| Basic Information | |
|---|---|
| Family ID | F057526 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 136 |
| Average Sequence Length | 44 residues |
| Representative Sequence | GTKVVFRADRYTGVRVNSGGPEIKVENLNGDIRILENHE |
| Number of Associated Samples | 122 |
| Number of Associated Scaffolds | 136 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 87.50 % |
| Associated GOLD sequencing projects | 115 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.31 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.588 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (18.382 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.824 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (61.765 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 25.37% Coil/Unstructured: 74.63% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 136 Family Scaffolds |
|---|---|---|
| PF13345 | Obsolete Pfam Family | 6.62 |
| PF13349 | DUF4097 | 5.15 |
| PF08241 | Methyltransf_11 | 2.21 |
| PF08541 | ACP_syn_III_C | 2.21 |
| PF04993 | TfoX_N | 1.47 |
| PF11453 | DUF2950 | 1.47 |
| PF01791 | DeoC | 0.74 |
| PF03781 | FGE-sulfatase | 0.74 |
| PF01850 | PIN | 0.74 |
| PF07228 | SpoIIE | 0.74 |
| PF08281 | Sigma70_r4_2 | 0.74 |
| PF08545 | ACP_syn_III | 0.74 |
| PF00557 | Peptidase_M24 | 0.74 |
| PF13620 | CarboxypepD_reg | 0.74 |
| PF01139 | RtcB | 0.74 |
| PF04030 | ALO | 0.74 |
| PF04255 | DUF433 | 0.74 |
| COG ID | Name | Functional Category | % Frequency in 136 Family Scaffolds |
|---|---|---|---|
| COG3070 | Transcriptional regulator of competence genes, TfoX/Sxy family | Transcription [K] | 1.47 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.74 |
| COG1262 | Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain | Posttranslational modification, protein turnover, chaperones [O] | 0.74 |
| COG1690 | RNA-splicing ligase RtcB, repairs tRNA damage | Translation, ribosomal structure and biogenesis [J] | 0.74 |
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.74 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.59 % |
| Unclassified | root | N/A | 4.41 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000156|NODE_c0544001 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1220 | Open in IMG/M |
| 3300001471|JGI12712J15308_10135041 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 634 | Open in IMG/M |
| 3300002557|JGI25381J37097_1063418 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 593 | Open in IMG/M |
| 3300003350|JGI26347J50199_1041443 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300005166|Ga0066674_10220223 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 903 | Open in IMG/M |
| 3300005179|Ga0066684_10047700 | All Organisms → cellular organisms → Bacteria | 2438 | Open in IMG/M |
| 3300005439|Ga0070711_100395377 | All Organisms → cellular organisms → Bacteria | 1121 | Open in IMG/M |
| 3300005446|Ga0066686_10470998 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 857 | Open in IMG/M |
| 3300005458|Ga0070681_10534952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1085 | Open in IMG/M |
| 3300005586|Ga0066691_10012985 | All Organisms → cellular organisms → Bacteria | 3945 | Open in IMG/M |
| 3300005591|Ga0070761_10507065 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 745 | Open in IMG/M |
| 3300005602|Ga0070762_11324781 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300005610|Ga0070763_10261891 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
| 3300005712|Ga0070764_10636933 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 653 | Open in IMG/M |
| 3300005764|Ga0066903_104004969 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 790 | Open in IMG/M |
| 3300006028|Ga0070717_10114848 | All Organisms → cellular organisms → Bacteria | 2301 | Open in IMG/M |
| 3300006046|Ga0066652_100532956 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1096 | Open in IMG/M |
