| Basic Information | |
|---|---|
| Family ID | F057490 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 136 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MTTPSRNTVGVYDRPHPLRTRKVLVPVLVAVVVAIVYAVWWYLA |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 136 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 61.03 % |
| % of genes near scaffold ends (potentially truncated) | 27.21 % |
| % of genes from short scaffolds (< 2000 bps) | 84.56 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.118 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (10.294 % of family members) |
| Environment Ontology (ENVO) | Unclassified (55.147 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (65.441 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.67% β-sheet: 0.00% Coil/Unstructured: 58.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 136 Family Scaffolds |
|---|---|---|
| PF02852 | Pyr_redox_dim | 41.91 |
| PF07992 | Pyr_redox_2 | 13.24 |
| PF06897 | DUF1269 | 5.88 |
| PF03401 | TctC | 2.94 |
| PF08534 | Redoxin | 2.94 |
| PF08240 | ADH_N | 0.74 |
| PF00005 | ABC_tran | 0.74 |
| PF03358 | FMN_red | 0.74 |
| PF00563 | EAL | 0.74 |
| PF00462 | Glutaredoxin | 0.74 |
| COG ID | Name | Functional Category | % Frequency in 136 Family Scaffolds |
|---|---|---|---|
| COG4803 | Uncharacterized membrane protein | Function unknown [S] | 5.88 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 2.94 |
| COG2200 | EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant) | Signal transduction mechanisms [T] | 0.74 |
| COG3434 | c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains | Signal transduction mechanisms [T] | 0.74 |
| COG4943 | Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains | Signal transduction mechanisms [T] | 0.74 |
| COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 0.74 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.12 % |
| Unclassified | root | N/A | 5.88 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2162886012|MBSR1b_contig_8014482 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1240 | Open in IMG/M |
| 2199352024|deeps__Contig_179088 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2387 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c2082336 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 714 | Open in IMG/M |
| 3300000363|ICChiseqgaiiFebDRAFT_13526320 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300003321|soilH1_10183849 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1131 | Open in IMG/M |
| 3300003324|soilH2_10265359 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1337 | Open in IMG/M |
| 3300003324|soilH2_10403897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium | 1004 | Open in IMG/M |
| 3300004114|Ga0062593_100688710 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 994 | Open in IMG/M |
| 3300004114|Ga0062593_103430329 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300004157|Ga0062590_102881792 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 514 | Open in IMG/M |
| 3300005327|Ga0070658_10031775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4241 | Open in IMG/M |
| 3300005327|Ga0070658_10253557 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1493 | Open in IMG/M |
| 3300005327|Ga0070658_10330736 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1302 | Open in IMG/M |
| 3300005328|Ga0070676_10300000 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1089 | Open in IMG/M |
| 3300005328|Ga0070676_10644570 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 768 | Open in IMG/M |
| 3300005330|Ga0070690_100229933 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1303 | Open in IMG/M |
| 3300005331|Ga0070670_100055773 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3391 | Open in IMG/M |
| 3300005331|Ga0070670_100112421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2347 | Open in IMG/M |
| 3300005335|Ga0070666_10212089 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1364 | Open in IMG/M |
| 3300005335|Ga0070666_10498884 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 882 | Open in IMG/M |
