Metagenome Family F057408

Basic Information
Family ID	F057408
Family Type	Metagenome
Number of Sequences	136
Average Sequence Length	41 residues
Representative Sequence	KKSLIIVHKVAFVLVKSCNSVEDVWVHPCSEMSWVRQEWHTGS
Number of Associated Samples	59
Number of Associated Scaffolds	136

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	0.00 %
% of genes near scaffold ends (potentially truncated)	96.32 %
% of genes from short scaffolds (< 2000 bps)	96.32 %
Associated GOLD sequencing projects	58
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.30

Most Common Taxonomy
Group	Unclassified (100.000 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (91.912 % of family members)
Environment Ontology (ENVO)	Unclassified (94.118 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (94.118 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	Yes	Secondary Structure distribution:	α-helix: 23.94% β-sheet: 0.00% Coil/Unstructured: 76.06%
Feature Viewer

Powered by Feature Viewer

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	100.00 %

Scaffold	Taxonomy	Length	IMG/M Link
3300005338\|Ga0068868_101171434	Not Available	710	Open in IMG/M
3300005459\|Ga0068867_100727043	Not Available	878	Open in IMG/M
3300006358\|Ga0068871_101429118	Not Available	652	Open in IMG/M
3300015274\|Ga0182188_1013609	Not Available	745	Open in IMG/M
3300015275\|Ga0182172_1019126	Not Available	741	Open in IMG/M
3300015277\|Ga0182128_1012663	Not Available	837	Open in IMG/M
3300015279\|Ga0182174_1012826	Not Available	857	Open in IMG/M
3300015279\|Ga0182174_1023710	Not Available	728	Open in IMG/M
3300015279\|Ga0182174_1058985	Not Available	564	Open in IMG/M
3300015279\|Ga0182174_1071143	Not Available	533	Open in IMG/M
3300015281\|Ga0182160_1017714	Not Available	777	Open in IMG/M
3300015282\|Ga0182124_1024840	Not Available	705	Open in IMG/M
3300015282\|Ga0182124_1054248	Not Available	569	Open in IMG/M
3300015282\|Ga0182124_1059814	Not Available	553	Open in IMG/M
3300015283\|Ga0182156_1008987	Not Available	957	Open in IMG/M
3300015283\|Ga0182156_1015400	Not Available	826	Open in IMG/M
3300015283\|Ga0182156_1028336	Not Available	699	Open in IMG/M
3300015286\|Ga0182176_1055294	Not Available	578	Open in IMG/M
3300015288\|Ga0182173_1073213	Not Available	529	Open in IMG/M
3300015291\|Ga0182125_1012957	Not Available	884	Open in IMG/M
3300015292\|Ga0182141_1040902	Not Available	643	Open in IMG/M
3300015295\|Ga0182175_1043493	Not Available	642	Open in IMG/M
3300015295\|Ga0182175_1045494	Not Available	634	Open in IMG/M
3300015296\|Ga0182157_1073563	Not Available	558	Open in IMG/M
3300015299\|Ga0182107_1066691	Not Available	578	Open in IMG/M
3300015300\|Ga0182108_1008938	Not Available	1033	Open in IMG/M
3300015300\|Ga0182108_1057459	Not Available	609	Open in IMG/M
3300015300\|Ga0182108_1064544	Not Available	588	Open in IMG/M
3300015302\|Ga0182143_1022928	Not Available	783	Open in IMG/M
3300015302\|Ga0182143_1045683	Not Available	646	Open in IMG/M
3300015302\|Ga0182143_1050403	Not Available	628	Open in IMG/M
3300015303\|Ga0182123_1079355	Not Available	537	Open in IMG/M
3300015304\|Ga0182112_1023331	Not Available	783	Open in IMG/M
3300015304\|Ga0182112_1048558	Not Available	636	Open in IMG/M