| 3300006176|Ga0070765_101011494 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 786 | Open in IMG/M |
| 3300006755|Ga0079222_11866341 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300006796|Ga0066665_11277980 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae | 562 | Open in IMG/M |
| 3300006800|Ga0066660_11545925 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300006804|Ga0079221_11204658 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300006806|Ga0079220_10391791 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300006806|Ga0079220_10479930 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 842 | Open in IMG/M |
| 3300006854|Ga0075425_100810320 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1073 | Open in IMG/M |
| 3300007076|Ga0075435_102021362 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300007255|Ga0099791_10514904 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
| 3300009090|Ga0099827_11574413 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300010047|Ga0126382_10111950 | All Organisms → cellular organisms → Bacteria | 1789 | Open in IMG/M |
| 3300010048|Ga0126373_10749809 | Not Available | 1037 | Open in IMG/M |
| 3300010303|Ga0134082_10367514 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 611 | Open in IMG/M |
| 3300010320|Ga0134109_10050214 | All Organisms → cellular organisms → Bacteria | 1379 | Open in IMG/M |
| 3300010321|Ga0134067_10442592 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300010336|Ga0134071_10096128 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1402 | Open in IMG/M |
| 3300010360|Ga0126372_13332822 | Not Available | 500 | Open in IMG/M |
| 3300010361|Ga0126378_10920004 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 981 | Open in IMG/M |
| 3300010361|Ga0126378_11300425 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 822 | Open in IMG/M |
| 3300010362|Ga0126377_11976096 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 659 | Open in IMG/M |
| 3300010376|Ga0126381_100460408 | All Organisms → cellular organisms → Bacteria | 1786 | Open in IMG/M |
| 3300010376|Ga0126381_101791156 | Not Available | 886 | Open in IMG/M |
| 3300010379|Ga0136449_102416754 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 757 | Open in IMG/M |
| 3300010397|Ga0134124_10058700 | All Organisms → cellular organisms → Bacteria | 3252 | Open in IMG/M |
| 3300010398|Ga0126383_10722633 | Not Available | 1075 | Open in IMG/M |
| 3300011120|Ga0150983_16085127 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1115 | Open in IMG/M |
| 3300011269|Ga0137392_10344771 | All Organisms → cellular organisms → Bacteria | 1234 | Open in IMG/M |
| 3300011270|Ga0137391_10406326 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1163 | Open in IMG/M |
| 3300012202|Ga0137363_10030744 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3707 | Open in IMG/M |
| 3300012203|Ga0137399_10074191 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2560 | Open in IMG/M |
| 3300012205|Ga0137362_10966480 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 726 | Open in IMG/M |
| 3300012207|Ga0137381_10088881 | All Organisms → cellular organisms → Bacteria | 2604 | Open in IMG/M |
| 3300012285|Ga0137370_10364160 | Not Available | 871 | Open in IMG/M |
| 3300012362|Ga0137361_11760813 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300012469|Ga0150984_111157557 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1438 | Open in IMG/M |
| 3300012685|Ga0137397_10232984 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1371 | Open in IMG/M |
| 3300012918|Ga0137396_10158874 | All Organisms → cellular organisms → Bacteria | 1650 | Open in IMG/M |
| 3300012925|Ga0137419_10093550 | All Organisms → cellular organisms → Bacteria | 2064 | Open in IMG/M |
| 3300014157|Ga0134078_10358929 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
