NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F057490

Metagenome / Metatranscriptome Family F057490

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F057490
Family Type Metagenome / Metatranscriptome
Number of Sequences 136
Average Sequence Length 45 residues
Representative Sequence MTTPSRNTVGVYDRPHPLRTRKVLVPVLVAVVVAIVYAVWWYLA
Number of Associated Samples 100
Number of Associated Scaffolds 136

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 61.03 %
% of genes near scaffold ends (potentially truncated) 27.21 %
% of genes from short scaffolds (< 2000 bps) 84.56 %
Associated GOLD sequencing projects 90
AlphaFold2 3D model prediction Yes
3D model pTM-score0.51

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (94.118 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(10.294 % of family members)
Environment Ontology (ENVO) Unclassified
(55.147 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(65.441 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 41.67%    β-sheet: 0.00%    Coil/Unstructured: 58.33%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.51
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 136 Family Scaffolds
PF02852Pyr_redox_dim 41.91
PF07992Pyr_redox_2 13.24
PF06897DUF1269 5.88
PF03401TctC 2.94
PF08534Redoxin 2.94
PF08240ADH_N 0.74
PF00005ABC_tran 0.74
PF03358FMN_red 0.74
PF00563EAL 0.74
PF00462Glutaredoxin 0.74

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 136 Family Scaffolds
COG4803Uncharacterized membrane proteinFunction unknown [S] 5.88
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 2.94
COG2200EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant)Signal transduction mechanisms [T] 0.74
COG3434c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domainsSignal transduction mechanisms [T] 0.74
COG4943Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domainsSignal transduction mechanisms [T] 0.74
COG5001Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domainSignal transduction mechanisms [T] 0.74


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.12 %
UnclassifiedrootN/A5.88 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2162886012|MBSR1b_contig_8014482All Organisms → cellular organisms → Bacteria → Proteobacteria1240Open in IMG/M
2199352024|deeps__Contig_179088All Organisms → cellular organisms → Bacteria → Proteobacteria2387Open in IMG/M
3300000033|ICChiseqgaiiDRAFT_c2082336All Organisms → cellular organisms → Bacteria → Proteobacteria714Open in IMG/M
3300000363|ICChiseqgaiiFebDRAFT_13526320All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300003321|soilH1_10183849All Organisms → cellular organisms → Bacteria → Proteobacteria1131Open in IMG/M
3300003324|soilH2_10265359All Organisms → cellular organisms → Bacteria → Proteobacteria1337Open in IMG/M
3300003324|soilH2_10403897All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium1004Open in IMG/M
3300004114|Ga0062593_100688710All Organisms → cellular organisms → Bacteria → Proteobacteria994Open in IMG/M
3300004114|Ga0062593_103430329All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300004157|Ga0062590_102881792All Organisms → cellular organisms → Bacteria → Proteobacteria514Open in IMG/M
3300005327|Ga0070658_10031775All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria4241Open in IMG/M
3300005327|Ga0070658_10253557All Organisms → cellular organisms → Bacteria → Proteobacteria1493Open in IMG/M
3300005327|Ga0070658_10330736All Organisms → cellular organisms → Bacteria → Proteobacteria1302Open in IMG/M
3300005328|Ga0070676_10300000All Organisms → cellular organisms → Bacteria → Proteobacteria1089Open in IMG/M
3300005328|Ga0070676_10644570All Organisms → cellular organisms → Bacteria → Proteobacteria768Open in IMG/M
3300005330|Ga0070690_100229933All Organisms → cellular organisms → Bacteria → Proteobacteria1303Open in IMG/M
3300005331|Ga0070670_100055773All Organisms → cellular organisms → Bacteria → Proteobacteria3391Open in IMG/M
3300005331|Ga0070670_100112421All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2347Open in IMG/M