3300015304\|Ga0182112_1063889	Not Available	587	Open in IMG/M
3300015304\|Ga0182112_1083146	Not Available	542	Open in IMG/M
3300015307\|Ga0182144_1015052	Not Available	896	Open in IMG/M
3300015307\|Ga0182144_1023477	Not Available	791	Open in IMG/M
3300015307\|Ga0182144_1033362	Not Available	715	Open in IMG/M
3300015307\|Ga0182144_1041006	Not Available	674	Open in IMG/M
3300015308\|Ga0182142_1087929	Not Available	547	Open in IMG/M
3300015314\|Ga0182140_1015478	Not Available	906	Open in IMG/M
3300015314\|Ga0182140_1028824	Not Available	762	Open in IMG/M
3300015314\|Ga0182140_1074438	Not Available	578	Open in IMG/M
3300015314\|Ga0182140_1099244	Not Available	528	Open in IMG/M
3300015321\|Ga0182127_1016624	Not Available	921	Open in IMG/M
3300015321\|Ga0182127_1036403	Not Available	734	Open in IMG/M
3300015321\|Ga0182127_1073581	Not Available	596	Open in IMG/M
3300015321\|Ga0182127_1109954	Not Available	523	Open in IMG/M
3300015321\|Ga0182127_1117202	Not Available	512	Open in IMG/M
3300015322\|Ga0182110_1082608	Not Available	573	Open in IMG/M
3300015323\|Ga0182129_1086668	Not Available	550	Open in IMG/M
3300015323\|Ga0182129_1093591	Not Available	537	Open in IMG/M
3300015341\|Ga0182187_1070649	Not Available	728	Open in IMG/M
3300015341\|Ga0182187_1118266	Not Available	609	Open in IMG/M
3300015342\|Ga0182109_1048266	Not Available	881	Open in IMG/M
3300015344\|Ga0182189_1031101	Not Available	1023	Open in IMG/M
3300015344\|Ga0182189_1139231	Not Available	608	Open in IMG/M
3300015345\|Ga0182111_1008086	Not Available	1625	Open in IMG/M
3300015345\|Ga0182111_1018206	Not Available	1275	Open in IMG/M
3300015345\|Ga0182111_1020613	Not Available	1226	Open in IMG/M
3300015345\|Ga0182111_1069594	Not Available	808	Open in IMG/M
3300015345\|Ga0182111_1106996	Not Available	691	Open in IMG/M
3300015345\|Ga0182111_1168831	Not Available	581	Open in IMG/M
3300015345\|Ga0182111_1220683	Not Available	523	Open in IMG/M
3300015345\|Ga0182111_1221125	Not Available	523	Open in IMG/M
3300015346\|Ga0182139_1102622	Not Available	702	Open in IMG/M
3300015346\|Ga0182139_1124558	Not Available	653	Open in IMG/M
3300015347\|Ga0182177_1056811	Not Available	875	Open in IMG/M
3300015351\|Ga0182161_1179441	Not Available	591	Open in IMG/M
3300015351\|Ga0182161_1190686	Not Available	576	Open in IMG/M
3300015355\|Ga0182159_1152250	Not Available	722	Open in IMG/M
3300015355\|Ga0182159_1311154	Not Available	530	Open in IMG/M
3300015361\|Ga0182145_1067584	Not Available	716	Open in IMG/M
3300015361\|Ga0182145_1153500	Not Available	544	Open in IMG/M
3300015361\|Ga0182145_1155063	Not Available	543	Open in IMG/M
3300017404\|Ga0182203_1015329	Not Available	1044	Open in IMG/M
3300017404\|Ga0182203_1025223	Not Available	903	Open in IMG/M
3300017404\|Ga0182203_1048575	Not Available	744	Open in IMG/M
3300017404\|Ga0182203_1078337	Not Available	639	Open in IMG/M
3300017404\|Ga0182203_1162007	Not Available	504	Open in IMG/M
3300017407\|Ga0182220_1046065	Not Available	640	Open in IMG/M
3300017407\|Ga0182220_1085811	Not Available	538	Open in IMG/M
3300017409\|Ga0182204_1077202	Not Available	576	Open in IMG/M
3300017409\|Ga0182204_1110011	Not Available	516	Open in IMG/M
3300017410\|Ga0182207_1052374	Not Available	751	Open in IMG/M