| 3300014166|Ga0134079_10314599 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 700 | Open in IMG/M |
| 3300014201|Ga0181537_10946039 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 583 | Open in IMG/M |
| 3300015052|Ga0137411_1261127 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300015357|Ga0134072_10169680 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 733 | Open in IMG/M |
| 3300016294|Ga0182041_10709101 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 893 | Open in IMG/M |
| 3300016341|Ga0182035_11450408 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
| 3300016404|Ga0182037_10897285 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 768 | Open in IMG/M |
| 3300016445|Ga0182038_10411027 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1137 | Open in IMG/M |
| 3300018085|Ga0187772_11002562 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
| 3300020199|Ga0179592_10441401 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| 3300020579|Ga0210407_10266993 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 1334 | Open in IMG/M |
| 3300020583|Ga0210401_11447297 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
| 3300021168|Ga0210406_10112283 | All Organisms → cellular organisms → Bacteria | 2309 | Open in IMG/M |
| 3300021168|Ga0210406_10366328 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1160 | Open in IMG/M |
| 3300021170|Ga0210400_10873214 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 735 | Open in IMG/M |
| 3300021178|Ga0210408_10678567 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 812 | Open in IMG/M |
| 3300021180|Ga0210396_11589653 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300021402|Ga0210385_10963616 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
| 3300021402|Ga0210385_11424369 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300021404|Ga0210389_10065511 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2785 | Open in IMG/M |
| 3300021405|Ga0210387_10103852 | All Organisms → cellular organisms → Bacteria | 2380 | Open in IMG/M |
| 3300021406|Ga0210386_11711979 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300021420|Ga0210394_11716562 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300021474|Ga0210390_11444818 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300021478|Ga0210402_11258029 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
| 3300021479|Ga0210410_11655580 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300021560|Ga0126371_12801713 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300022721|Ga0242666_1021887 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1206 | Open in IMG/M |
| 3300024283|Ga0247670_1098637 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300025912|Ga0207707_10462374 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1085 | Open in IMG/M |
| 3300026221|Ga0209848_1021766 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1247 | Open in IMG/M |
| 3300026296|Ga0209235_1254946 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300026312|Ga0209153_1294508 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300026315|Ga0209686_1135966 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 783 | Open in IMG/M |
| 3300026323|Ga0209472_1006698 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6066 | Open in IMG/M |
| 3300026333|Ga0209158_1196031 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 709 | Open in IMG/M |
| 3300026334|Ga0209377_1220763 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 625 | Open in IMG/M |
| 3300026335|Ga0209804_1111754 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1247 | Open in IMG/M |
| 3300026508|Ga0257161_1102997 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
| 3300026530|Ga0209807_1105457 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1205 | Open in IMG/M |