| 3300005338|Ga0068868_101150202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium | 716 | Open in IMG/M |
| 3300005338|Ga0068868_101425785 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 646 | Open in IMG/M |
| 3300005338|Ga0068868_101708985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 593 | Open in IMG/M |
| 3300005338|Ga0068868_101930483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium | 559 | Open in IMG/M |
| 3300005344|Ga0070661_101174623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae | 641 | Open in IMG/M |
| 3300005345|Ga0070692_10761489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium | 657 | Open in IMG/M |
| 3300005364|Ga0070673_100329170 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1351 | Open in IMG/M |
| 3300005366|Ga0070659_100308197 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1322 | Open in IMG/M |
| 3300005366|Ga0070659_100459361 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1081 | Open in IMG/M |
| 3300005435|Ga0070714_100117927 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2358 | Open in IMG/M |
| 3300005439|Ga0070711_100298577 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1280 | Open in IMG/M |
| 3300005457|Ga0070662_101300209 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 626 | Open in IMG/M |
| 3300005458|Ga0070681_11320332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium | 644 | Open in IMG/M |
| 3300005459|Ga0068867_102013142 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 546 | Open in IMG/M |
| 3300005546|Ga0070696_101016468 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 693 | Open in IMG/M |
| 3300005563|Ga0068855_100033885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae | 6092 | Open in IMG/M |
| 3300005618|Ga0068864_100943715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 853 | Open in IMG/M |
| 3300005840|Ga0068870_10447834 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 850 | Open in IMG/M |
| 3300005903|Ga0075279_10024401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium | 895 | Open in IMG/M |
| 3300006196|Ga0075422_10206358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium | 810 | Open in IMG/M |
| 3300006237|Ga0097621_100258054 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1528 | Open in IMG/M |
| 3300006237|Ga0097621_101093483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Bordetella | 748 | Open in IMG/M |
| 3300006755|Ga0079222_10037008 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2149 | Open in IMG/M |
| 3300009177|Ga0105248_12462166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 593 | Open in IMG/M |
| 3300009545|Ga0105237_10805003 | Not Available | 946 | Open in IMG/M |
| 3300010373|Ga0134128_10084352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3624 | Open in IMG/M |
| 3300010400|Ga0134122_10217523 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1594 | Open in IMG/M |
| 3300010401|Ga0134121_11792432 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300012212|Ga0150985_110228533 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1237 | Open in IMG/M |
| 3300012212|Ga0150985_114530505 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1021 | Open in IMG/M |
| 3300012212|Ga0150985_119736932 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1957 | Open in IMG/M |
| 3300012212|Ga0150985_121637557 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1614 | Open in IMG/M |
| 3300012469|Ga0150984_101448899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium | 1201 | Open in IMG/M |
| 3300012469|Ga0150984_104563811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 515 | Open in IMG/M |
| 3300012469|Ga0150984_112487139 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 647 | Open in IMG/M |
| 3300012469|Ga0150984_120814313 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 952 | Open in IMG/M |
| 3300012911|Ga0157301_10099119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium | 853 | Open in IMG/M |