3300017410\|Ga0182207_1073691	Not Available	674	Open in IMG/M
3300017410\|Ga0182207_1077553	Not Available	663	Open in IMG/M
3300017411\|Ga0182208_1042325	Not Available	708	Open in IMG/M
3300017411\|Ga0182208_1103221	Not Available	540	Open in IMG/M
3300017413\|Ga0182222_1019593	Not Available	779	Open in IMG/M
3300017420\|Ga0182228_1048713	Not Available	721	Open in IMG/M
3300017420\|Ga0182228_1079390	Not Available	600	Open in IMG/M
3300017424\|Ga0182219_1037294	Not Available	759	Open in IMG/M
3300017424\|Ga0182219_1040914	Not Available	736	Open in IMG/M
3300017425\|Ga0182224_1025037	Not Available	901	Open in IMG/M
3300017425\|Ga0182224_1094978	Not Available	602	Open in IMG/M
3300017427\|Ga0182190_1068904	Not Available	678	Open in IMG/M
3300017430\|Ga0182192_1024761	Not Available	972	Open in IMG/M
3300017430\|Ga0182192_1164275	Not Available	512	Open in IMG/M
3300017433\|Ga0182206_1088600	Not Available	607	Open in IMG/M
3300017433\|Ga0182206_1088649	Not Available	607	Open in IMG/M
3300017433\|Ga0182206_1102698	Not Available	579	Open in IMG/M
3300017436\|Ga0182209_1142405	Not Available	537	Open in IMG/M
3300017438\|Ga0182191_1033473	Not Available	877	Open in IMG/M
3300017442\|Ga0182221_1001296	Not Available	2253	Open in IMG/M
3300017442\|Ga0182221_1005868	Not Available	1384	Open in IMG/M
3300017442\|Ga0182221_1021197	Not Available	946	Open in IMG/M
3300017442\|Ga0182221_1039165	Not Available	788	Open in IMG/M
3300017442\|Ga0182221_1110563	Not Available	576	Open in IMG/M
3300017442\|Ga0182221_1157470	Not Available	515	Open in IMG/M
3300017443\|Ga0182193_1017801	Not Available	1091	Open in IMG/M
3300017443\|Ga0182193_1022597	Not Available	1017	Open in IMG/M
3300017443\|Ga0182193_1075691	Not Available	697	Open in IMG/M
3300017443\|Ga0182193_1092860	Not Available	652	Open in IMG/M
3300017443\|Ga0182193_1109955	Not Available	616	Open in IMG/M
3300017443\|Ga0182193_1131725	Not Available	579	Open in IMG/M
3300017443\|Ga0182193_1138590	Not Available	569	Open in IMG/M
3300017443\|Ga0182193_1181142	Not Available	518	Open in IMG/M
3300017684\|Ga0182225_1042997	Not Available	732	Open in IMG/M
3300017684\|Ga0182225_1136185	Not Available	512	Open in IMG/M
3300017686\|Ga0182205_1064029	Not Available	699	Open in IMG/M
3300017690\|Ga0182223_1013119	Not Available	923	Open in IMG/M
3300017690\|Ga0182223_1056293	Not Available	627	Open in IMG/M
3300021060\|Ga0182232_1021733	Not Available	1114	Open in IMG/M
3300021060\|Ga0182232_1054089	Not Available	663	Open in IMG/M
3300021060\|Ga0182232_1077302	Not Available	541	Open in IMG/M
3300025942\|Ga0207689_10877749	Not Available	757	Open in IMG/M
3300025942\|Ga0207689_11212089	Not Available	635	Open in IMG/M
3300025942\|Ga0207689_11724241	Not Available	519	Open in IMG/M
3300026089\|Ga0207648_10673485	Not Available	957	Open in IMG/M
3300026089\|Ga0207648_11799122	Not Available	574	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	94.12%
Rhizoplane	Host-Associated → Plants → Rhizoplane	5.15%
Roots	Host-Associated → Plants → Roots	0.74%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	94.12%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	5.15%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.74%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	94.12%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	5.15%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.74%