| 3300026557|Ga0179587_10235795 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1168 | Open in IMG/M |
| 3300027671|Ga0209588_1127672 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 812 | Open in IMG/M |
| 3300027867|Ga0209167_10835843 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300027879|Ga0209169_10456561 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 671 | Open in IMG/M |
| 3300027884|Ga0209275_10023366 | All Organisms → cellular organisms → Bacteria | 2788 | Open in IMG/M |
| 3300027884|Ga0209275_10103739 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1459 | Open in IMG/M |
| 3300028577|Ga0265318_10233393 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 672 | Open in IMG/M |
| 3300029636|Ga0222749_10405485 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 723 | Open in IMG/M |
| 3300031128|Ga0170823_16002151 | Not Available | 673 | Open in IMG/M |
| 3300031247|Ga0265340_10402902 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300031573|Ga0310915_10662524 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 738 | Open in IMG/M |
| 3300031708|Ga0310686_117577451 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 832 | Open in IMG/M |
| 3300031715|Ga0307476_11178826 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
| 3300031718|Ga0307474_10579735 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 883 | Open in IMG/M |
| 3300031718|Ga0307474_11499251 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300031720|Ga0307469_10549735 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1022 | Open in IMG/M |
| 3300031720|Ga0307469_11089812 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 750 | Open in IMG/M |
| 3300031753|Ga0307477_10511455 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 815 | Open in IMG/M |
| 3300031754|Ga0307475_10631699 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 856 | Open in IMG/M |
| 3300031754|Ga0307475_10726254 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 791 | Open in IMG/M |
| 3300031780|Ga0318508_1195529 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300031820|Ga0307473_10070795 | All Organisms → cellular organisms → Bacteria | 1748 | Open in IMG/M |
| 3300031823|Ga0307478_10024733 | All Organisms → cellular organisms → Bacteria | 4274 | Open in IMG/M |
| 3300031823|Ga0307478_10083851 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2438 | Open in IMG/M |
| 3300031823|Ga0307478_11096576 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 664 | Open in IMG/M |
| 3300031890|Ga0306925_10903753 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 908 | Open in IMG/M |
| 3300031946|Ga0310910_10677553 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 816 | Open in IMG/M |
| 3300031954|Ga0306926_10052611 | All Organisms → cellular organisms → Bacteria | 4877 | Open in IMG/M |
| 3300031954|Ga0306926_13033082 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300031962|Ga0307479_11108771 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 757 | Open in IMG/M |
| 3300031962|Ga0307479_11467568 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 640 | Open in IMG/M |
| 3300031962|Ga0307479_11787667 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300032059|Ga0318533_10321319 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1125 | Open in IMG/M |
| 3300032068|Ga0318553_10152456 | All Organisms → cellular organisms → Bacteria | 1197 | Open in IMG/M |
| 3300032076|Ga0306924_11602885 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 686 | Open in IMG/M |
| 3300032261|Ga0306920_103819729 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
| 3300032954|Ga0335083_10969303 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 671 | Open in IMG/M |
| 3300033158|Ga0335077_10046599 | All Organisms → cellular organisms → Bacteria | 5298 | Open in IMG/M |