3300005335|Ga0070666_10212089All Organisms → cellular organisms → Bacteria → Proteobacteria1364Open in IMG/M
3300005335|Ga0070666_10498884All Organisms → cellular organisms → Bacteria → Proteobacteria882Open in IMG/M
3300005338|Ga0068868_101150202All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium716Open in IMG/M
3300005338|Ga0068868_101425785All Organisms → cellular organisms → Bacteria → Proteobacteria646Open in IMG/M
3300005338|Ga0068868_101708985All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium593Open in IMG/M
3300005338|Ga0068868_101930483All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium559Open in IMG/M
3300005344|Ga0070661_101174623All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae641Open in IMG/M
3300005345|Ga0070692_10761489All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium657Open in IMG/M
3300005364|Ga0070673_100329170All Organisms → cellular organisms → Bacteria → Proteobacteria1351Open in IMG/M
3300005366|Ga0070659_100308197All Organisms → cellular organisms → Bacteria → Proteobacteria1322Open in IMG/M
3300005366|Ga0070659_100459361All Organisms → cellular organisms → Bacteria → Proteobacteria1081Open in IMG/M
3300005435|Ga0070714_100117927All Organisms → cellular organisms → Bacteria → Proteobacteria2358Open in IMG/M
3300005439|Ga0070711_100298577All Organisms → cellular organisms → Bacteria → Proteobacteria1280Open in IMG/M
3300005457|Ga0070662_101300209All Organisms → cellular organisms → Bacteria → Proteobacteria626Open in IMG/M
3300005458|Ga0070681_11320332All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium644Open in IMG/M
3300005459|Ga0068867_102013142All Organisms → cellular organisms → Bacteria → Proteobacteria546Open in IMG/M
3300005546|Ga0070696_101016468All Organisms → cellular organisms → Bacteria → Proteobacteria693Open in IMG/M
3300005563|Ga0068855_100033885All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae6092Open in IMG/M
3300005618|Ga0068864_100943715All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales853Open in IMG/M
3300005840|Ga0068870_10447834All Organisms → cellular organisms → Bacteria → Proteobacteria850Open in IMG/M
3300005903|Ga0075279_10024401All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium895Open in IMG/M
3300006196|Ga0075422_10206358All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium810Open in IMG/M
3300006237|Ga0097621_100258054All Organisms → cellular organisms → Bacteria → Proteobacteria1528Open in IMG/M
3300006237|Ga0097621_101093483All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Bordetella748Open in IMG/M
3300006755|Ga0079222_10037008All Organisms → cellular organisms → Bacteria → Proteobacteria2149Open in IMG/M
3300009177|Ga0105248_12462166All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium593Open in IMG/M
3300009545|Ga0105237_10805003Not Available946Open in IMG/M
3300010373|Ga0134128_10084352All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3624Open in IMG/M
3300010400|Ga0134122_10217523All Organisms → cellular organisms → Bacteria → Proteobacteria1594Open in IMG/M
3300010401|Ga0134121_11792432All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300012212|Ga0150985_110228533All Organisms → cellular organisms → Bacteria → Proteobacteria1237Open in IMG/M
3300012212|Ga0150985_114530505All Organisms → cellular organisms → Bacteria → Proteobacteria1021Open in IMG/M
3300012212|Ga0150985_119736932All Organisms → cellular organisms → Bacteria → Proteobacteria1957Open in IMG/M
3300012212|Ga0150985_121637557All Organisms → cellular organisms → Bacteria → Proteobacteria1614Open in IMG/M
3300012469|Ga0150984_101448899All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium1201Open in IMG/M
3300012469|Ga0150984_104563811All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium515Open in IMG/M
3300012469|Ga0150984_112487139All Organisms → cellular organisms → Bacteria → Proteobacteria647Open in IMG/M
3300012469|Ga0150984_120814313All Organisms → cellular organisms → Bacteria → Proteobacteria952Open in IMG/M
3300012911|Ga0157301_10099119All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium853Open in IMG/M