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	91.91%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	5.15%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	2.21%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.74%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Host-Associated	Open in IMG/M
3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Host-Associated	Open in IMG/M
3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Host-Associated	Open in IMG/M
3300015274	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015275	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015277	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015279	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015281	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015282	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015283	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015286	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015288	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015291	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015292	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015295	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015298	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015299	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015302	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015307	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015308	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015321	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015323	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015342	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017407	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017409	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017420	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017424	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017427	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017430	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017433	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017436	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017438	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017684	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017686	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017690	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300021060	Phyllosphere microbial comminities from miscanthus, Michigan, USA - G6R3_NF_07NOV2016_LD2 MG	Host-Associated	Open in IMG/M
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0068868_1011714341	3300005338	Miscanthus Rhizosphere	LIIVHKAAFVSVKSCNSIEDVWVHPCSEMSWVRQEWHIGS*
Ga0068867_1007270432	3300005459	Miscanthus Rhizosphere	PRYFSKKSLIIVHKVAFVLVKSCNSVEDVWVHPCSEMNWVGQEWHIRS*
Ga0068871_1014291181	3300006358	Miscanthus Rhizosphere	IIVHKAAFVLVKSCNSVEDVWVHLCSETSWVRQELLTGS*
Ga0182188_10136091	3300015274	Miscanthus Phyllosphere	FSKKFLIIVHKVAFVLVKSCNSVEDVWVHPCFEMSWVRQEWHTGS*
Ga0182172_10191261	3300015275	Miscanthus Phyllosphere	FVSVKSCNFVEDVCVHPCSETRWVRKEWHIGSKGG*