| 3300033480|Ga0316620_10325369 | All Organisms → cellular organisms → Bacteria | 1358 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.38% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.50% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 11.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.56% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.62% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.88% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.15% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.94% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.21% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.47% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.47% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.47% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.47% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.47% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.47% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.74% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.74% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.74% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.74% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.74% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.74% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.74% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.74% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.74% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.74% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.74% |
| Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.74% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300002557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm | Environmental | Open in IMG/M |
| 3300003350 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022721 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024283 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11 | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026221 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-062 (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Host-Associated | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| NODE_05440011 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | PVSAEHRGNKFVFRTDRFTGGRVGNGGPEIKAENLNGDIRVLERHE* |
| JGI12712J15308_101350411 | 3300001471 | Forest Soil | APTREEHGGKVVFRADRFTAARISNGGPEIKIENLNGDIRILENHE* |
| JGI25381J37097_10634182 | 3300002557 | Grasslands Soil | EEHHGAKVVFHADRYTGVRVNSGGPEIKVENLNGEIRILENHE* |
| JGI26347J50199_10414432 | 3300003350 | Bog Forest Soil | HAIEAEHKGGKVVYRADRYTSARVNAGGPEIQIENLNGDIRILENHE* |
| Ga0066674_102202232 | 3300005166 | Soil | HHGAKVVFHADRYTSVRVNSGGPEIKVENLNGEIRILENHE* |
| Ga0066684_100477004 | 3300005179 | Soil | QEEHHGAKVVFHADRYTGVRINSGGPEIKVENLNGDIRILENHE* |
| Ga0070711_1003953771 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | GTKFVFRSDRFTGGRVGSGGPEIKAENLNGDIRILERHE* |
| Ga0066686_104709982 | 3300005446 | Soil | RAIQEEHHGAKVVFHADRYTGVRVNSGGPEIKVENLNGEIRILENHE* |
| Ga0070681_105349521 | 3300005458 | Corn Rhizosphere | GGKVVYRADRFTGARVNAGGPEIQIENLNGDIRILENHE* |
| Ga0066691_100129857 | 3300005586 | Soil | IQEEHHGAKVVFHADRYTGVRVNSGGPEIKVENLNGEIRILENHE* |
| Ga0070761_105070652 | 3300005591 | Soil | EHHGGKVVFHADRFTAARVSNGGPEIKIENLNGDIRILENHE* |
| Ga0070762_113247812 | 3300005602 | Soil | TTAPLHAPQEEHRGNKVVYHTDRFTAGRVSAGGPEIKIENLNGDIRILENHE* |
| Ga0070763_102618912 | 3300005610 | Soil | QEEHHGGKVVFRADRFTAARVSGGGPEIKIENLNGDIRILENHE* |
| Ga0070764_106369332 | 3300005712 | Soil | GGKVVFRADRFTAARISNGGPEIKIENLNGDIRILENHE* |
| Ga0066903_1040049691 | 3300005764 | Tropical Forest Soil | RAVQEEHRGAKVVFHADRYTGVRVSSGGPEIKVENLNGDIRILENHE* |
| Ga0070717_101148483 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | FVFRSDRFTGGRVGSGGPEIKAENLNGDIRILERHE* |
| Ga0066652_1005329562 | 3300006046 | Soil | KVVFHADRYTGVRVNSGGPEIKVENLNGEIRILENHE* |