3300012955|Ga0164298_11645047All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300012957|Ga0164303_10619559All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium716Open in IMG/M
3300012986|Ga0164304_10083237All Organisms → cellular organisms → Bacteria → Proteobacteria1857Open in IMG/M
3300012988|Ga0164306_10333044All Organisms → cellular organisms → Bacteria → Proteobacteria1119Open in IMG/M
3300012989|Ga0164305_11038917All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300012989|Ga0164305_11501141All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium598Open in IMG/M
3300013100|Ga0157373_10008739All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria7506Open in IMG/M
3300013102|Ga0157371_10748736All Organisms → cellular organisms → Bacteria → Proteobacteria734Open in IMG/M
3300013104|Ga0157370_10077890All Organisms → cellular organisms → Bacteria → Proteobacteria3122Open in IMG/M
3300013104|Ga0157370_10140922All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales2246Open in IMG/M
3300013104|Ga0157370_10363674All Organisms → cellular organisms → Bacteria → Proteobacteria1333Open in IMG/M
3300013105|Ga0157369_10040094All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales5115Open in IMG/M
3300013105|Ga0157369_11141472Not Available796Open in IMG/M
3300013307|Ga0157372_10194112All Organisms → cellular organisms → Bacteria → Proteobacteria2352Open in IMG/M
3300013307|Ga0157372_10350234Not Available1721Open in IMG/M
3300013503|Ga0120127_10027129All Organisms → cellular organisms → Bacteria → Proteobacteria1051Open in IMG/M
3300014497|Ga0182008_10102685All Organisms → cellular organisms → Bacteria → Proteobacteria1414Open in IMG/M
3300014497|Ga0182008_10260466All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium897Open in IMG/M
3300015077|Ga0173483_10157197All Organisms → cellular organisms → Bacteria → Proteobacteria1009Open in IMG/M
3300015200|Ga0173480_10379154All Organisms → cellular organisms → Bacteria815Open in IMG/M
3300015371|Ga0132258_11191678All Organisms → cellular organisms → Bacteria → Proteobacteria1925Open in IMG/M
3300015373|Ga0132257_100035591All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales5445Open in IMG/M
3300020069|Ga0197907_11001315All Organisms → cellular organisms → Bacteria → Proteobacteria1449Open in IMG/M
3300020070|Ga0206356_11005726All Organisms → cellular organisms → Bacteria → Proteobacteria709Open in IMG/M
3300020070|Ga0206356_11539623All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium638Open in IMG/M
3300020077|Ga0206351_10778454All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium1470Open in IMG/M
3300020081|Ga0206354_10396421All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium916Open in IMG/M
3300020082|Ga0206353_10109756All Organisms → cellular organisms → Bacteria → Proteobacteria1354Open in IMG/M
3300020082|Ga0206353_11631768All Organisms → cellular organisms → Bacteria → Proteobacteria1674Open in IMG/M
3300021445|Ga0182009_10237971All Organisms → cellular organisms → Bacteria → Proteobacteria899Open in IMG/M
3300025321|Ga0207656_10024514All Organisms → cellular organisms → Bacteria → Proteobacteria2440Open in IMG/M
3300025898|Ga0207692_11199272Not Available504Open in IMG/M
3300025903|Ga0207680_10243177All Organisms → cellular organisms → Bacteria → Proteobacteria1241Open in IMG/M
3300025903|Ga0207680_10341784All Organisms → cellular organisms → Bacteria1050Open in IMG/M
3300025903|Ga0207680_10388260All Organisms → cellular organisms → Bacteria → Proteobacteria985Open in IMG/M
3300025911|Ga0207654_10546460All Organisms → cellular organisms → Bacteria → Proteobacteria822Open in IMG/M
3300025920|Ga0207649_10346322All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium1098Open in IMG/M
3300025923|Ga0207681_10850521All Organisms → cellular organisms → Bacteria → Proteobacteria763Open in IMG/M
3300025925|Ga0207650_10104859All Organisms → cellular organisms → Bacteria → Proteobacteria2182Open in IMG/M
3300025930|Ga0207701_10154075All Organisms → cellular organisms → Bacteria → Proteobacteria2036Open in IMG/M