Ga0182128_10126631	3300015277	Miscanthus Phyllosphere	GHKAAFVSVKSCNSVEEVWVHLCSEMGWVREEWHTGS*
Ga0182174_10128261	3300015279	Miscanthus Phyllosphere	IVHKVAFVLVKSFNSVEDVWVHPCSETSWVRQELLTGS*
Ga0182174_10237101	3300015279	Miscanthus Phyllosphere	KSLIIVHKVAFVSMKSCNSVEDVWVHPCSEMSWVKQEWHTRS*
Ga0182174_10589851	3300015279	Miscanthus Phyllosphere	HKDTFVSVNSCNSVEDVWVHPCSEMSWVMQEWHIGS*
Ga0182174_10711431	3300015279	Miscanthus Phyllosphere	PELVKMAPRDFSKKSLIIVHKAAFVLVKSCNSVEDVWVHPCSETGWVRQELLTGS*
Ga0182160_10177141	3300015281	Miscanthus Phyllosphere	DFSKKSLIIVHKVAFVSVKSYNSVDDVWVHPCSKTSWVRQEWHTGS*
Ga0182124_10248401	3300015282	Miscanthus Phyllosphere	MVPKAVFVLVKSCNSVEDVWVHPCFETSWVRQELL
Ga0182124_10542481	3300015282	Miscanthus Phyllosphere	DFSKKSLIIVYKVAFVSVKSCNSVQDVWVHLRSEMSWVR*
Ga0182124_10598141	3300015282	Miscanthus Phyllosphere	IGHKAAFVLVKSCNSVEEVWVHLCSEMSWVREEWHTGS*
Ga0182156_10089871	3300015283	Miscanthus Phyllosphere	HKEVFVSVSSCYSVEDVYVHLCSKTSWVRQEWHTGS*
Ga0182156_10154001	3300015283	Miscanthus Phyllosphere	MGHKEVFVSVSSCNSIEDVWVHLCSEMSWVRQEWHTG
Ga0182156_10283361	3300015283	Miscanthus Phyllosphere	APSDFSKKSLIIVHKVAFVSVKSYNSVDDVWVHPCSKTSWVRQEWHTGS*
Ga0182176_10552941	3300015286	Miscanthus Phyllosphere	QKWAPSDFSKKSLIIVHKVAFVSVKSCNSIEDVWVHPCSEISWVRQEWHIRS*
Ga0182173_10732131	3300015288	Miscanthus Phyllosphere	GHKAAFVLVKSCNSVEDVWVHPFSETSQVGQEWHIRS*
Ga0182125_10129571	3300015291	Miscanthus Phyllosphere	SDFSKKSLIIVHKVAFVLVKSCNSVEDVWVHPCSEMSWVRQEWHTGS*
Ga0182141_10409021	3300015292	Miscanthus Phyllosphere	LIIVHKVAFVSVKSCNSVKDVWVHPCSEMSWVRQEWHTRS*
Ga0182175_10434931	3300015295	Miscanthus Phyllosphere	KEAVVSVNSCNSVEDVWVHPCSEMSWVRQEWHTGS*
Ga0182175_10454941	3300015295	Miscanthus Phyllosphere	IIGHKAAFVLVKSCNFIEEVSVHPCPEMSWVREEWHTGS*
Ga0182157_10735631	3300015296	Miscanthus Phyllosphere	QKWAPSDFSKKSLIIVHKVAFVLGKSYNSVEDVWVHPCFETSWVRQEWHTGS*
Ga0182106_10735181	3300015298	Miscanthus Phyllosphere	HKVAFVLVKSCNSVEDVWINLCSDTSWVRQELLIGS*
Ga0182107_10666911	3300015299	Miscanthus Phyllosphere	IGHKAAFVSVKSCNSVEEVWVHPCFETSLVKQEWHTES*
Ga0182108_10089381	3300015300	Miscanthus Phyllosphere	DFSKKSLIIVHKVAFISVKSCNSVEDVWVHPFSEMSWVRQEWHTGS*
Ga0182108_10574591	3300015300	Miscanthus Phyllosphere	HKAAFVLVKSCNSVEDVWVHPCFETTWVRQELLTGSWAR*
Ga0182108_10645441	3300015300	Miscanthus Phyllosphere	VKKSLIIVHKVAFVSVKSYNSVEDVWVNLCSKMSWVR*
Ga0182143_10229282	3300015302	Miscanthus Phyllosphere	IIVHKVAFVSVKSCNSVEDVWVHPCSESSWVRQELLIGS*
Ga0182143_10456831	3300015302	Miscanthus Phyllosphere	IVHKVAFVLVKSCNSVEDVWVHPCSEMSWVRQEWHIGS*
Ga0182143_10504031	3300015302	Miscanthus Phyllosphere	LIIVHKAAFVLVKSCNSVEDVWVHPCSKMSWVRQELLTGS*
Ga0182123_10793551	3300015303	Miscanthus Phyllosphere	KWGPRDFSKKSLIIVHNAAFVLVKSCNSVDDVWVHPCSEMSWIRKELLI*
Ga0182112_10233311	3300015304	Miscanthus Phyllosphere	FSKKSLIIVHKAAFVSVKSCNSVEDVWVHQCSETRWVRQEWYTGS*
Ga0182112_10485581	3300015304	Miscanthus Phyllosphere	KSLIIVHKAAFVSVKSCNSVEDVWVHQCSETSWVRQEWLTGS*
Ga0182112_10638891	3300015304	Miscanthus Phyllosphere	IGHKEAFVSVNSCNSIEDLWVHPCSEMSWVRQEWHIAS*
Ga0182112_10831461	3300015304	Miscanthus Phyllosphere	IVHKVAFVSVKSCNSVEDVWVHLCFETSWVRQEWHAGS*
Ga0182144_10150521	3300015307	Miscanthus Phyllosphere	SLIIVHKVAFVSVKSCNSVEDVWVHPCSEMSWVGQEWHIGS*