| Ga0070765_1010114942 | 3300006176 | Soil | MPLHAVQEEHHGGKVVYHADRFTAARVSAGGPEIKIENLNGDIRILENHE* |
| Ga0079222_118663411 | 3300006755 | Agricultural Soil | NGKLILRADRYTGGRVGNGGPEIRVENFNGDIRVLERHD* |
| Ga0066665_112779802 | 3300006796 | Soil | PVTALPVHALLEEHHGAKVIFRADRYTGVRVNSGGPEIQVENLNGDIRILENHE* |
| Ga0066660_115459252 | 3300006800 | Soil | RPPEEQRTSGKFVFRADRFTGGRVAAGGSEIKIETLNGDIHIRERHD* |
| Ga0079221_112046581 | 3300006804 | Agricultural Soil | KFVFRSDRFTGGRIGSGGPEIKAENLNGDIRILERHE* |
| Ga0079220_103917912 | 3300006806 | Agricultural Soil | PVHSIQEEKRGGRVVFRADRFTSARVNAGGPEIQIENLNGDIRILENHE* |
| Ga0079220_104799301 | 3300006806 | Agricultural Soil | QGAKVVFHADRYSGVRVSSGGPEIKVENLNGEIRILENHE* |
| Ga0075425_1008103203 | 3300006854 | Populus Rhizosphere | GAKVVFHADRYTGVRVNSGGPEIKVENLNGEIRILANHE* |
| Ga0075435_1020213621 | 3300007076 | Populus Rhizosphere | EEHHGAKVTFHADRYTGVRVGSGGPEIKVENLNGDIRILEHHE* |
| Ga0099791_105149041 | 3300007255 | Vadose Zone Soil | HHGSKVIFRADRYTGARINAGGPQIEVQNLNGDIRILENHE* |
| Ga0099827_115744131 | 3300009090 | Vadose Zone Soil | KVVFRADRYTGARIASGGPQIKVENLNGDIRILENHE* |
| Ga0126382_101119503 | 3300010047 | Tropical Forest Soil | GGKFVFRADRYTGVRVSSGGPEIKVENLNGDIRILENHE* |
| Ga0126373_107498091 | 3300010048 | Tropical Forest Soil | HDGKFVFRTSRFTGGRVGSGGLEIKADNLNGDIRVLERHE* |
| Ga0134082_103675142 | 3300010303 | Grasslands Soil | IQEEHHGAKVVFHADRYTSVRVNSGGPEIKVENLNGEIRILENHE* |
| Ga0134109_100502143 | 3300010320 | Grasslands Soil | GAKVVYRADRYTGVRIGTGGPEIKVENLNGDIRILENHE* |
| Ga0134067_104425921 | 3300010321 | Grasslands Soil | IQEEHHGAKVIFRADRFAGARVSSGGPQIKVENLNGDIRILENHE* |
| Ga0134071_100961281 | 3300010336 | Grasslands Soil | HHGAKVVFHADRYTGVRVNSGGPEIKVENLNGEIRILENHE* |
| Ga0126372_133328221 | 3300010360 | Tropical Forest Soil | KFIYKSDRYTGLRVGAGGLEIKADNLNGDIRVLERQ* |
| Ga0126378_109200041 | 3300010361 | Tropical Forest Soil | ALPVHAIQEEHHGTKVVFRADRYTGVRVNSGGPEIKVENLNGDIRILENHE* |
| Ga0126378_113004251 | 3300010361 | Tropical Forest Soil | KFIYHSDRYTGGRVGAGGMEIKADNLNGDIRVLERHE* |
| Ga0126377_119760962 | 3300010362 | Tropical Forest Soil | HALQEDHRGGKTIFRADRFTGARVNAGGPEIKVENLNGDIRILENHE* |
| Ga0126381_1004604083 | 3300010376 | Tropical Forest Soil | PVAALPVRPMQEEHHGAKVVYRADRYTGVRIGTGGPEIKVQNLNGDIRILENHE* |
| Ga0126381_1017911561 | 3300010376 | Tropical Forest Soil | SGKFVFRADRFTGGRVAAGGPEIKIETLNGDIHIRERHD* |
| Ga0136449_1024167542 | 3300010379 | Peatlands Soil | VVFRADRYTGGRIGSGGPEIKVANLNGDIRILENHV* |
| Ga0134124_100587006 | 3300010397 | Terrestrial Soil | VFRSDRYTGGRIGSGGPEIKAENLNGDIRVLERHE* |
| Ga0126383_107226332 | 3300010398 | Tropical Forest Soil | IYHSDRYTGGRVGAGGMEIKADNLNGDIRVLERHE* |
| Ga0150983_160851271 | 3300011120 | Forest Soil | MKEEHRSGKVIFRADRYTGARVNSGGPEIKVENLNGDIRILENHE* |
| Ga0137392_103447711 | 3300011269 | Vadose Zone Soil | IFRADRYTGARINAGGPQIKVENLNGDIRILENHE* |
| Ga0137391_104063262 | 3300011270 | Vadose Zone Soil | MQQERHGSKVVFRADRYTGARIASGGPQIKVENLNGDIRILENHE* |
| Ga0137363_100307441 | 3300012202 | Vadose Zone Soil | VHAIQEERRGGKMVYRADRFTGARVNGGGPEIQIENLNGDIRILENHE* |
| Ga0137399_100741911 | 3300012203 | Vadose Zone Soil | EEHHGSKVIFRADRYTGARINAGGPQIKVENLNGDIRILEDHE* |
| Ga0137362_109664802 | 3300012205 | Vadose Zone Soil | VQGMQEERHGNKVIFRADRYTGARINAGGPQIKVGNLNGDIRILENHE* |
| Ga0137381_100888811 | 3300012207 | Vadose Zone Soil | HGAKVVFHADRYTGVRVNSGGPEIKVENLNGEIRILENHE* |
| Ga0137370_103641601 | 3300012285 | Vadose Zone Soil | FVFRSDRFTNARVGVGGPEIMIDTLNGDIRVLQRHAAL* |
| Ga0137361_117608132 | 3300012362 | Vadose Zone Soil | PVQGMQEEHHGSKVIFRADRYTGARINAGGPQIKIENLNGDIRILENHE* |
| Ga0150984_1111575573 | 3300012469 | Avena Fatua Rhizosphere | ALPAHALQEDHRDGKTIFRADRFTGARVNSGGPEIKIENLNGDIRILENHE* |
| Ga0137397_102329841 | 3300012685 | Vadose Zone Soil | VRAIQEEHHGAKVVFHADRYTGVRVNSGGPEIKVENLNGEIRILENHE* |
| Ga0137396_101588743 | 3300012918 | Vadose Zone Soil | QEEHHGSKVIFRADRYTGARINAGGPQIKVENLNGDIRILENHE* |