| 3300012955|Ga0164298_11645047 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300012957|Ga0164303_10619559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium | 716 | Open in IMG/M |
| 3300012986|Ga0164304_10083237 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1857 | Open in IMG/M |
| 3300012988|Ga0164306_10333044 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1119 | Open in IMG/M |
| 3300012989|Ga0164305_11038917 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300012989|Ga0164305_11501141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium | 598 | Open in IMG/M |
| 3300013100|Ga0157373_10008739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 7506 | Open in IMG/M |
| 3300013102|Ga0157371_10748736 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 734 | Open in IMG/M |
| 3300013104|Ga0157370_10077890 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3122 | Open in IMG/M |
| 3300013104|Ga0157370_10140922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2246 | Open in IMG/M |
| 3300013104|Ga0157370_10363674 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1333 | Open in IMG/M |
| 3300013105|Ga0157369_10040094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 5115 | Open in IMG/M |
| 3300013105|Ga0157369_11141472 | Not Available | 796 | Open in IMG/M |
| 3300013307|Ga0157372_10194112 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2352 | Open in IMG/M |
| 3300013307|Ga0157372_10350234 | Not Available | 1721 | Open in IMG/M |
| 3300013503|Ga0120127_10027129 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1051 | Open in IMG/M |
| 3300014497|Ga0182008_10102685 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1414 | Open in IMG/M |
| 3300014497|Ga0182008_10260466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium | 897 | Open in IMG/M |
| 3300015077|Ga0173483_10157197 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1009 | Open in IMG/M |
| 3300015200|Ga0173480_10379154 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300015371|Ga0132258_11191678 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1925 | Open in IMG/M |
| 3300015373|Ga0132257_100035591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 5445 | Open in IMG/M |
| 3300020069|Ga0197907_11001315 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1449 | Open in IMG/M |
| 3300020070|Ga0206356_11005726 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 709 | Open in IMG/M |
| 3300020070|Ga0206356_11539623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium | 638 | Open in IMG/M |
| 3300020077|Ga0206351_10778454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium | 1470 | Open in IMG/M |
| 3300020081|Ga0206354_10396421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium | 916 | Open in IMG/M |
| 3300020082|Ga0206353_10109756 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1354 | Open in IMG/M |
| 3300020082|Ga0206353_11631768 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1674 | Open in IMG/M |
| 3300021445|Ga0182009_10237971 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 899 | Open in IMG/M |
| 3300025321|Ga0207656_10024514 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2440 | Open in IMG/M |
| 3300025898|Ga0207692_11199272 | Not Available | 504 | Open in IMG/M |
| 3300025903|Ga0207680_10243177 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1241 | Open in IMG/M |
| 3300025903|Ga0207680_10341784 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
| 3300025903|Ga0207680_10388260 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 985 | Open in IMG/M |
| 3300025911|Ga0207654_10546460 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 822 | Open in IMG/M |
| 3300025920|Ga0207649_10346322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium | 1098 | Open in IMG/M |
| 3300025923|Ga0207681_10850521 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 763 | Open in IMG/M |
| 3300025925|Ga0207650_10104859 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2182 | Open in IMG/M |
| 3300025930|Ga0207701_10154075 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2036 | Open in IMG/M |