Ga0182144_10234772	3300015307	Miscanthus Phyllosphere	SKKSLIIVHKAVFVSVKSCNSVEDVWVHLCSEISWVMQEWHTGS*
Ga0182144_10333621	3300015307	Miscanthus Phyllosphere	SKKSLIIVHKAAFVSLKSCNSVEDVWVNPCSEMSWVRQKWHTGS*
Ga0182144_10410061	3300015307	Miscanthus Phyllosphere	KEAFVSVNSCNSIEDVRVHPCSEMSWLREEWHTRS*
Ga0182142_10879291	3300015308	Miscanthus Phyllosphere	WAPSDFSKKSLIIVHKVAFVSVKSYNSVEDVWVHPCFETSWVRQEWHTGS*
Ga0182140_10154781	3300015314	Miscanthus Phyllosphere	KKSLIIVHKVAFVSVKSCNSIEDVWVHPCSEISWVRQEWHIRS*
Ga0182140_10288241	3300015314	Miscanthus Phyllosphere	FSKKSLIIVHKVTLVLVKSCNSVKDVWVHLCAEMSWVRQECHTRS*
Ga0182140_10744381	3300015314	Miscanthus Phyllosphere	SDFCKKSLIIVHKVAFVSVKSYNSVEDVWVNPCSEMSWVRQEWHIGSLAR*
Ga0182140_10992441	3300015314	Miscanthus Phyllosphere	KAAFVLVKSCNSVEDVWVHLCSETSWVRQELLTGS*
Ga0182127_10166241	3300015321	Miscanthus Phyllosphere	KSLIIVHKVVFVSVKSCNSVEDVWVHSCSETSWVRQELLIGS*
Ga0182127_10364031	3300015321	Miscanthus Phyllosphere	PREFSKKSLIIVHKAAFVSVKSCNSIEDVYVHLCSEMSWVRQELLIES*
Ga0182127_10735811	3300015321	Miscanthus Phyllosphere	IVHKVAFVSVKSCNSVEDVWVHPCSETSWVRQEWHIGS*
Ga0182127_11099541	3300015321	Miscanthus Phyllosphere	SDFCKKSLIIVHKVAFVSVKSYNSIEDVWVNPCSEMSWVRQKWHTGS*
Ga0182127_11172021	3300015321	Miscanthus Phyllosphere	DFSKKSLIIVHKAAFVLVKSCNSVEDVWVHPCSEASWVRQELLIGS*
Ga0182110_10826081	3300015322	Miscanthus Phyllosphere	PRDFSKKSLIIVHKAAFVLVKCCNFVEDVWVHPCSKMSWVRQELLIGS*
Ga0182129_10866681	3300015323	Miscanthus Phyllosphere	KKYLIIVHKAAFVLVKSCNSVKDVWVHTCSETSSVRQEWDIGS*
Ga0182129_10935911	3300015323	Miscanthus Phyllosphere	VHKVAFVLVKSCNSVEDVWVHPCSEMSWVRQEWHIGS*
Ga0182187_10706491	3300015341	Miscanthus Phyllosphere	IIVHKVAFVLVKSCNSVEDVWVHPCSKTRWVRQEWHTGS*
Ga0182187_11182661	3300015341	Miscanthus Phyllosphere	VHKVAFVLVKSCNSVEDVWVLLCSETSWVRQEELTQS*
Ga0182109_10482661	3300015342	Miscanthus Phyllosphere	SKKSLIIVHKATFVSVKSCNSVEDVWVNPCSEMSWGRQQWHTGS*
Ga0182189_10311011	3300015344	Miscanthus Phyllosphere	SLIIGHKEVFVSVSSCNSVEDVWVHLCSETSWVRQEWHIGSYGGQLR*
Ga0182189_11392311	3300015344	Miscanthus Phyllosphere	VHKVAFVLVKSCNSVEDVWVHSCSKTSWVKQEWHTGS*
Ga0182111_10080861	3300015345	Miscanthus Phyllosphere	PLIIGHKEAFVSVKSCNSIEDVWVHLCSKMSWVRKEWHTGS*
Ga0182111_10182061	3300015345	Miscanthus Phyllosphere	SLIIVHKVAFVSVKSYNSIEDVWVHPCSEMSWVR*
Ga0182111_10206131	3300015345	Miscanthus Phyllosphere	LEIFSKKSLIIVHKVAFVSVKSCNSVEDVWVHPCFETSWVRQEWHRGS*
Ga0182111_10695941	3300015345	Miscanthus Phyllosphere	FSKKSLIIVHKAAFVLVKSCNFVEDVWVHSCSEMSWVRQEWHTGS*
Ga0182111_11069961	3300015345	Miscanthus Phyllosphere	LIIGHKDTFVSVNSCNSVEDVWVHPCSEMSWVRQEWHIGS*
Ga0182111_11688311	3300015345	Miscanthus Phyllosphere	KKSLIIVHKVAFVSVKSYNSVEDVWVNPCSEMSWVRQEWHTGS*
Ga0182111_12206831	3300015345	Miscanthus Phyllosphere	SKKSLIIVHKVAFVLVKSCNSVEDVWVHPSSKTSWVRQ*
Ga0182111_12211251	3300015345	Miscanthus Phyllosphere	KKSLIIVHKVAFVSVKSCNSVEDVRVHPCFEMSWVR*
Ga0182139_11026221	3300015346	Miscanthus Phyllosphere	APSDFSKKSLIIVHKVAFVSVKSCNSVEDVWVHPCFEMSWVRQEWHIGS*
Ga0182139_11245581	3300015346	Miscanthus Phyllosphere	DFSKKSLIMVHKVAFVLVKSCNSVEDVWVHPCSEMSSVR*
Ga0182177_10568111	3300015347	Miscanthus Phyllosphere	HKEVFVSVSSYNSIEDVWVHLYSKTSWVRQEWHTGS*
Ga0182161_11794411	3300015351	Miscanthus Phyllosphere	KKSLIIVHKAAFVLVKSCNSVEDVWVHPCSEMSWVRQELLTGS*