3300025931|Ga0207644_10312198All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium1269Open in IMG/M
3300025931|Ga0207644_11709055Not Available527Open in IMG/M
3300025932|Ga0207690_10310376All Organisms → cellular organisms → Bacteria → Proteobacteria1237Open in IMG/M
3300025933|Ga0207706_10335036Not Available1316Open in IMG/M
3300025933|Ga0207706_10671785All Organisms → cellular organisms → Bacteria → Proteobacteria886Open in IMG/M
3300025941|Ga0207711_10544330All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium1083Open in IMG/M
3300025942|Ga0207689_10210595All Organisms → cellular organisms → Bacteria → Proteobacteria1606Open in IMG/M
3300025944|Ga0207661_11901169All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium541Open in IMG/M
3300025945|Ga0207679_10424320All Organisms → cellular organisms → Bacteria → Proteobacteria1174Open in IMG/M
3300025949|Ga0207667_11862285All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300026078|Ga0207702_10151924Not Available2107Open in IMG/M
3300026089|Ga0207648_10492674All Organisms → cellular organisms → Bacteria → Proteobacteria1121Open in IMG/M
3300026095|Ga0207676_10919069All Organisms → cellular organisms → Bacteria → Proteobacteria859Open in IMG/M
3300026116|Ga0207674_11448182All Organisms → cellular organisms → Bacteria → Proteobacteria656Open in IMG/M
3300027424|Ga0209984_1050181All Organisms → cellular organisms → Bacteria → Proteobacteria610Open in IMG/M
3300027775|Ga0209177_10170330All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium754Open in IMG/M
3300028379|Ga0268266_11566134All Organisms → cellular organisms → Bacteria → Proteobacteria634Open in IMG/M
3300028587|Ga0247828_10156629All Organisms → cellular organisms → Bacteria → Proteobacteria1147Open in IMG/M
3300028597|Ga0247820_10565403All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium781Open in IMG/M
3300028889|Ga0247827_11259958All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300031058|Ga0308189_10177759All Organisms → cellular organisms → Bacteria → Proteobacteria753Open in IMG/M
3300031716|Ga0310813_10549058All Organisms → cellular organisms → Bacteria → Proteobacteria1016Open in IMG/M
3300031716|Ga0310813_10805911All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium846Open in IMG/M
3300031824|Ga0307413_11889824All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ardenticatenia → Ardenticatenales → unclassified Ardenticatenales → Ardenticatenales bacterium536Open in IMG/M
3300031908|Ga0310900_10444432All Organisms → cellular organisms → Bacteria → Proteobacteria995Open in IMG/M
3300031938|Ga0308175_100267814All Organisms → cellular organisms → Bacteria → Proteobacteria1724Open in IMG/M
3300031938|Ga0308175_100363223All Organisms → cellular organisms → Bacteria → Proteobacteria1500Open in IMG/M
3300031938|Ga0308175_100500432Not Available1291Open in IMG/M
3300031938|Ga0308175_100532300All Organisms → cellular organisms → Bacteria → Proteobacteria1254Open in IMG/M
3300031938|Ga0308175_101175867All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium852Open in IMG/M
3300031939|Ga0308174_10046704All Organisms → cellular organisms → Bacteria → Proteobacteria2902Open in IMG/M
3300031944|Ga0310884_10494650All Organisms → cellular organisms → Bacteria → Proteobacteria717Open in IMG/M
3300031996|Ga0308176_10474913All Organisms → cellular organisms → Bacteria → Proteobacteria1264Open in IMG/M
3300031996|Ga0308176_12470963All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300033412|Ga0310810_10712255All Organisms → cellular organisms → Bacteria → Proteobacteria930Open in IMG/M
3300033475|Ga0310811_10906769All Organisms → cellular organisms → Bacteria → Proteobacteria794Open in IMG/M
3300033480|Ga0316620_10074948All Organisms → cellular organisms → Bacteria → Proteobacteria2448Open in IMG/M
3300033486|Ga0316624_10823520All Organisms → cellular organisms → Bacteria → Proteobacteria826Open in IMG/M