| 3300025931|Ga0207644_10312198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium | 1269 | Open in IMG/M |
| 3300025931|Ga0207644_11709055 | Not Available | 527 | Open in IMG/M |
| 3300025932|Ga0207690_10310376 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1237 | Open in IMG/M |
| 3300025933|Ga0207706_10335036 | Not Available | 1316 | Open in IMG/M |
| 3300025933|Ga0207706_10671785 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 886 | Open in IMG/M |
| 3300025941|Ga0207711_10544330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium | 1083 | Open in IMG/M |
| 3300025942|Ga0207689_10210595 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1606 | Open in IMG/M |
| 3300025944|Ga0207661_11901169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 541 | Open in IMG/M |
| 3300025945|Ga0207679_10424320 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1174 | Open in IMG/M |
| 3300025949|Ga0207667_11862285 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300026078|Ga0207702_10151924 | Not Available | 2107 | Open in IMG/M |
| 3300026089|Ga0207648_10492674 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1121 | Open in IMG/M |
| 3300026095|Ga0207676_10919069 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 859 | Open in IMG/M |
| 3300026116|Ga0207674_11448182 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 656 | Open in IMG/M |
| 3300027424|Ga0209984_1050181 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 610 | Open in IMG/M |
| 3300027775|Ga0209177_10170330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium | 754 | Open in IMG/M |
| 3300028379|Ga0268266_11566134 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 634 | Open in IMG/M |
| 3300028587|Ga0247828_10156629 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1147 | Open in IMG/M |
| 3300028597|Ga0247820_10565403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium | 781 | Open in IMG/M |
| 3300028889|Ga0247827_11259958 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300031058|Ga0308189_10177759 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 753 | Open in IMG/M |
| 3300031716|Ga0310813_10549058 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1016 | Open in IMG/M |
| 3300031716|Ga0310813_10805911 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium | 846 | Open in IMG/M |
| 3300031824|Ga0307413_11889824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ardenticatenia → Ardenticatenales → unclassified Ardenticatenales → Ardenticatenales bacterium | 536 | Open in IMG/M |
| 3300031908|Ga0310900_10444432 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 995 | Open in IMG/M |
| 3300031938|Ga0308175_100267814 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1724 | Open in IMG/M |
| 3300031938|Ga0308175_100363223 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1500 | Open in IMG/M |
| 3300031938|Ga0308175_100500432 | Not Available | 1291 | Open in IMG/M |
| 3300031938|Ga0308175_100532300 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1254 | Open in IMG/M |
| 3300031938|Ga0308175_101175867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium | 852 | Open in IMG/M |
| 3300031939|Ga0308174_10046704 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2902 | Open in IMG/M |
| 3300031944|Ga0310884_10494650 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 717 | Open in IMG/M |
| 3300031996|Ga0308176_10474913 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1264 | Open in IMG/M |
| 3300031996|Ga0308176_12470963 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300033412|Ga0310810_10712255 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 930 | Open in IMG/M |
| 3300033475|Ga0310811_10906769 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 794 | Open in IMG/M |
| 3300033480|Ga0316620_10074948 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2448 | Open in IMG/M |
| 3300033486|Ga0316624_10823520 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 826 | Open in IMG/M |