| Ga0137419_100935505 | 3300012925 | Vadose Zone Soil | KVIFRADRYTGARINAGGPQIKVENLNGDIRILENHE* |
| Ga0134078_103589292 | 3300014157 | Grasslands Soil | VFHADRYTGVRVNSGGPEIKVENLNGEIRILENHE* |
| Ga0134079_103145991 | 3300014166 | Grasslands Soil | KVVFHADRYTGVRINSGGPEIKVENLNGDIRILENHE* |
| Ga0181537_109460391 | 3300014201 | Bog | HRGGKVVFHADRFTAARVSSGGPEIKIENLNGDIRILENHE* |
| Ga0137411_12611271 | 3300015052 | Vadose Zone Soil | DSAAGAGNVKEEHHGAKVIFRADRYTGARVNAGGPQIKVENLNGDIRILENHE* |
| Ga0134072_101696802 | 3300015357 | Grasslands Soil | PVRAVQEEHHGAKVVFHADRYTGVRINSGGPEIKVENLNGDIRILENHE* |
| Ga0182041_107091011 | 3300016294 | Soil | ALPVRAIQEEHHGAKVVFHADRYTSVRVNSGGPEIKVENLNGEIRILENHE |
| Ga0182035_114504081 | 3300016341 | Soil | DGKLVFRTDGFTGGRVGAGGPEIKVENLNGDIRVLERHA |
| Ga0182037_108972851 | 3300016404 | Soil | IEEEHHGAKVVFRADRYTGVRVNSGGPEIKVENLNGDIRILENHE |
| Ga0182038_104110271 | 3300016445 | Soil | PQRAIQEEHHGAKVIFRADRYTGARVNSGGPEIKIENLNGDICILENHE |
| Ga0187772_110025621 | 3300018085 | Tropical Peatland | VIYRADRYTEARVNAGGPQIQVENLNGDIRILENHE |
| Ga0179592_104414012 | 3300020199 | Vadose Zone Soil | LPVQGMQEEHHGAKVVFRADRYTGARINAGGPQIKVENLNGDIRILESHE |
| Ga0210407_102669931 | 3300020579 | Soil | GGKMVYRADRFTEARVNSGGPEIQIENLNGDIRILENHE |
| Ga0210401_114472972 | 3300020583 | Soil | QGMQEERHGTKVIFRADRYTGARINAGGPQIKVENLNGDIRILENHE |
| Ga0210406_101122835 | 3300021168 | Soil | KVVYRADRFTGARVNAGGPEIQVENLNGDIRILENHE |
| Ga0210406_103663281 | 3300021168 | Soil | HHGSKVIFRADRYTGARINAGGPQIKVENLNGDIRILENHD |
| Ga0210400_108732142 | 3300021170 | Soil | DFPVTALPAQGMQEEHHGSKVIFRADRYTGARIHSGGPQIKVENLNGDIRILENHE |
| Ga0210408_106785671 | 3300021178 | Soil | AIQEEHHGAKVVFHADRYTGVRVNSGGPEIKVETLNGEIRILENHE |
| Ga0210396_115896531 | 3300021180 | Soil | EHHGGKVVYHADRFTAARVSAGGPEIKIENLNGDIRILENHE |
| Ga0210385_109636162 | 3300021402 | Soil | GKVVFRADRFTAARISNGGPEIKIENLNGDIRILENHE |
| Ga0210385_114243691 | 3300021402 | Soil | VTTMPLHAVQEEHHGGKVVYHADRFTAARVSAGGPEIKIENLNGDIRILENHE |
| Ga0210389_100655111 | 3300021404 | Soil | QEERRGGKMVYRADRFTGARVNGGGPEIQIENLNGDIRILENND |
| Ga0210387_101038524 | 3300021405 | Soil | MVYRADRFTGARVNAGGPEIQIENLNGDIRILENHE |
| Ga0210386_117119792 | 3300021406 | Soil | VVFRADRFTAARISNGGPEIKIENLNGDIRILENHE |
| Ga0210394_117165622 | 3300021420 | Soil | IEAEHKGGKVVYRADRYTSARVNAGGPEIQIENLNGDIRILENHE |
| Ga0210390_114448181 | 3300021474 | Soil | VTALPLHPIQSEHKGAKVVYRADRFTEARVNAGGPEIQIENLNGDIRILENHE |
| Ga0210402_112580291 | 3300021478 | Soil | VVYRADRFTEARVNSGGPEIQIENLNGDIRILENHE |
| Ga0210410_116555802 | 3300021479 | Soil | RGGKVVYRANRFTEARVNSGGPEIQIENLNGDIRILENHE |
| Ga0126371_128017131 | 3300021560 | Tropical Forest Soil | VVFRADRYTGARVSSGGPEIRIENLNGDIRILENHE |
| Ga0242666_10218873 | 3300022721 | Soil | SPVHAIQEERRGGKMVYRANRFAEARVNSGGPEIQIENLNGDIRILENHE |
| Ga0247670_10986372 | 3300024283 | Soil | HAIQQERRGGKVVYRADRFTGARVNAGGPEIQIENLNGDIRILENHE |
| Ga0207707_104623742 | 3300025912 | Corn Rhizosphere | GGKVVYRADRFTGARVNAGGPEIQIENLNGDIRILENHE |
| Ga0209848_10217662 | 3300026221 | Permafrost Soil | NGKFVFRSDRFTGGRIGSGGPEIKAENLNGDIRILERHN |
| Ga0209235_12549462 | 3300026296 | Grasslands Soil | IQEEHHGAKVVFHADRYTGVRVNSGGPEIKVENLNGEIRILENHE |
| Ga0209153_12945081 | 3300026312 | Soil | QEEHHGAKVVFHADRYTGVRINSGGPEIKVENLNGDIRILENHE |
| Ga0209686_11359661 | 3300026315 | Soil | VRAMQEEHHGAKVVYRADRYTGVRIGTGGPEIKVENLNGDIRILENHE |
| Ga0209472_100669810 | 3300026323 | Soil | KVVFHADRYTNVRVNSGGPEIKVENLNGEIRILENHE |
| Ga0209158_11960312 | 3300026333 | Soil | AIQEEHHAAKVVFHADRYTGVRVNSGGPEIKVENLNGEIRILKS |
| Ga0209377_12207632 | 3300026334 | Soil | EKRGNKFVFRADRYTGVRIGSGGPEIRAENLNGDIRVLERHE |
| Ga0209804_11117541 | 3300026335 | Soil | ALPVRAIQEEHHAAKVVFHADRYTGVRVNSGGPEIKVENLNGEIRILENHE |
| Ga0257161_11029972 | 3300026508 | Soil | TALPVRAIQEEHHGAKVVFHADRYTGVRVNSGGPEIKVETLNGEIRILENHE |
| Ga0209807_11054572 | 3300026530 | Soil | AKVVFHADRYTGVRVNSGGPEIKVENLNGEIGILENHE |
| Ga0179587_102357951 | 3300026557 | Vadose Zone Soil | HGTKFVFRSDRFTGGRIGSGGPEIKAENLNGDIRVLERHE |
| Ga0209588_11276722 | 3300027671 | Vadose Zone Soil | VIFRADRYTGARINAGGPQIKVENLNGDIRILENHE |
| Ga0209167_108358431 | 3300027867 | Surface Soil | TLPVHGIQEERRGGKVVYRADRFTGARVNAGGPEIQIENLNGDIRILENHE |
| Ga0209169_104565612 | 3300027879 | Soil | EEHGGKVVFRADRFTAARISNGGPEIKIENLNGDIRILENHE |
| Ga0209275_100233664 | 3300027884 | Soil | HAIQEERRGGKMVYRADRFTAARVNAGGPEIQIENLNGDIRILENHE |
| Ga0209275_101037392 | 3300027884 | Soil | IQEERRGGKMVYRADRFTGARVNAGGPEIQVENLNGDIRILENHE |
| Ga0265318_102333931 | 3300028577 | Rhizosphere | FPVTALPLHPIQSEHKGAKVVYRADRFTEARVNAGGPEIQIENLNGDIRILENHE |
| Ga0222749_104054851 | 3300029636 | Soil | MPLHAVQEEHHGGKVVYHADRFTAARVSAGGPEIKIENLNGDIRILENHE |
| Ga0170823_160021512 | 3300031128 | Forest Soil | SLPVRSMKEEHEGTRVIFRADRSSGARVGSGGPEISAENLNGNIRILENHE |
| Ga0265340_104029022 | 3300031247 | Rhizosphere | VTTLPLHGIQEERRGGKVVYRADRFTGARVNAGGPEIQIENLNGDIRILENHE |
| Ga0310915_106625242 | 3300031573 | Soil | GAKVIFRADRYTGARVNSGGPEIKIENLNGDIRILENHE |
| Ga0310686_1175774512 | 3300031708 | Soil | PVTEERHAGKVVYRSDRFTAARVSAGGPEIKIENLNGDIRILENHE |
| Ga0307476_111788262 | 3300031715 | Hardwood Forest Soil | VVYHADRFTAARVSAGGPEIKIENLNGDIRILENHE |
| Ga0307474_105797351 | 3300031718 | Hardwood Forest Soil | PTKEEHGGKVVFRADRFTAARISNGGPEIKIENLNGDIRILENHE |
| Ga0307474_114992512 | 3300031718 | Hardwood Forest Soil | GRFVFHADRYSGGRVAAGGPEIQVETLNGDIHIRERHD |
| Ga0307469_105497351 | 3300031720 | Hardwood Forest Soil | ALPVRAIQEEHHGAKVVFHADRYTGVRVNSGGPEIKVENLNGEIRILENHE |
| Ga0307469_110898121 | 3300031720 | Hardwood Forest Soil | HAIQEERRGGKMVYRADRFTSARVNAGGPEIQIENLNGDIRILENHE |
| Ga0307477_105114552 | 3300031753 | Hardwood Forest Soil | QGMQEEHHGSKVIFRADRYTGARINAGGPQIKVENLNGDIRILENHE |
| Ga0307475_106316991 | 3300031754 | Hardwood Forest Soil | KVVFHADRYTGVRVNSGGPEIKVENLNGEIRILENHE |
| Ga0307475_107262542 | 3300031754 | Hardwood Forest Soil | GKVVYHADRFTAGRVSAGGPEIKIENLNGDIRILENHE |
| Ga0318508_11955291 | 3300031780 | Soil | HAIQEEHHGTKVVFRADRYTSVRVNSGGPEIKVENLNGDIRILENHE |
| Ga0307473_100707951 | 3300031820 | Hardwood Forest Soil | EEHRGSKVIFRADRYTGARINAGGPQIKVENLNGDIRILENHE |
| Ga0307478_100247336 | 3300031823 | Hardwood Forest Soil | GGKVVYHADRFTAARVSAGGPEIKIENLNGDIRILENHE |
| Ga0307478_100838515 | 3300031823 | Hardwood Forest Soil | GSKVIFRADRYTGARINAGGPQIKVENLNGDIRILENHE |
| Ga0307478_110965761 | 3300031823 | Hardwood Forest Soil | VTTSPVHAIQEERRGGKMVYRADRFTGARVNSGGPEIQIENLNGDIRILENHE |
| Ga0306925_109037531 | 3300031890 | Soil | TALPVRAIQEEHHGGKVVFHADRYTGVRVNSGGPEIRVENLNGEIRILENHE |
| Ga0310910_106775532 | 3300031946 | Soil | LPQRAIQEEHHGAKVIFRADRYTGARVNSGGPEIKIENLNGDICILENHE |
| Ga0306926_100526114 | 3300031954 | Soil | TALPQRAIQEEHHGAKVIFRADRYTGARVNSGGPEIKIENLNGDIRILENHE |
| Ga0306926_130330821 | 3300031954 | Soil | GTKVVFRADRYTGVRVNSGGPEIKVENLNGDIRILENHE |
| Ga0307479_111087711 | 3300031962 | Hardwood Forest Soil | GKVIFRADRYTGARVNSGGPEIKVENLNGDIRILENHD |
| Ga0307479_114675682 | 3300031962 | Hardwood Forest Soil | QEEHHGGKVVYHADRFTAARVSAGGPEIKIENLNGDIRILENHE |
| Ga0307479_117876671 | 3300031962 | Hardwood Forest Soil | IFKADRYTGARVNAGGPQIKVENLNGDIRILENHE |
| Ga0318533_103213192 | 3300032059 | Soil | AIQEEHLGTKVVFRADRYTGVRVNSGGPEIKVENLNGDIRILENHE |
| Ga0318553_101524563 | 3300032068 | Soil | HGAKVVYRADRYTGVRIGTGGPEIKVQNLNGDIRILENHE |
| Ga0306924_116028851 | 3300032076 | Soil | ERRDGKFIYHSDRYTGGRVGAGGMEIKADNLNGDIRVLERHE |
| Ga0306920_1038197292 | 3300032261 | Soil | DFPVTALPVRAIQEEHHGAKVVFHADHYTGVRVNSGGPEIKVENLNGEIRILENHD |
| Ga0335083_109693032 | 3300032954 | Soil | VSEEHKGGKLILRADRSTGARIGSGGPEIKVENLNGDIRILENNE |
| Ga0335077_100465994 | 3300033158 | Soil | REVTPEHRGAKLILRADRTMGVRVGAGGPEIEVENLNGEIRILQSHE |
| Ga0316620_103253693 | 3300033480 | Soil | GGKVVYRADRFTGARVNAGGPEIQIENLNGDIRILENHD |
| ⦗Top⦘ |