517_106373271 | 3300027854 | Peatlands Soil | MRREDLMSPDLLSEIVLLGSVALMVVALLLIVVAALTQPAALA |
| Ga0209693_100067772 | 3300027855 | Soil | MLRGDLMNPDLFSEIVLLGSAALIVVAFLLIVVAAFTQPAALA |
| Ga0209693_104478151 | 3300027855 | Soil | MRQQDLMSPDLLSEIVLLGSAALLVVGLLLIVAAALTQPVALA |
| Ga0209380_100199724 | 3300027889 | Soil | MNRKDLMKPDLLSQIVPLGSAAVMVFVLLLILVAALTQATAPA |
| Ga0209380_103158992 | 3300027889 | Soil | MNPDLFSEIVLLGSAALIVVAFLLIVVAAFTQPAALA |
| Ga0209624_103874522 | 3300027895 | Forest Soil | MRREDLMSPDLLSEIVLLGSVALMVVTLLLIVVAAFTQPTAHMAGM |
| Ga0265354_10046643 | 3300028016 | Rhizosphere | MLREDLMNPDLFSEIVLLGSAALVVVALLLIVAAAFAQPAALV |
| Ga0265349_10277872 | 3300028037 | Soil | DLMNPDLFSEIVLLGSAALVVVAWLLIVVAAFAQPAALA |
| Ga0209526_108326632 | 3300028047 | Forest Soil | MRREDLMSPDLLSELVLLGSAAVIVGALLLIGAVT |
| Ga0308309_100047984 | 3300028906 | Soil | MSPDLLSEIVLLGSVGLMVVALLFTVVAALAQPSALA |
| Ga0311339_110513561 | 3300029999 | Palsa | FWRQGKTEMNRKDLMKPDLLSQIVPLGSAAVMVFVLLLILVAALTQATAPA |
| Ga0265753_10517842 | 3300030862 | Soil | MLREDLMKPDLLSEIVLLGSAALIIVVLLLIVAAAFTQPAALA |
| Ga0073994_100219402 | 3300030991 | Soil | MRQQDLMNPDLLSEVVLVGSAALLVVGLLLVVLAALTQPAALA |
| Ga0170824_1123899261 | 3300031231 | Forest Soil | MHREDLMNPDLLSEIVLLGSAAVIVVALLLIVVAALTQPTALA |
| Ga0170820_113528961 | 3300031446 | Forest Soil | MHREDLMNPDLLSEIVLLGSAAVIVVALLLIVVAALTPPTALA |
| Ga0310686_1118270342 | 3300031708 | Soil | MNPDLFGEIVLLGRAALIVVAMLLVVVAAFTQPAALA |
| Ga0310686_1154329402 | 3300031708 | Soil | MLREDLMNPDLLSEIVLLGSAALIVLALLLIVVAVFTHPAALA |
| Ga0307476_100050168 | 3300031715 | Hardwood Forest Soil | MRRDDLMSPDLLSEIVLLGSGALMVVALLLTVAAVLTQPAALA |
| Ga0307474_103979551 | 3300031718 | Hardwood Forest Soil | MRREDLMSPDLLSEIVLLGSVALMVAALLLIAVAAVTQSAALA |
| Ga0307479_105551962 | 3300031962 | Hardwood Forest Soil | MHREDLMQPDLLSEIVLVGSVALMVVALALIVVAAFTQPTAPA |
| Ga0307479_105885652 | 3300031962 | Hardwood Forest Soil | MRHEDLMNPDLLSEIVLLGSAALIAVTLLLIVVAALTQPAALA |
| Ga0311301_103588582 | 3300032160 | Peatlands Soil | MRREDLMQPDLLSEIVLLGSAALIVVALLLIAVAAFTQPTALA |
| ⦗Top⦘ |