| 3300033513|Ga0316628_100170227 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2578 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 9.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 9.56% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 8.82% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 6.62% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 5.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 5.15% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.68% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.94% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 2.94% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 2.94% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.21% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 2.21% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.47% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.47% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.47% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.47% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.47% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.47% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.47% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.47% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.47% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.47% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.74% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.74% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.74% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.74% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.74% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.74% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.74% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.74% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.74% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005903 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_303 | Environmental | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013503 | Permafrost microbial communities from Nunavut, Canada - A23_5cm_12M | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| MBSR1b_0727.00004950 | 2162886012 | Miscanthus Rhizosphere | MTSPSRNTVGVYDRPHPLRTRKVIVPVLVAVVVTIGYAVFFYLR |
| deeps_03343540 | 2199352024 | Soil | MALPSRSAVGVYDRPHPLRTRKVLIPALVAIVTAMGYGAWFYFR |
| ICChiseqgaiiDRAFT_20823362 | 3300000033 | Soil | MNAPSRKSVGIYDRPHPLRTRKVLIPALVAVAVTAVYAAWWWFAR* |
| ICChiseqgaiiFebDRAFT_135263202 | 3300000363 | Soil | MTSPSPRNTVGVYDRPHPLRTRKVIVPVLVAVVVTIGYAVFFYLR* |
| soilH1_101838492 | 3300003321 | Sugarcane Root And Bulk Soil | VEQRSSRNAVGVYDRPPAWRTRKVLVPVAIFVVVAIAYALYFLL* |
| soilH2_102653592 | 3300003324 | Sugarcane Root And Bulk Soil | VEQRSSRNAVGVYDRPPAWRTRKVLVPVAIFVVVAVAYALYFLL* |
| soilH2_104038972 | 3300003324 | Sugarcane Root And Bulk Soil | VPRTVGIYDRPHPLRTRKVLVPLAVAAVVALVYALWFYLS* |
| Ga0062593_1006887102 | 3300004114 | Soil | MPPPSRNTVGVYDRPHPLRTRKVLVPVLVAVVVIIGYALYFLLR* |
| Ga0062593_1034303291 | 3300004114 | Soil | MTSPSRNTVGVYDRPHPLRTRKVIVPVLVAVVVTIGYAVFFYLR* |
| Ga0062590_1028817922 | 3300004157 | Soil | SPSRNTVGVYDRPHPLRTRKVIVPVLVAVVVTIGYAVFFYLR* |
| Ga0070658_100317752 | 3300005327 | Corn Rhizosphere | MNDRPSGRSRNAVGVYERPHPLRTRKVLVPVVIFVLMALVYGLYFLLR* |
| Ga0070658_102535572 | 3300005327 | Corn Rhizosphere | MPGGTVGVYDRPHPLRTRKVLVPAAIAVVVALGYAGWFYLR* |
| Ga0070658_103307362 | 3300005327 | Corn Rhizosphere | MSDPGKPTTAASRNSVGVYDRPHPLRTRKVLVPTAIAVVVGIGYALWFYLR* |
| Ga0070676_103000002 | 3300005328 | Miscanthus Rhizosphere | MAEPSRKSVGVYDRPHPLRTRKVLIPVIVAIVVAAAYALWAYLA* |
| Ga0070676_106445701 | 3300005328 | Miscanthus Rhizosphere | MAEPSRKSVGVYDRPHPLRTRKVLIPVLVALVVAAAYALWAYLA* |
| Ga0070690_1002299332 | 3300005330 | Switchgrass Rhizosphere | MTSPSRNTVGVYDRPHPLRTRKVMVPVLVAVVVTIGYAVFFYLR* |
| Ga0070670_1000557732 | 3300005331 | Switchgrass Rhizosphere | MPPPQSRNTVGVYDRPHPLRTRKVLVPVLMAVVVVIAYALYFMLR* |
| Ga0070670_1001124211 | 3300005331 | Switchgrass Rhizosphere | TARPEETPMTSPSRNTVGVYDRPHPLRTRKVIVPVLVAVVVTIGYAVFFYLR* |
| Ga0070666_102120892 | 3300005335 | Switchgrass Rhizosphere | MAEPSRKSVGVYDRPHPLRTRKVLIPVIVAIVVAVAYALWAHFA* |