Ga0182161_11906861	3300015351	Miscanthus Phyllosphere	MVHKVAFVLVKSCNSVEDVWVHPCSEMSWVRQEWH
Ga0182161_12031261	3300015351	Miscanthus Phyllosphere	AAFVLVKSFNSVEDVWVHPCSDTSWVRQEWHIGS*
Ga0182159_11284301	3300015355	Miscanthus Phyllosphere	DFSKKSLIIVHKVAFVSVKSCNSIEDVWVHPCSEMSWVR*
Ga0182159_11522501	3300015355	Miscanthus Phyllosphere	IGHKEAVVSVNSCNSVEDVWVHPCSEMSWVRQEWHTRS*
Ga0182159_13111541	3300015355	Miscanthus Phyllosphere	HKVAFVSVKSCNSIEDVWVHLRYETSWVWQEWHTGS*
Ga0182145_10675841	3300015361	Miscanthus Phyllosphere	KDTFVSVNSCNSVEDVWVHPCSEMSWVMQEWHIGS*
Ga0182145_11535001	3300015361	Miscanthus Phyllosphere	IGHKAAFVSVKSYNSVEEVWVHPCFETSLVKQEWHIGS*
Ga0182145_11550631	3300015361	Miscanthus Phyllosphere	IIGHKEAFVLVKSCNSIKEVWVHPCSEMSWVRKE*
Ga0182203_10153291	3300017404	Miscanthus Phyllosphere	VHKVVFVLVKSCNSVKDVWVHLCSETSWVRQEWHTGS
Ga0182203_10252231	3300017404	Miscanthus Phyllosphere	LIIVHKVAFVLVKSCNSVEDVWVHPCSKTRWVRQEWHTGS
Ga0182203_10485751	3300017404	Miscanthus Phyllosphere	IIVHKVAFVLVKSCNSIKDVWVHPCSETSWVKQELLTGS
Ga0182203_10783371	3300017404	Miscanthus Phyllosphere	IIVHKAAFVSVKSCNSVEDVWVHPCSETCWVRQEWHIGS
Ga0182203_11620071	3300017404	Miscanthus Phyllosphere	KSLIIVHKVAFVSVKSYNSVEDVWVHPCSETSWVR
Ga0182220_10460651	3300017407	Miscanthus Phyllosphere	FSKKSLIIVHKAAFVSVKSYNSVEDVWVHPCSEMSWVR
Ga0182220_10858111	3300017407	Miscanthus Phyllosphere	IVPKAVFVLVKSCNSVEDVWVHLCSETCWVRQELLTRS
Ga0182204_10772021	3300017409	Miscanthus Phyllosphere	RYFSKKSLIIVHKVAFVLVKSCNSVEDVWVHPCSEMSWVRQEWHTGS
Ga0182204_11100111	3300017409	Miscanthus Phyllosphere	GHKEAFVLVKSCNSVEDVLDHPCSKRSWVRQEWHTRGWTA
Ga0182207_10523741	3300017410	Miscanthus Phyllosphere	SKKSLIIVHKVVFVLVKSCNSVEDVWVHPCSETSWVRHEWHIGS
Ga0182207_10736911	3300017410	Miscanthus Phyllosphere	FFKKSLLIGHKAAFVSVKSCNSAEDVWVHWFFEMSWVRQEWHIGS
Ga0182207_10775531	3300017410	Miscanthus Phyllosphere	SLIIVHKVAFVSVKSCNSIEDVWVHPCSKMSWVRQEWHTGS
Ga0182208_10423251	3300017411	Miscanthus Phyllosphere	KSLIIGHKIVFVSVKSCNSVEEVWFHPCSEMSWVR
Ga0182208_11032211	3300017411	Miscanthus Phyllosphere	VHKAAFVLVKSCNSVEDVWVHPCSEMGWVRQELLTGN
Ga0182222_10195931	3300017413	Miscanthus Phyllosphere	IGHKTAFVLVKSYNSVEEVWFHPCSKTSWIRLEWHIGS
Ga0182228_10487131	3300017420	Miscanthus Phyllosphere	HKVAFVSVKSCNSVKDVWVHPCSETSWVRQEWHTRSLAR
Ga0182228_10793901	3300017420	Miscanthus Phyllosphere	KKSLIIVHKAAFVLVKSCNSVEDVWVHPCSEMSWVRQELLTGS
Ga0182219_10372941	3300017424	Miscanthus Phyllosphere	QKWAPSDFSKKSLIIVHKVAFVSVKSYNSIEDVWVHPCFETSWVRQEWHTGS
Ga0182219_10409141	3300017424	Miscanthus Phyllosphere	FCKKSLIIVHKVAFVSLKSCNSVEDVWVHLCSEMSWVRQELLTGS
Ga0182224_10250371	3300017425	Miscanthus Phyllosphere	KSLIIVHKAVFVLVKSCNSVEDVWVHSCSETSWVRHEWHTGS
Ga0182224_10949781	3300017425	Miscanthus Phyllosphere	KWDPRDFSKKSLIIVHKAAFVLVKSCNSVEDVWVHPCFEMSWVRQELLTGS
Ga0182190_10689041	3300017427	Miscanthus Phyllosphere	KKSLIIVHKAVFVLVKSCNSVEDVWVHPCSETCWVRHKWHTGS
Ga0182192_10247611	3300017430	Miscanthus Phyllosphere	SLIIVHKVAFVSVKSCNSVEDVWVHPCSETSWVTQEWHTGS
Ga0182192_11642751	3300017430	Miscanthus Phyllosphere	PRDFSKKSLIIVHKAAFVSVKSCNSVEDVWVHPCSETSWVRQEWLTGS
Ga0182206_10886001	3300017433	Miscanthus Phyllosphere	PSDFSKKSFIIVHKVAFVSVKSCYSVEDVWVHPCSEMSWIR
Ga0182206_10886491	3300017433	Miscanthus Phyllosphere	SKKSLIIVHKEVFVLVKSCNSVKDVWVYPCSETSWVRHEWHTGS