3300033513|Ga0316628_100170227All Organisms → cellular organisms → Bacteria → Proteobacteria2578Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil10.29%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil9.56%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere9.56%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere8.82%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere6.62%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere5.88%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere5.15%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.68%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.94%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere2.94%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere2.94%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.21%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.21%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil2.21%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.21%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.47%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.47%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.47%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.47%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.47%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.47%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere1.47%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.47%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.47%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.47%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.47%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.74%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.74%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.74%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.74%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.74%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.74%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.74%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.74%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.74%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2162886012Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
2199352024Bare-fallow DEEP SOILEnvironmentalOpen in IMG/M
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000363Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300003321Sugarcane bulk soil Sample H1EnvironmentalOpen in IMG/M
3300003324Sugarcane bulk soil Sample H2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005903Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_303EnvironmentalOpen in IMG/M
3300006196Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1Host-AssociatedOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013503Permafrost microbial communities from Nunavut, Canada - A23_5cm_12MEnvironmentalOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300020069Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020077Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020081Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020082Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300025321Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027424Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300028597Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14EnvironmentalOpen in IMG/M
3300028889Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2EnvironmentalOpen in IMG/M
3300031058Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031824Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2Host-AssociatedOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M
3300033480Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_BEnvironmentalOpen in IMG/M
3300033486Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_AEnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
MBSR1b_0727.000049502162886012Miscanthus RhizosphereMTSPSRNTVGVYDRPHPLRTRKVIVPVLVAVVVTIGYAVFFYLR
deeps_033435402199352024SoilMALPSRSAVGVYDRPHPLRTRKVLIPALVAIVTAMGYGAWFYFR
ICChiseqgaiiDRAFT_208233623300000033SoilMNAPSRKSVGIYDRPHPLRTRKVLIPALVAVAVTAVYAAWWWFAR*
ICChiseqgaiiFebDRAFT_1352632023300000363SoilMTSPSPRNTVGVYDRPHPLRTRKVIVPVLVAVVVTIGYAVFFYLR*
soilH1_1018384923300003321Sugarcane Root And Bulk SoilVEQRSSRNAVGVYDRPPAWRTRKVLVPVAIFVVVAIAYALYFLL*
soilH2_1026535923300003324Sugarcane Root And Bulk SoilVEQRSSRNAVGVYDRPPAWRTRKVLVPVAIFVVVAVAYALYFLL*
soilH2_1040389723300003324Sugarcane Root And Bulk SoilVPRTVGIYDRPHPLRTRKVLVPLAVAAVVALVYALWFYLS*
Ga0062593_10068871023300004114SoilMPPPSRNTVGVYDRPHPLRTRKVLVPVLVAVVVIIGYALYFLLR*
Ga0062593_10343032913300004114SoilMTSPSRNTVGVYDRPHPLRTRKVIVPVLVAVVVTIGYAVFFYLR*
Ga0062590_10288179223300004157SoilSPSRNTVGVYDRPHPLRTRKVIVPVLVAVVVTIGYAVFFYLR*
Ga0070658_1003177523300005327Corn RhizosphereMNDRPSGRSRNAVGVYERPHPLRTRKVLVPVVIFVLMALVYGLYFLLR*
Ga0070658_1025355723300005327Corn RhizosphereMPGGTVGVYDRPHPLRTRKVLVPAAIAVVVALGYAGWFYLR*
Ga0070658_1033073623300005327Corn RhizosphereMSDPGKPTTAASRNSVGVYDRPHPLRTRKVLVPTAIAVVVGIGYALWFYLR*
Ga0070676_1030000023300005328Miscanthus RhizosphereMAEPSRKSVGVYDRPHPLRTRKVLIPVIVAIVVAAAYALWAYLA*
Ga0070676_1064457013300005328Miscanthus RhizosphereMAEPSRKSVGVYDRPHPLRTRKVLIPVLVALVVAAAYALWAYLA*
Ga0070690_10022993323300005330Switchgrass RhizosphereMTSPSRNTVGVYDRPHPLRTRKVMVPVLVAVVVTIGYAVFFYLR*
Ga0070670_10005577323300005331Switchgrass RhizosphereMPPPQSRNTVGVYDRPHPLRTRKVLVPVLMAVVVVIAYALYFMLR*
Ga0070670_10011242113300005331Switchgrass RhizosphereTARPEETPMTSPSRNTVGVYDRPHPLRTRKVIVPVLVAVVVTIGYAVFFYLR*
Ga0070666_1021208923300005335Switchgrass RhizosphereMAEPSRKSVGVYDRPHPLRTRKVLIPVIVAIVVAVAYALWAHFA*
Ga0070666_1049888423300005335Switchgrass RhizosphereMTMPSRSTVGVYDRPHPLRTRKVMVPVIVAIVVTIAYAIWWYVA*
Ga0068868_10115020213300005338Miscanthus RhizosphereMAEPSRKSVGVYDQPHPLRTRKVLIPVIVAIVVAVAYALWAHFA*
Ga0068868_10142578523300005338Miscanthus RhizosphereEGTPMTSPSRNTVGVYDRPHPLRTRKVIVPVLVAVVVTIGYAVFFYLR*
Ga0068868_10170898523300005338Miscanthus RhizosphereMTAPSRNTVGVYDRPHPLRTRKVLVPVLVAVVVAIVYAVWWYVA*
Ga0068868_10193048323300005338Miscanthus RhizosphereMPPPSRNTVGVYDRPHPLRTRKVLVPVLVAVVVIIGYALY
Ga0070661_10117462323300005344Corn RhizosphereMPSRSSVGVYDRPHPLRTRKVVVPVLIAVVVAVAYAMWWYVG*
Ga0070692_1076148923300005345Corn, Switchgrass And Miscanthus RhizosphereMNDRPSGRSRNAVGVYERPHPLRTRKVLVPVVIFVLMALVYGLYFLMR*
Ga0070673_10032917023300005364Switchgrass RhizosphereMAEPSRKSVGVYDRPHPLRTRKVLIPVIVTIVVAVAYALWAHFA*
Ga0070659_10030819723300005366Corn RhizosphereMPSRSSVGVYDRPHPLRTRKVVVPVLIAVVVAAAYAMWWYVG*
Ga0070659_10045936123300005366Corn RhizosphereSAPHGPARPGKSPMPGGTVGVYDRPHPLRTRKVLVPAAIAVVVALGYAGWFYLR*
Ga0070714_10011792733300005435Agricultural SoilMNKQTRGAVGVYDRPHPLRTRKALVSAAVAIVVAAGYALWFYLR*
Ga0070711_10029857723300005439Corn, Switchgrass And Miscanthus RhizosphereMPSRSSVGVYDRPHPLRMRKVVVPMLIAAVVAVAYAIGWYVG*
Ga0070662_10130020913300005457Corn RhizosphereITMAEPSRKSVGVYDRPHPLRTRKVLIPVIVAIVVAAAYALWAYLA*
Ga0070681_1132033223300005458Corn RhizosphereMPSPPRNTVGVYDRPHPLRTRKVLVPVLAAVVVTIAYALWWYLA*
Ga0068867_10201314213300005459Miscanthus RhizosphereHQSARILMPEPSRKSVGVYDRPHPLRTRKVLLPVVIAIVVAAVYAMWAYLT*
Ga0070696_10101646823300005546Corn, Switchgrass And Miscanthus RhizosphereMPRTVGVYDRPHPLRTRKVLVPLAVAAVAGLAYALWFYLR*
Ga0068855_10003388543300005563Corn RhizosphereMPSRSSVGVYDRPHPLRTRKVVVPVLIAVVVAVAYAIWWYVG*
Ga0068864_10094371533300005618Switchgrass RhizosphereRPSTEARITMAEPSRKSVGVYDRPHPLRTRKVLIPVIVAIVVAAAYALWAYLA*
Ga0068870_1044783413300005840Miscanthus RhizosphereRNTVGVYDRPHPLRTRKVIVPVLVAVVVTIGYAVFFYLR*
Ga0075279_1002440123300005903Rice Paddy SoilVSVSIPRKAVGVYDRPHPFRTRRVLVPAAVVAVTIAAYALWFFLT*
Ga0075422_1020635813300006196Populus RhizosphereMTSPSRNTVGVYDRPHPLRTRKVMVPVLVAVVVTLGYAVFFY
Ga0097621_10025805423300006237Miscanthus RhizosphereMAEPSRKSVGVYDRPHPLRTRKVLIVIVAMVVAVAYALWAHFA*
Ga0097621_10109348323300006237Miscanthus RhizosphereMTAPSRNTVGVYDRPHPLRTRKVLVPVLVAVVVGIVYAVWWYVA*
Ga0079222_1003700823300006755Agricultural SoilMPRTVGVYDRPHPLRTRKVLVPLAVAAVAGLAYALWFYLS*
Ga0105248_1246216623300009177Switchgrass RhizosphereMTTPSRNTVGVYDRPHPLRTRKVLVPVLVAVVVAIVYAVWWYVA*
Ga0105237_1080500323300009545Corn RhizosphereLNPRPEFMSDPGKPTTAASRNSVGVYDRPHPLRTRKVLVPVVIFVLMALVYGLYFLLR*
Ga0134128_1008435213300010373Terrestrial SoilMERDRSRNAVGVYDRPPAWRTRKVLVPVAIFVVVAVAYALYFLR*
Ga0134122_1021752323300010400Terrestrial SoilMTAPSRNTVGVYDRPHPLRTRKVLVPAVVAVGVAILYGLWAYFA*
Ga0134121_1179243213300010401Terrestrial SoilMTTPSRNTVGVYDRPHPLRTRKVLVPVLVAVVVAIVYAVWWYLA*
Ga0150985_11022853323300012212Avena Fatua RhizosphereMTEPSRKSVGVYDRPHPLRTRKVLIPVIVALVVAAAYALWAYLA*
Ga0150985_11453050523300012212Avena Fatua RhizosphereMTTPSRNTVGVYDRPHPLRTRKVLVPVLVAVVVAIAYAVWWYVA*
Ga0150985_11973693223300012212Avena Fatua RhizosphereMTVPSRSTVGVYDRPHWLRTRKVVAPLVVAAIVAVGYAVWWYVA*
Ga0150985_12163755723300012212Avena Fatua RhizosphereMPSRNTVGVYDRPHPLRTRKVIVPVLVAVVVAIAYAVWWYVR*
Ga0150984_10144889913300012469Avena Fatua RhizosphereMTEPSRKSVGVYDRPHPLRTRKVLIPVIVAIVVTAA
Ga0150984_10456381123300012469Avena Fatua RhizosphereMTVPSRSTVGVYDRPHWLRTRKVVAPLLVAGIVAVGYAVWWYVA*
Ga0150984_11248713913300012469Avena Fatua RhizosphereMPEPSRKSVGVYDRPHPLRTRKVLLPVVIAIVVAAVYAMWAYLT*
Ga0150984_12081431323300012469Avena Fatua RhizosphereMPTPSRNTVGVYDRPHPLRTRKVLVPVLIAVVVAIAYAVWWYVA*
Ga0157301_1009911913300012911SoilMTSPSRNTVGVYDRPHPLRTRKVIVPVLVAVVVTIGYA
Ga0164298_1164504713300012955SoilVYDRPHPFRTRKVFVPVLVAVVVAIAYAIWWYVS*
Ga0164303_1061955923300012957SoilMAPPSRSAVGVYERPHPLRTRKVLIPALVAIVTAMGYGAWFYFR*
Ga0164304_1008323723300012986SoilMAPPSRSAVVVYERPHPLRTRKVLIPALVAIVTAMGYGAWFYFR*
Ga0164306_1033304423300012988SoilMARPSRSAVGVYERPHPLRTRKVLIPALVAIVTAMGYGAWFYFR*
Ga0164305_1103891713300012989SoilLRAPTMNDRPSGRSRNAVGVYERPHPLRTRKVLVPVVIFVLMALVYGLYFLLR*
Ga0164305_1150114123300012989SoilMTSPSRNTVGVYDRPHPLRTRKVIVPVLGAVVVTIGYAVFFYLR*
Ga0157373_1000873943300013100Corn RhizosphereMNDRPSGLSRNAVGVYERPHPLRTRKVLVPVVIFVLMALVYGLYFLLR*
Ga0157371_1074873623300013102Corn RhizosphereMERDRSRNAVGVYDRPPAWRTRKVLVPVAIFVVVAVAYALYFLL*
Ga0157370_1007789033300013104Corn RhizosphereVPGGTVGVYDRPHPLRTRKVLVPAAIAVVVALGYAGWFYLR*
Ga0157370_1014092213300013104Corn RhizosphereHSYLRAPTMNDRPSGRSRNAVGVYERPHPLRTRKVLVPVVIFVLMALVYGLYFLLR*
Ga0157370_1036367423300013104Corn RhizosphereMDQGRSRNAVGVYDRPPAWRTRKVLVPVAIFVVVAIAYTLYFLL*
Ga0157369_1004009443300013105Corn RhizosphereMTMPSRSSVGVYDRPHPLRTRKVVVPVLIAVVVAAAYAMWWYVG*
Ga0157369_1114147223300013105Corn RhizosphereMNDRPSGRSRNAVGVYERPHPLLTRKVLVPVVIFVLMALVYGLYFLLR*
Ga0157372_1019411223300013307Corn RhizosphereMPPPSRNTVGVYDRPHPLRTRKVLVPVLVAVVVMIGYALYFLLR*
Ga0157372_1035023413300013307Corn RhizosphereNAVGVYDRPPAWRTRKVLVPVAIFVAVAVAYALYFLR*
Ga0120127_1002712923300013503PermafrostMSLPSRSAVGVYDRPHPLRTRKVLIPALVAIVTAMGYGAWFYFR*
Ga0182008_1010268513300014497RhizosphereSIMDQGRSRNAVGVYDRPPAWRTRKVLVPVAIFVVVAIAYTLYFLL*
Ga0182008_1026046623300014497RhizosphereMESSMNAPSRKSVGIYDRPHPLRTRKVLVPVVIFVLMALVYGLYFLLR*
Ga0173483_1015719723300015077SoilMTSPSRNTVGVYDQPHPLRTRKVIVPVLVAVVVTIGYAVFFYLR*
Ga0173480_1037915413300015200SoilSARRRARTARPEETPMTSPSRNTVGVYDRPHPLRTRKVIVPVLVAVVVTIGYAVFFYLR*
Ga0132258_1119167823300015371Arabidopsis RhizosphereMSEGSRKAVGVYDRPHPLRTRKVLIPALVAIAVAVAYAVFAYFS*
Ga0132257_10003559153300015373Arabidopsis RhizosphereMPRTVGIYDRPHPLRTRKALVSLAVAAVVGLGYALWFFLR*
Ga0197907_1100131523300020069Corn, Switchgrass And Miscanthus RhizosphereMNDRPSGRSRNAVGVYERPHPLRTRKVLVPVVIFVLMALVYGLYFLLR
Ga0206356_1100572623300020070Corn, Switchgrass And Miscanthus RhizosphereMSDPGKPTTAASRNSVGVYDRPHPLRTRKVLVPTAIAVVVGIGYALWFYLR
Ga0206356_1153962323300020070Corn, Switchgrass And Miscanthus RhizosphereMDQGRSRNAVGVYDRPPAWRTRKVLVPVAIFVVVAVAYALYFLL
Ga0206351_1077845423300020077Corn, Switchgrass And Miscanthus RhizosphereMNDRPSGLSRNAVGVYERPHPLRTRKVLVPVVIFVLMALVYGLYFLLR
Ga0206354_1039642123300020081Corn, Switchgrass And Miscanthus RhizosphereMNDRPSGRSRNAVGVYERPHPLRTRKVLVPVVIFVLMALVYGLYFLMR
Ga0206353_1010975623300020082Corn, Switchgrass And Miscanthus RhizosphereMERDRSRNAVGVYDRPPAWRTRKVLVPVAIFVVVAVAYALYFLR
Ga0206353_1163176823300020082Corn, Switchgrass And Miscanthus RhizosphereMPGGTVGVYDRPHPLRTRKVLVPAAIAVVVALGYAGWFYLR
Ga0182009_1023797123300021445SoilMNAPSRKSVGIYDRPHPLRTRKVLIPVLVAVAVSAVYATWWWLAR
Ga0207656_1002451423300025321Corn RhizosphereMPPPSRNTVGVYDRPHPLRTRKVLVPVLVAVVVIIGYALYFLLR
Ga0207692_1119927213300025898Corn, Switchgrass And Miscanthus RhizosphereRCHSYLRAPTMNDRPSGRSRNAVGVYERPHPLRTRKVLVPVVIFVLMALVYGLYFLLR
Ga0207680_1024317723300025903Switchgrass RhizosphereMAEPSRKSVGVYDRPHPLRTRKVLIPVIVAIVVAVAYALWAHFA
Ga0207680_1034178423300025903Switchgrass RhizosphereMTMPSRSTVGVYDRPHPLRTRKVMVPVIVAIVVTIAYAIWWYVA
Ga0207680_1038826013300025903Switchgrass RhizosphereEGTPMTSPSRNTVGVYDRPHPLRTRKVIVPVLVAVVVTIGYAVFFYLR
Ga0207654_1054646023300025911Corn RhizosphereMPRTVGVYDRPHPLRTRKVLVPLAVAAVAGLAYALWFYLR
Ga0207649_1034632223300025920Corn RhizosphereMPSRSSVGVYDRPHPLRTRKVVVPVLIAVVVAVAYAIWWYVG
Ga0207681_1085052123300025923Switchgrass RhizosphereMAEPSRKSVGVYDRPHPLRTRKVLIPVLVALVVAAAYALWAYLA
Ga0207650_1010485923300025925Switchgrass RhizosphereMPPPQSRNTVGVYDRPHPLRTRKVLVPVLMAVVVVIAYALYFMLR
Ga0207701_1015407523300025930Corn, Switchgrass And Miscanthus RhizosphereMAEPSRKSVGVYDQPHPLRTRKVLIPVIVAIVVAVAYALWAHFA
Ga0207644_1031219823300025931Switchgrass RhizosphereMTSPSRNTVGVYDRPHPLRTRKVIVPVLVAVVVTI
Ga0207644_1170905513300025931Switchgrass RhizosphereMTTPSRNTVGVYDRPHPLRTRKVLVPVLVAVVVAIVYAVWWYLA
Ga0207690_1031037623300025932Corn RhizosphereMPSRSSVGVYDRPHPLRTRKVVVPVLIAVVVAAAYAMWWYVG
Ga0207706_1033503623300025933Corn RhizosphereMTGGPRKAVGVYDRPHPLRTRKVLVPVVIFVLMALVYGLYFLLR
Ga0207706_1067178523300025933Corn RhizosphereMAEPSRKSVGVYDRPHPLRTRKVLIPVIVAIVVAAAYALWAYLA
Ga0207711_1054433013300025941Switchgrass RhizosphereMTSPSRNTVGVYDRPHPLRTRKVIVPVLVAVVVTIG
Ga0207689_1021059513300025942Miscanthus RhizosphereMPPPSRNTVGVYDRPHPLRTRKVLLPVLVAVVVIIGYALYFLLR
Ga0207661_1190116923300025944Corn RhizosphereGRRFSSIMDQGRSRNAVGVYDRPPAWRTRKVLVPVAIFAVVAIAYTLYFLL
Ga0207679_1042432023300025945Corn RhizosphereSRVRARQVGPSMTMPSRSSVGVYDRPHPLRTRKVVVPVLIAVVVAAAYAMWWYVG
Ga0207667_1186228513300025949Corn RhizosphereAPRPEFMSDPGKPTTAASRNSVGVYDRPHPLRTRKVLVPTAIAVVVGIGYALWFYLR
Ga0207702_1015192433300026078Corn RhizosphereMPSRSSVGVYDRPHPLRTRKVVVPVLIAAVVAAAYAIGWYVG
Ga0207648_1049267413300026089Miscanthus RhizosphereDPQPRRVSSMAEPSRKSVGVYDQPHPLRTRKVLIPVIVAIVVAVAYALWAHFA
Ga0207676_1091906923300026095Switchgrass RhizosphereVGVYDRPHPLRTRKVLIPVIVAIVVAVAYALWAHFA
Ga0207674_1144818223300026116Corn RhizosphereVDQGRSRNAVGVYDRPPAWRTRKVLVPLAIFVVVAIAYTLYFLL
Ga0209984_105018123300027424Arabidopsis Thaliana RhizosphereMNAPSRKSVGIYDRPHPLRTRKVLIPALVAVAVSAVYAAWWWFAR
Ga0209177_1017033013300027775Agricultural SoilMPRTVGVYDRPHPLRTRKVLVPLAVAAVAGLAYAL
Ga0268266_1156613423300028379Switchgrass RhizosphereMTSPSRNTVGVYDRPHPLGTRKVMVPVLVAVVVTIGYAVFFYLR
Ga0247828_1015662913300028587SoilAPTARPEEIPMTSPSRNTVGVYDRPHPLRTRKVMVPVLVAVVVTIGYAVFFYLR
Ga0247820_1056540313300028597SoilMPSPSRNTVGVYDRPHPLRTRKVIVPVLVAVVVTIGYA
Ga0247827_1125995823300028889SoilMPSPSRNTVGVYDRPHPLRTRKVIVPVLVAVVVTIGYAVFFYLR
Ga0308189_1017775923300031058SoilMTPPSRNTVGVYDRPHPWRTRKVLVPVVVAIVVAIGYALYFYLR
Ga0310813_1054905813300031716SoilEAMPPPSRNTVGVYDRPHPLRTRKVLVPVLVAVVVIIGYALSFLLR
Ga0310813_1080591113300031716SoilMDQGRSRNAVGVYDRPPAWRTRKVLVPVAIFVVVAIAYTLYFLL
Ga0307413_1188982423300031824RhizosphereMAPPSRNSVGVYDRPSPWRTRKVLLPAIVAVVVGIAYALWAYFT
Ga0310900_1044443223300031908SoilMTSPSRNTVGVYDRPHPLRTRKVVVPVLVAVVVTIGYAVFFYLR
Ga0308175_10026781423300031938SoilMNDHRNRRSRNAVGVYDRPHPLRTRKVLVPVVIFVLMALVYGLYFLLR
Ga0308175_10036322323300031938SoilTPTRSSVGVYDRPHPLRTRKVLVPVAIVVAIAIAYAIYFLLR
Ga0308175_10050043223300031938SoilMNDRRNGSSRNAVGIYDRPHPLRTRKVLVPVGIFVLMALVYGLYFLLR
Ga0308175_10053230023300031938SoilMNDRRNGRSRNAVGVYDRPHPLRTRRVLVPVVIFVLIAIVYALYFLLR
Ga0308175_10117586723300031938SoilVNDTRNGRARGTVGVYNRPHPLRTRKVLVPAVIFVLIAIAYALYFLLR
Ga0308174_1004670443300031939SoilMTTPSRNTVGVYDRPHPLRTRKVMVPVVIAVIVAVAYAIWWYVA
Ga0310884_1049465013300031944SoilARPEETPMTSPSRNTVGVYDRPHPLRTRKVIVPVLVAVVVTIGYAVFFYLR
Ga0308176_1047491313300031996SoilGVYNRPHPLRTRKVLVPAVIFVLIAIAYALYFLLR
Ga0308176_1247096323300031996SoilVNDTGNGRSRGTVGVYDRPHPLRTRKVLVPAVIFVLIAIAYVLYFLLR
Ga0310810_1071225523300033412SoilMTMPSRSSVGVYDRPHPLRTRKVVVPVLIAAVVAAAYAIWWYVG
Ga0310811_1090676923300033475SoilVGVYDRPHPLRTRKVLVPVLVAVVVTIGYAVFFYLR
Ga0316620_1007494823300033480SoilMPATRNAVGVYDRPHPLRTRKALVAAAIALVVALGYGLWFALR
Ga0316624_1082352023300033486SoilAMPATRNAVGVYDRPHPLRTRKALVAAAIALVVALGYGLWFALR
Ga0316628_10017022713300033513SoilMTSSRNAVGVYDRPHPLRTRKALVAAGISLVVAAGYAAWFYFR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.