| Ga0070666_104988842 | 3300005335 | Switchgrass Rhizosphere | MTMPSRSTVGVYDRPHPLRTRKVMVPVIVAIVVTIAYAIWWYVA* |
| Ga0068868_1011502021 | 3300005338 | Miscanthus Rhizosphere | MAEPSRKSVGVYDQPHPLRTRKVLIPVIVAIVVAVAYALWAHFA* |
| Ga0068868_1014257852 | 3300005338 | Miscanthus Rhizosphere | EGTPMTSPSRNTVGVYDRPHPLRTRKVIVPVLVAVVVTIGYAVFFYLR* |
| Ga0068868_1017089852 | 3300005338 | Miscanthus Rhizosphere | MTAPSRNTVGVYDRPHPLRTRKVLVPVLVAVVVAIVYAVWWYVA* |
| Ga0068868_1019304832 | 3300005338 | Miscanthus Rhizosphere | MPPPSRNTVGVYDRPHPLRTRKVLVPVLVAVVVIIGYALY |
| Ga0070661_1011746232 | 3300005344 | Corn Rhizosphere | MPSRSSVGVYDRPHPLRTRKVVVPVLIAVVVAVAYAMWWYVG* |
| Ga0070692_107614892 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MNDRPSGRSRNAVGVYERPHPLRTRKVLVPVVIFVLMALVYGLYFLMR* |
| Ga0070673_1003291702 | 3300005364 | Switchgrass Rhizosphere | MAEPSRKSVGVYDRPHPLRTRKVLIPVIVTIVVAVAYALWAHFA* |
| Ga0070659_1003081972 | 3300005366 | Corn Rhizosphere | MPSRSSVGVYDRPHPLRTRKVVVPVLIAVVVAAAYAMWWYVG* |
| Ga0070659_1004593612 | 3300005366 | Corn Rhizosphere | SAPHGPARPGKSPMPGGTVGVYDRPHPLRTRKVLVPAAIAVVVALGYAGWFYLR* |
| Ga0070714_1001179273 | 3300005435 | Agricultural Soil | MNKQTRGAVGVYDRPHPLRTRKALVSAAVAIVVAAGYALWFYLR* |
| Ga0070711_1002985772 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MPSRSSVGVYDRPHPLRMRKVVVPMLIAAVVAVAYAIGWYVG* |
| Ga0070662_1013002091 | 3300005457 | Corn Rhizosphere | ITMAEPSRKSVGVYDRPHPLRTRKVLIPVIVAIVVAAAYALWAYLA* |
| Ga0070681_113203322 | 3300005458 | Corn Rhizosphere | MPSPPRNTVGVYDRPHPLRTRKVLVPVLAAVVVTIAYALWWYLA* |
| Ga0068867_1020131421 | 3300005459 | Miscanthus Rhizosphere | HQSARILMPEPSRKSVGVYDRPHPLRTRKVLLPVVIAIVVAAVYAMWAYLT* |
| Ga0070696_1010164682 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MPRTVGVYDRPHPLRTRKVLVPLAVAAVAGLAYALWFYLR* |
| Ga0068855_1000338854 | 3300005563 | Corn Rhizosphere | MPSRSSVGVYDRPHPLRTRKVVVPVLIAVVVAVAYAIWWYVG* |
| Ga0068864_1009437153 | 3300005618 | Switchgrass Rhizosphere | RPSTEARITMAEPSRKSVGVYDRPHPLRTRKVLIPVIVAIVVAAAYALWAYLA* |
| Ga0068870_104478341 | 3300005840 | Miscanthus Rhizosphere | RNTVGVYDRPHPLRTRKVIVPVLVAVVVTIGYAVFFYLR* |
| Ga0075279_100244012 | 3300005903 | Rice Paddy Soil | VSVSIPRKAVGVYDRPHPFRTRRVLVPAAVVAVTIAAYALWFFLT* |
| Ga0075422_102063581 | 3300006196 | Populus Rhizosphere | MTSPSRNTVGVYDRPHPLRTRKVMVPVLVAVVVTLGYAVFFY |
| Ga0097621_1002580542 | 3300006237 | Miscanthus Rhizosphere | MAEPSRKSVGVYDRPHPLRTRKVLIVIVAMVVAVAYALWAHFA* |
| Ga0097621_1010934832 | 3300006237 | Miscanthus Rhizosphere | MTAPSRNTVGVYDRPHPLRTRKVLVPVLVAVVVGIVYAVWWYVA* |
| Ga0079222_100370082 | 3300006755 | Agricultural Soil | MPRTVGVYDRPHPLRTRKVLVPLAVAAVAGLAYALWFYLS* |
| Ga0105248_124621662 | 3300009177 | Switchgrass Rhizosphere | MTTPSRNTVGVYDRPHPLRTRKVLVPVLVAVVVAIVYAVWWYVA* |
| Ga0105237_108050032 | 3300009545 | Corn Rhizosphere | LNPRPEFMSDPGKPTTAASRNSVGVYDRPHPLRTRKVLVPVVIFVLMALVYGLYFLLR* |
| Ga0134128_100843521 | 3300010373 | Terrestrial Soil | MERDRSRNAVGVYDRPPAWRTRKVLVPVAIFVVVAVAYALYFLR* |
| Ga0134122_102175232 | 3300010400 | Terrestrial Soil | MTAPSRNTVGVYDRPHPLRTRKVLVPAVVAVGVAILYGLWAYFA* |
| Ga0134121_117924321 | 3300010401 | Terrestrial Soil | MTTPSRNTVGVYDRPHPLRTRKVLVPVLVAVVVAIVYAVWWYLA* |
| Ga0150985_1102285332 | 3300012212 | Avena Fatua Rhizosphere | MTEPSRKSVGVYDRPHPLRTRKVLIPVIVALVVAAAYALWAYLA* |
| Ga0150985_1145305052 | 3300012212 | Avena Fatua Rhizosphere | MTTPSRNTVGVYDRPHPLRTRKVLVPVLVAVVVAIAYAVWWYVA* |
| Ga0150985_1197369322 | 3300012212 | Avena Fatua Rhizosphere | MTVPSRSTVGVYDRPHWLRTRKVVAPLVVAAIVAVGYAVWWYVA* |
| Ga0150985_1216375572 | 3300012212 | Avena Fatua Rhizosphere | MPSRNTVGVYDRPHPLRTRKVIVPVLVAVVVAIAYAVWWYVR* |
| Ga0150984_1014488991 | 3300012469 | Avena Fatua Rhizosphere | MTEPSRKSVGVYDRPHPLRTRKVLIPVIVAIVVTAA |
| Ga0150984_1045638112 | 3300012469 | Avena Fatua Rhizosphere | MTVPSRSTVGVYDRPHWLRTRKVVAPLLVAGIVAVGYAVWWYVA* |
| Ga0150984_1124871391 | 3300012469 | Avena Fatua Rhizosphere | MPEPSRKSVGVYDRPHPLRTRKVLLPVVIAIVVAAVYAMWAYLT* |
| Ga0150984_1208143132 | 3300012469 | Avena Fatua Rhizosphere | MPTPSRNTVGVYDRPHPLRTRKVLVPVLIAVVVAIAYAVWWYVA* |
| Ga0157301_100991191 | 3300012911 | Soil | MTSPSRNTVGVYDRPHPLRTRKVIVPVLVAVVVTIGYA |
| Ga0164298_116450471 | 3300012955 | Soil | VYDRPHPFRTRKVFVPVLVAVVVAIAYAIWWYVS* |
| Ga0164303_106195592 | 3300012957 | Soil | MAPPSRSAVGVYERPHPLRTRKVLIPALVAIVTAMGYGAWFYFR* |
| Ga0164304_100832372 | 3300012986 | Soil | MAPPSRSAVVVYERPHPLRTRKVLIPALVAIVTAMGYGAWFYFR* |
| Ga0164306_103330442 | 3300012988 | Soil | MARPSRSAVGVYERPHPLRTRKVLIPALVAIVTAMGYGAWFYFR* |
| Ga0164305_110389171 | 3300012989 | Soil | LRAPTMNDRPSGRSRNAVGVYERPHPLRTRKVLVPVVIFVLMALVYGLYFLLR* |
| Ga0164305_115011412 | 3300012989 | Soil | MTSPSRNTVGVYDRPHPLRTRKVIVPVLGAVVVTIGYAVFFYLR* |
| Ga0157373_100087394 | 3300013100 | Corn Rhizosphere | MNDRPSGLSRNAVGVYERPHPLRTRKVLVPVVIFVLMALVYGLYFLLR* |
| Ga0157371_107487362 | 3300013102 | Corn Rhizosphere | MERDRSRNAVGVYDRPPAWRTRKVLVPVAIFVVVAVAYALYFLL* |
| Ga0157370_100778903 | 3300013104 | Corn Rhizosphere | VPGGTVGVYDRPHPLRTRKVLVPAAIAVVVALGYAGWFYLR* |
| Ga0157370_101409221 | 3300013104 | Corn Rhizosphere | HSYLRAPTMNDRPSGRSRNAVGVYERPHPLRTRKVLVPVVIFVLMALVYGLYFLLR* |
| Ga0157370_103636742 | 3300013104 | Corn Rhizosphere | MDQGRSRNAVGVYDRPPAWRTRKVLVPVAIFVVVAIAYTLYFLL* |
| Ga0157369_100400944 | 3300013105 | Corn Rhizosphere | MTMPSRSSVGVYDRPHPLRTRKVVVPVLIAVVVAAAYAMWWYVG* |
| Ga0157369_111414722 | 3300013105 | Corn Rhizosphere | MNDRPSGRSRNAVGVYERPHPLLTRKVLVPVVIFVLMALVYGLYFLLR* |
| Ga0157372_101941122 | 3300013307 | Corn Rhizosphere | MPPPSRNTVGVYDRPHPLRTRKVLVPVLVAVVVMIGYALYFLLR* |
| Ga0157372_103502341 | 3300013307 | Corn Rhizosphere | NAVGVYDRPPAWRTRKVLVPVAIFVAVAVAYALYFLR* |
| Ga0120127_100271292 | 3300013503 | Permafrost | MSLPSRSAVGVYDRPHPLRTRKVLIPALVAIVTAMGYGAWFYFR* |
| Ga0182008_101026851 | 3300014497 | Rhizosphere | SIMDQGRSRNAVGVYDRPPAWRTRKVLVPVAIFVVVAIAYTLYFLL* |
| Ga0182008_102604662 | 3300014497 | Rhizosphere | MESSMNAPSRKSVGIYDRPHPLRTRKVLVPVVIFVLMALVYGLYFLLR* |
| Ga0173483_101571972 | 3300015077 | Soil | MTSPSRNTVGVYDQPHPLRTRKVIVPVLVAVVVTIGYAVFFYLR* |
| Ga0173480_103791541 | 3300015200 | Soil | SARRRARTARPEETPMTSPSRNTVGVYDRPHPLRTRKVIVPVLVAVVVTIGYAVFFYLR* |
| Ga0132258_111916782 | 3300015371 | Arabidopsis Rhizosphere | MSEGSRKAVGVYDRPHPLRTRKVLIPALVAIAVAVAYAVFAYFS* |
| Ga0132257_1000355915 | 3300015373 | Arabidopsis Rhizosphere | MPRTVGIYDRPHPLRTRKALVSLAVAAVVGLGYALWFFLR* |
| Ga0197907_110013152 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | MNDRPSGRSRNAVGVYERPHPLRTRKVLVPVVIFVLMALVYGLYFLLR |
| Ga0206356_110057262 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDPGKPTTAASRNSVGVYDRPHPLRTRKVLVPTAIAVVVGIGYALWFYLR |
| Ga0206356_115396232 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MDQGRSRNAVGVYDRPPAWRTRKVLVPVAIFVVVAVAYALYFLL |
| Ga0206351_107784542 | 3300020077 | Corn, Switchgrass And Miscanthus Rhizosphere | MNDRPSGLSRNAVGVYERPHPLRTRKVLVPVVIFVLMALVYGLYFLLR |
| Ga0206354_103964212 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | MNDRPSGRSRNAVGVYERPHPLRTRKVLVPVVIFVLMALVYGLYFLMR |
| Ga0206353_101097562 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | MERDRSRNAVGVYDRPPAWRTRKVLVPVAIFVVVAVAYALYFLR |
| Ga0206353_116317682 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | MPGGTVGVYDRPHPLRTRKVLVPAAIAVVVALGYAGWFYLR |
| Ga0182009_102379712 | 3300021445 | Soil | MNAPSRKSVGIYDRPHPLRTRKVLIPVLVAVAVSAVYATWWWLAR |
| Ga0207656_100245142 | 3300025321 | Corn Rhizosphere | MPPPSRNTVGVYDRPHPLRTRKVLVPVLVAVVVIIGYALYFLLR |
| Ga0207692_111992721 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | RCHSYLRAPTMNDRPSGRSRNAVGVYERPHPLRTRKVLVPVVIFVLMALVYGLYFLLR |
| Ga0207680_102431772 | 3300025903 | Switchgrass Rhizosphere | MAEPSRKSVGVYDRPHPLRTRKVLIPVIVAIVVAVAYALWAHFA |
| Ga0207680_103417842 | 3300025903 | Switchgrass Rhizosphere | MTMPSRSTVGVYDRPHPLRTRKVMVPVIVAIVVTIAYAIWWYVA |
| Ga0207680_103882601 | 3300025903 | Switchgrass Rhizosphere | EGTPMTSPSRNTVGVYDRPHPLRTRKVIVPVLVAVVVTIGYAVFFYLR |
| Ga0207654_105464602 | 3300025911 | Corn Rhizosphere | MPRTVGVYDRPHPLRTRKVLVPLAVAAVAGLAYALWFYLR |
| Ga0207649_103463222 | 3300025920 | Corn Rhizosphere | MPSRSSVGVYDRPHPLRTRKVVVPVLIAVVVAVAYAIWWYVG |
| Ga0207681_108505212 | 3300025923 | Switchgrass Rhizosphere | MAEPSRKSVGVYDRPHPLRTRKVLIPVLVALVVAAAYALWAYLA |
| Ga0207650_101048592 | 3300025925 | Switchgrass Rhizosphere | MPPPQSRNTVGVYDRPHPLRTRKVLVPVLMAVVVVIAYALYFMLR |
| Ga0207701_101540752 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEPSRKSVGVYDQPHPLRTRKVLIPVIVAIVVAVAYALWAHFA |
| Ga0207644_103121982 | 3300025931 | Switchgrass Rhizosphere | MTSPSRNTVGVYDRPHPLRTRKVIVPVLVAVVVTI |
| Ga0207644_117090551 | 3300025931 | Switchgrass Rhizosphere | MTTPSRNTVGVYDRPHPLRTRKVLVPVLVAVVVAIVYAVWWYLA |
| Ga0207690_103103762 | 3300025932 | Corn Rhizosphere | MPSRSSVGVYDRPHPLRTRKVVVPVLIAVVVAAAYAMWWYVG |
| Ga0207706_103350362 | 3300025933 | Corn Rhizosphere | MTGGPRKAVGVYDRPHPLRTRKVLVPVVIFVLMALVYGLYFLLR |
| Ga0207706_106717852 | 3300025933 | Corn Rhizosphere | MAEPSRKSVGVYDRPHPLRTRKVLIPVIVAIVVAAAYALWAYLA |
| Ga0207711_105443301 | 3300025941 | Switchgrass Rhizosphere | MTSPSRNTVGVYDRPHPLRTRKVIVPVLVAVVVTIG |
| Ga0207689_102105951 | 3300025942 | Miscanthus Rhizosphere | MPPPSRNTVGVYDRPHPLRTRKVLLPVLVAVVVIIGYALYFLLR |
| Ga0207661_119011692 | 3300025944 | Corn Rhizosphere | GRRFSSIMDQGRSRNAVGVYDRPPAWRTRKVLVPVAIFAVVAIAYTLYFLL |
| Ga0207679_104243202 | 3300025945 | Corn Rhizosphere | SRVRARQVGPSMTMPSRSSVGVYDRPHPLRTRKVVVPVLIAVVVAAAYAMWWYVG |
| Ga0207667_118622851 | 3300025949 | Corn Rhizosphere | APRPEFMSDPGKPTTAASRNSVGVYDRPHPLRTRKVLVPTAIAVVVGIGYALWFYLR |
| Ga0207702_101519243 | 3300026078 | Corn Rhizosphere | MPSRSSVGVYDRPHPLRTRKVVVPVLIAAVVAAAYAIGWYVG |
| Ga0207648_104926741 | 3300026089 | Miscanthus Rhizosphere | DPQPRRVSSMAEPSRKSVGVYDQPHPLRTRKVLIPVIVAIVVAVAYALWAHFA |
| Ga0207676_109190692 | 3300026095 | Switchgrass Rhizosphere | VGVYDRPHPLRTRKVLIPVIVAIVVAVAYALWAHFA |
| Ga0207674_114481822 | 3300026116 | Corn Rhizosphere | VDQGRSRNAVGVYDRPPAWRTRKVLVPLAIFVVVAIAYTLYFLL |
| Ga0209984_10501812 | 3300027424 | Arabidopsis Thaliana Rhizosphere | MNAPSRKSVGIYDRPHPLRTRKVLIPALVAVAVSAVYAAWWWFAR |
| Ga0209177_101703301 | 3300027775 | Agricultural Soil | MPRTVGVYDRPHPLRTRKVLVPLAVAAVAGLAYAL |
| Ga0268266_115661342 | 3300028379 | Switchgrass Rhizosphere | MTSPSRNTVGVYDRPHPLGTRKVMVPVLVAVVVTIGYAVFFYLR |
| Ga0247828_101566291 | 3300028587 | Soil | APTARPEEIPMTSPSRNTVGVYDRPHPLRTRKVMVPVLVAVVVTIGYAVFFYLR |
| Ga0247820_105654031 | 3300028597 | Soil | MPSPSRNTVGVYDRPHPLRTRKVIVPVLVAVVVTIGYA |
| Ga0247827_112599582 | 3300028889 | Soil | MPSPSRNTVGVYDRPHPLRTRKVIVPVLVAVVVTIGYAVFFYLR |
| Ga0308189_101777592 | 3300031058 | Soil | MTPPSRNTVGVYDRPHPWRTRKVLVPVVVAIVVAIGYALYFYLR |
| Ga0310813_105490581 | 3300031716 | Soil | EAMPPPSRNTVGVYDRPHPLRTRKVLVPVLVAVVVIIGYALSFLLR |
| Ga0310813_108059111 | 3300031716 | Soil | MDQGRSRNAVGVYDRPPAWRTRKVLVPVAIFVVVAIAYTLYFLL |
| Ga0307413_118898242 | 3300031824 | Rhizosphere | MAPPSRNSVGVYDRPSPWRTRKVLLPAIVAVVVGIAYALWAYFT |
| Ga0310900_104444322 | 3300031908 | Soil | MTSPSRNTVGVYDRPHPLRTRKVVVPVLVAVVVTIGYAVFFYLR |
| Ga0308175_1002678142 | 3300031938 | Soil | MNDHRNRRSRNAVGVYDRPHPLRTRKVLVPVVIFVLMALVYGLYFLLR |
| Ga0308175_1003632232 | 3300031938 | Soil | TPTRSSVGVYDRPHPLRTRKVLVPVAIVVAIAIAYAIYFLLR |
| Ga0308175_1005004322 | 3300031938 | Soil | MNDRRNGSSRNAVGIYDRPHPLRTRKVLVPVGIFVLMALVYGLYFLLR |
| Ga0308175_1005323002 | 3300031938 | Soil | MNDRRNGRSRNAVGVYDRPHPLRTRRVLVPVVIFVLIAIVYALYFLLR |
| Ga0308175_1011758672 | 3300031938 | Soil | VNDTRNGRARGTVGVYNRPHPLRTRKVLVPAVIFVLIAIAYALYFLLR |
| Ga0308174_100467044 | 3300031939 | Soil | MTTPSRNTVGVYDRPHPLRTRKVMVPVVIAVIVAVAYAIWWYVA |
| Ga0310884_104946501 | 3300031944 | Soil | ARPEETPMTSPSRNTVGVYDRPHPLRTRKVIVPVLVAVVVTIGYAVFFYLR |
| Ga0308176_104749131 | 3300031996 | Soil | GVYNRPHPLRTRKVLVPAVIFVLIAIAYALYFLLR |
| Ga0308176_124709632 | 3300031996 | Soil | VNDTGNGRSRGTVGVYDRPHPLRTRKVLVPAVIFVLIAIAYVLYFLLR |
| Ga0310810_107122552 | 3300033412 | Soil | MTMPSRSSVGVYDRPHPLRTRKVVVPVLIAAVVAAAYAIWWYVG |
| Ga0310811_109067692 | 3300033475 | Soil | VGVYDRPHPLRTRKVLVPVLVAVVVTIGYAVFFYLR |
| Ga0316620_100749482 | 3300033480 | Soil | MPATRNAVGVYDRPHPLRTRKALVAAAIALVVALGYGLWFALR |
| Ga0316624_108235202 | 3300033486 | Soil | AMPATRNAVGVYDRPHPLRTRKALVAAAIALVVALGYGLWFALR |
| Ga0316628_1001702271 | 3300033513 | Soil | MTSSRNAVGVYDRPHPLRTRKALVAAGISLVVAAGYAAWFYFR |
| ⦗Top⦘ |