Ga0182206_11026981	3300017433	Miscanthus Phyllosphere	EKSLIIGHKTAFVLVKSYNSVEEVWFHPCSKTSWIRLEWHIGS
Ga0182209_11424051	3300017436	Miscanthus Phyllosphere	KKYLIIVHKVAFVSVKSCNSIEDVWVHPCSEMSWVR
Ga0182191_10334731	3300017438	Miscanthus Phyllosphere	KPLIIGHKETFVSVKSCNSVEDVWVHSCSEVSWVRKEWHTGR
Ga0182221_10012961	3300017442	Miscanthus Phyllosphere	MIGHKEVFVSVSSCYSVEDVYVHLCSKTSWVRQEWHTGS
Ga0182221_10058682	3300017442	Miscanthus Phyllosphere	PLEIFSKKSLIIVHKVAFVSVKSCNSVKDVWVHLCFETSWVRQEWHTGS
Ga0182221_10211971	3300017442	Miscanthus Phyllosphere	FSKKSLIIVHKAAFVSVKSCNSVEDIWVHLCSEMSWIRQELLTGS
Ga0182221_10391651	3300017442	Miscanthus Phyllosphere	DFSKKSLIIVHKAAFVSVKSYNSIEDVWVHPCSETSWVRQEWHTES
Ga0182221_11105631	3300017442	Miscanthus Phyllosphere	KEVFVSVSSCNSVEDVWVHLCSETSWVRQEWHTRS
Ga0182221_11574701	3300017442	Miscanthus Phyllosphere	VHKAVFVLVKSCNSVEDVWVHPCSETRWVRQEWLTGS
Ga0182193_10178011	3300017443	Miscanthus Phyllosphere	KSLIIVHKVAFVLVKSCNSVEDVWVLLCSETSWVRQEELTRS
Ga0182193_10225972	3300017443	Miscanthus Phyllosphere	SDFSKKSLIIVHKVAFVSVKSCNSIEDVWVHPCSELSWEWQQWHTGS
Ga0182193_10756911	3300017443	Miscanthus Phyllosphere	KSLIIVHKVAFVLVKSCNSVEDVWVLLCSETSWVRQEELTQS
Ga0182193_10928601	3300017443	Miscanthus Phyllosphere	WAPSDFSKKSLIIVHKVAFVSVKSYNSIEDVWVHPCFETSWVRQEWHTGS
Ga0182193_11099551	3300017443	Miscanthus Phyllosphere	KWAPRDFSKKSLIIVHKAAFVLVKSYNSIKDVWVHPCFEMSWVRQEWHTGS
Ga0182193_11317251	3300017443	Miscanthus Phyllosphere	LIIVHKVAFVSVKSCNSIEDVWVHPCSKMSWVMQELLIGS
Ga0182193_11385901	3300017443	Miscanthus Phyllosphere	IIGHKDTFVSVNSCNSVEDVWVHPCSEMSWVMQEWHIGS
Ga0182193_11811421	3300017443	Miscanthus Phyllosphere	HKVVFVLVKSCNSVKDVWVHLCSETSWVRQEWHTGS
Ga0182225_10429971	3300017684	Miscanthus Phyllosphere	SLIIGHKAAFVSVKSCNFVEEVWVHPFSEMSWVREEWHTGS
Ga0182225_11361851	3300017684	Miscanthus Phyllosphere	KVGPRYFSKKSLIIVHKVAFVLVKSCNSVEDVWVHPCSEMNWVGQEWHIRS
Ga0182205_10640291	3300017686	Miscanthus Phyllosphere	KKSLIIVHKVAFVSVKSCNSIKDVWVHPCSETSWVRQEWHTGS
Ga0182205_11193901	3300017686	Miscanthus Phyllosphere	SKKSLIIVHKVAFVSVKSCNSVEDVWVHPCSETSWIR
Ga0182223_10131191	3300017690	Miscanthus Phyllosphere	LIIGHKAAFVLVKSCNFIEEVSVHPCPEMSWVREEWHTGS
Ga0182223_10562931	3300017690	Miscanthus Phyllosphere	LIIGHKEAFVSMNSCNSVEDLWVHPCSEMSWVRQEWHTGS
Ga0182232_10217331	3300021060	Phyllosphere	SKKSLIIVHKAAFVLVKSCNSVEDVWVHPCSETSWVRKELLIGKLG
Ga0182232_10540891	3300021060	Phyllosphere	IIVHKVAFVSVKSYNSVEDVWVHPCFETSWVRQEWHTGS
Ga0182232_10773021	3300021060	Phyllosphere	VHKVAFVLGKSCNSVEDVWVQPCSEMSLVRQEWHTES
Ga0207689_108777491	3300025942	Miscanthus Rhizosphere	APSDFSKKSLIIVHKVAFVSVKSYNSVEDVWVHPCFETSWVRQEWHTGS
Ga0207689_112120891	3300025942	Miscanthus Rhizosphere	IIVHKVAFVLVKSCNSVGDVWVHPCFEMSWVRQEWHTGS
Ga0207689_117242411	3300025942	Miscanthus Rhizosphere	GHKKSVVSVKSCNSVEDAWVHPGSETSWVWQEWHTGN
Ga0207648_106734851	3300026089	Miscanthus Rhizosphere	KKSLIIVHKVAFVLVKSCNSVEDVWVHPCSEMSWVRQEWHTGS
Ga0207648_117991221	3300026089	Miscanthus Rhizosphere	KKSLIIVHKVAFVLVKSCNSVEDVWVHPCSEMNWVGQEWHIRS

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.30
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.30
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F057408

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign