Basic Information | |
---|---|
Family ID | F057343 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 136 |
Average Sequence Length | 43 residues |
Representative Sequence | EEFTADLNMKLGNLPVAAPAKDVLEPRFVDRALAKLGTYQKK |
Number of Associated Samples | 118 |
Number of Associated Scaffolds | 136 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 3.91 % |
% of genes near scaffold ends (potentially truncated) | 86.03 % |
% of genes from short scaffolds (< 2000 bps) | 83.09 % |
Associated GOLD sequencing projects | 112 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.35 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (92.647 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (23.529 % of family members) |
Environment Ontology (ENVO) | Unclassified (27.206 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.265 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 37.14% β-sheet: 0.00% Coil/Unstructured: 62.86% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 136 Family Scaffolds |
---|---|---|
PF00005 | ABC_tran | 82.35 |
PF00528 | BPD_transp_1 | 6.62 |
PF02738 | MoCoBD_1 | 2.21 |
PF09084 | NMT1 | 1.47 |
PF00353 | HemolysinCabind | 1.47 |
PF03401 | TctC | 0.74 |
PF04326 | AlbA_2 | 0.74 |
PF12833 | HTH_18 | 0.74 |
PF01977 | UbiD | 0.74 |
PF01494 | FAD_binding_3 | 0.74 |
PF00589 | Phage_integrase | 0.74 |
COG ID | Name | Functional Category | % Frequency in 136 Family Scaffolds |
---|---|---|---|
COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.47 |
COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.47 |
COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.47 |
COG0043 | 3-polyprenyl-4-hydroxybenzoate decarboxylase | Coenzyme transport and metabolism [H] | 0.74 |
COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.74 |
COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.74 |
COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.74 |
COG2865 | Predicted transcriptional regulator, contains HTH domain | Transcription [K] | 0.74 |
COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.74 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 93.38 % |
Unclassified | root | N/A | 6.62 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459004|F62QY1Z01D8BLL | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 501 | Open in IMG/M |
2170459013|GO6OHWN01AEJJ2 | Not Available | 504 | Open in IMG/M |
2228664021|ICCgaii200_c0935646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 644 | Open in IMG/M |
3300000655|AF_2010_repII_A100DRAFT_1034524 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 926 | Open in IMG/M |
3300000655|AF_2010_repII_A100DRAFT_1038624 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 867 | Open in IMG/M |
3300000732|JGI12023J11887_1006232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 681 | Open in IMG/M |
3300000793|AF_2010_repII_A001DRAFT_10017039 | All Organisms → cellular organisms → Bacteria | 1752 | Open in IMG/M |
3300001164|JGI11823J13286_1006937 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 785 | Open in IMG/M |
3300001661|JGI12053J15887_10078459 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1822 | Open in IMG/M |
3300001867|JGI12627J18819_10222339 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 761 | Open in IMG/M |
3300001977|JGI24746J21847_1023003 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 867 | Open in IMG/M |
3300002239|JGI24034J26672_10028412 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 903 | Open in IMG/M |
3300004267|Ga0066396_10010467 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1101 | Open in IMG/M |
3300004629|Ga0008092_11309719 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 603 | Open in IMG/M |
3300005168|Ga0066809_10207903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 531 | Open in IMG/M |
3300005332|Ga0066388_100358175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2105 | Open in IMG/M |
3300005332|Ga0066388_108285100 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 518 | Open in IMG/M |
3300005332|Ga0066388_108454851 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 513 | Open in IMG/M |
3300005434|Ga0070709_11780961 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 504 | Open in IMG/M |
3300005534|Ga0070735_10708089 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 595 | Open in IMG/M |
3300005543|Ga0070672_100034365 | All Organisms → cellular organisms → Bacteria | 3847 | Open in IMG/M |
3300005566|Ga0066693_10265042 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 682 | Open in IMG/M |
3300005568|Ga0066703_10663852 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 602 | Open in IMG/M |
3300005764|Ga0066903_100005400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 11083 | Open in IMG/M |
3300006028|Ga0070717_10770494 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 875 | Open in IMG/M |
3300006032|Ga0066696_10671150 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 668 | Open in IMG/M |
3300006034|Ga0066656_10653140 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 678 | Open in IMG/M |
3300006038|Ga0075365_10015017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4673 | Open in IMG/M |
3300006038|Ga0075365_10169667 | All Organisms → cellular organisms → Bacteria | 1523 | Open in IMG/M |
3300006577|Ga0074050_11984214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 621 | Open in IMG/M |
3300006605|Ga0074057_11652514 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 539 | Open in IMG/M |
3300006800|Ga0066660_10231623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1431 | Open in IMG/M |
3300006800|Ga0066660_10431101 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1097 | Open in IMG/M |
3300006854|Ga0075425_102680012 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 550 | Open in IMG/M |
3300006953|Ga0074063_10061479 | All Organisms → cellular organisms → Bacteria | 1261 | Open in IMG/M |
3300009094|Ga0111539_10425313 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1547 | Open in IMG/M |
3300009100|Ga0075418_10526205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1270 | Open in IMG/M |
3300009789|Ga0126307_11074019 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 651 | Open in IMG/M |
3300010046|Ga0126384_10856037 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 818 | Open in IMG/M |
3300010360|Ga0126372_12062123 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 618 | Open in IMG/M |
3300010366|Ga0126379_12236292 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 648 | Open in IMG/M |
3300010376|Ga0126381_102280040 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 778 | Open in IMG/M |
3300010398|Ga0126383_10305436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1591 | Open in IMG/M |
3300010398|Ga0126383_12970077 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 554 | Open in IMG/M |
3300010868|Ga0124844_1133945 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 943 | Open in IMG/M |
3300011271|Ga0137393_10952354 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 732 | Open in IMG/M |
3300012189|Ga0137388_10155482 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2029 | Open in IMG/M |
3300012202|Ga0137363_10918274 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 743 | Open in IMG/M |
3300012359|Ga0137385_10659584 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 876 | Open in IMG/M |
3300012359|Ga0137385_10707236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 841 | Open in IMG/M |
3300012908|Ga0157286_10349932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 557 | Open in IMG/M |
3300012927|Ga0137416_11838519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 554 | Open in IMG/M |
3300012939|Ga0162650_100059983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 636 | Open in IMG/M |
3300012943|Ga0164241_10561934 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 824 | Open in IMG/M |
3300012977|Ga0134087_10788231 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 513 | Open in IMG/M |
3300013306|Ga0163162_12036690 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 658 | Open in IMG/M |
3300013306|Ga0163162_12273906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 623 | Open in IMG/M |
3300013308|Ga0157375_13029168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 561 | Open in IMG/M |
3300015373|Ga0132257_104427725 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 511 | Open in IMG/M |
3300016270|Ga0182036_10187040 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1507 | Open in IMG/M |
3300016341|Ga0182035_12101624 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 513 | Open in IMG/M |
3300016387|Ga0182040_10989734 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 701 | Open in IMG/M |
3300016404|Ga0182037_10467376 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1052 | Open in IMG/M |
3300016404|Ga0182037_11467405 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 604 | Open in IMG/M |
3300016422|Ga0182039_10180163 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1667 | Open in IMG/M |
3300020005|Ga0193697_1115160 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 630 | Open in IMG/M |
3300020581|Ga0210399_10113947 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2218 | Open in IMG/M |
3300021073|Ga0210378_10161347 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 863 | Open in IMG/M |
3300021432|Ga0210384_10346976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Bordetella | 1337 | Open in IMG/M |
3300021560|Ga0126371_10350107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Bordetella → Bordetella flabilis | 1612 | Open in IMG/M |
3300021560|Ga0126371_11462277 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 813 | Open in IMG/M |
3300021560|Ga0126371_11848554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 724 | Open in IMG/M |
3300021861|Ga0213853_10159131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 654 | Open in IMG/M |
3300021861|Ga0213853_11488880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 799 | Open in IMG/M |
3300025321|Ga0207656_10088327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Bordetella | 1403 | Open in IMG/M |
3300026305|Ga0209688_1076982 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 602 | Open in IMG/M |
3300026550|Ga0209474_10029323 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4145 | Open in IMG/M |
3300026552|Ga0209577_10106500 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2264 | Open in IMG/M |
3300027381|Ga0208983_1102716 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 527 | Open in IMG/M |
3300027383|Ga0209213_1001661 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3565 | Open in IMG/M |
3300027502|Ga0209622_1033298 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 921 | Open in IMG/M |
3300027616|Ga0209106_1148909 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 522 | Open in IMG/M |
3300027775|Ga0209177_10499748 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 507 | Open in IMG/M |
3300027873|Ga0209814_10414003 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp. | 593 | Open in IMG/M |
3300027880|Ga0209481_10263854 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 869 | Open in IMG/M |
3300027882|Ga0209590_10751823 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 622 | Open in IMG/M |
3300027903|Ga0209488_10594675 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 803 | Open in IMG/M |
3300027909|Ga0209382_10066921 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4249 | Open in IMG/M |
3300028708|Ga0307295_10139286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 669 | Open in IMG/M |
3300028712|Ga0307285_10003532 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3093 | Open in IMG/M |
3300028712|Ga0307285_10114219 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 721 | Open in IMG/M |
3300028720|Ga0307317_10063039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Bordetella | 1201 | Open in IMG/M |
3300028754|Ga0307297_10183562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 726 | Open in IMG/M |
3300028778|Ga0307288_10345490 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 598 | Open in IMG/M |
3300028872|Ga0307314_10130587 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 711 | Open in IMG/M |
3300031198|Ga0307500_10250809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 546 | Open in IMG/M |
3300031545|Ga0318541_10371874 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 798 | Open in IMG/M |
3300031546|Ga0318538_10125794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Bordetella | 1341 | Open in IMG/M |
3300031561|Ga0318528_10540621 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 625 | Open in IMG/M |
3300031572|Ga0318515_10460917 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 679 | Open in IMG/M |
3300031640|Ga0318555_10072050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Bordetella | 1787 | Open in IMG/M |
3300031640|Ga0318555_10489805 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 666 | Open in IMG/M |
3300031640|Ga0318555_10629963 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 580 | Open in IMG/M |
3300031668|Ga0318542_10452548 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 665 | Open in IMG/M |
3300031680|Ga0318574_10002404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 7251 | Open in IMG/M |
3300031682|Ga0318560_10064324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Bordetella | 1837 | Open in IMG/M |
3300031751|Ga0318494_10048326 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2241 | Open in IMG/M |
3300031764|Ga0318535_10247261 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 798 | Open in IMG/M |
3300031770|Ga0318521_10370406 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 851 | Open in IMG/M |
3300031778|Ga0318498_10098701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Bordetella | 1323 | Open in IMG/M |
3300031795|Ga0318557_10271033 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 778 | Open in IMG/M |
3300031820|Ga0307473_10987026 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 614 | Open in IMG/M |
3300031846|Ga0318512_10392932 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 696 | Open in IMG/M |
3300031897|Ga0318520_10574711 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 699 | Open in IMG/M |
3300031897|Ga0318520_10827478 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 581 | Open in IMG/M |
3300031941|Ga0310912_10927986 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 669 | Open in IMG/M |
3300031943|Ga0310885_10897851 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 508 | Open in IMG/M |
3300032039|Ga0318559_10102418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Bordetella | 1269 | Open in IMG/M |
3300032044|Ga0318558_10212726 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 945 | Open in IMG/M |
3300032054|Ga0318570_10554780 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 524 | Open in IMG/M |
3300032055|Ga0318575_10066922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Bordetella | 1686 | Open in IMG/M |
3300032063|Ga0318504_10594412 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 531 | Open in IMG/M |
3300032075|Ga0310890_11053274 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 656 | Open in IMG/M |
3300032090|Ga0318518_10007273 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4409 | Open in IMG/M |
3300032090|Ga0318518_10022418 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2800 | Open in IMG/M |
3300032122|Ga0310895_10379664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 687 | Open in IMG/M |
3300032261|Ga0306920_100899639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1294 | Open in IMG/M |
3300034163|Ga0370515_0330900 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 644 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.53% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.09% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.35% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.62% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.62% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.88% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.88% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.41% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.41% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.94% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.94% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.21% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.21% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 1.47% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 1.47% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.47% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.47% |
Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.47% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.74% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.74% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.74% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.74% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.74% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.74% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.74% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.74% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.74% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.74% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.74% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.74% |
Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.74% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459004 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm (2) | Environmental | Open in IMG/M |
2170459013 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis soil at the rocks surface 0-21cm | Environmental | Open in IMG/M |
2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
3300000732 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 | Environmental | Open in IMG/M |
3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
3300001164 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 | Environmental | Open in IMG/M |
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Host-Associated | Open in IMG/M |
3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Host-Associated | Open in IMG/M |
3300004267 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio | Environmental | Open in IMG/M |
3300004629 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome P72I A01 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
3300006577 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006605 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012939 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t1i015 | Environmental | Open in IMG/M |
3300012943 | Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY) | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300020005 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2 | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026305 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300027381 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027383 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027502 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027616 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
E4B_00785990 | 2170459004 | Grass Soil | VNGGLDPAIEEFTADLNVKLGNLPVAAPAKDVLEPRFVERALATLGNYQSK |
N57_01687000 | 2170459013 | Grass Soil | NMKLGNLPVAPAAKDVLEPRFVDAALKKLGPYQAK |
ICCgaii200_09356462 | 2228664021 | Soil | FTANLNMKLGNLPIAPPAKDVLEPRFVDAALKRLGPYQKK |
AF_2010_repII_A100DRAFT_10345241 | 3300000655 | Forest Soil | ADLNMKLGNLPVAAPAKDVLEPRFVDRALEKLGSYQAK* |
AF_2010_repII_A100DRAFT_10386242 | 3300000655 | Forest Soil | EEFTADLNMKLGNLPVAPPPKDVLEPRFVDHALAKLGSYQKK* |
JGI12023J11887_10062322 | 3300000732 | Forest Soil | AVEEFTANLNMKLGNLPVAPPAKDVLEPRFVDAALKQLGPYQKK* |
AF_2010_repII_A001DRAFT_100170393 | 3300000793 | Forest Soil | TADLNMKLGNLPVAPPPKDVLEPRFVDHALAKLGSYQKK* |
JGI11823J13286_10069371 | 3300001164 | Forest Soil | NMKLGNLPVAPPAKDVLEPRFVDAALKQLGPYQKK* |
JGI12053J15887_100784592 | 3300001661 | Forest Soil | NGGLDPAIEEFTAELNMKLGNLPVAPKASDILDXRFVDAALKKLGTYQTK* |
JGI12627J18819_102223391 | 3300001867 | Forest Soil | LNMKLGNLPVAAPPKDVLEPRFVDRALAKLGTHQKK* |
JGI24746J21847_10230031 | 3300001977 | Corn, Switchgrass And Miscanthus Rhizosphere | GVNGGLDPAIEEFTAELNMKLGNLPVAPAAKDVLEPRFVDAALKKLGPYQAK* |
JGI24034J26672_100284122 | 3300002239 | Corn, Switchgrass And Miscanthus Rhizosphere | EEFTAELNMKLGNLPVAPAAKDVLEPRFVDAALKKLGPYQAK* |
Ga0066396_100104671 | 3300004267 | Tropical Forest Soil | DPAIEEFTAELNMKLGNLPVAAPAKDVLEPRFVDRALAKLGTYRKN* |
Ga0008092_113097191 | 3300004629 | Tropical Rainforest Soil | GGLDPAIEEFTADLNVKLGNLPVAAPAKDVLEPRFVDRALATLGNYQTK* |
Ga0066809_102079032 | 3300005168 | Soil | LDPAIEEFTAELNMKLGNLPVAPAAKDVLEPRFVDAALKKLGPYQAK* |
Ga0066388_1003581752 | 3300005332 | Tropical Forest Soil | VDGGLDPAVEEFTADLNMKLGNLPVAPPPKDVLEPRFVDRALAKLGAYQKK* |
Ga0066388_1082851002 | 3300005332 | Tropical Forest Soil | DPAIEEFTADLNMKLGNLPVAAPAKDVLEPRFVDRALATLGNYQTK* |
Ga0066388_1084548512 | 3300005332 | Tropical Forest Soil | AIEEFTADLNMKLGNLPVAAPAKDVLDPRFVEAALKKLGSYKKK* |
Ga0070709_117809612 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | EEFTADLNMKLGNLPVAAPAKDVLEPRFVDRALAKLGTYQKK* |
Ga0070735_107080891 | 3300005534 | Surface Soil | VKLGNLTAAPPEKDVLDPRFVDVALKKLGPYQKK* |
Ga0070672_1000343651 | 3300005543 | Miscanthus Rhizosphere | FTAELNMKLGNLPVAPAAKDVLEPRFVDAALKKLGPYQAK* |
Ga0066693_102650422 | 3300005566 | Soil | IEEFTADLNMKLGNLPVAPPPKDVLEPRFVDRALAKLGTYQKK* |
Ga0066703_106638522 | 3300005568 | Soil | VKLGNLPVAARAKDVLEPRFVERALATLGNYQTK* |
Ga0066903_1000054001 | 3300005764 | Tropical Forest Soil | GGLDPAVEEFTADLNKKLGNLPVAPAPSEVLDQRFVQAALKKLGPAGGR* |
Ga0070717_104184071 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | WGVNGGLDPAIEEFTADLNVKLGNLPVAARAKDVLEPRFVERALATLGNYQTK* |
Ga0070717_107704941 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | AELNMKLGNLPVAPAAKDVLEPRFVDAALKKLGPYQAK* |
Ga0066696_106711501 | 3300006032 | Soil | ELNMKLGNLPVAVPAKDVLEARFVEAALKKFGPYQKQ* |
Ga0066656_106531402 | 3300006034 | Soil | LNVKLGNLPVAARAKDVLEPRFVERALATLGNYQTK* |
Ga0075365_100150175 | 3300006038 | Populus Endosphere | VDGGLDPAIEQFTADLNMQLGNLPVAPAASAVLEARFVDAALKRLGSYQKK* |
Ga0075365_101696671 | 3300006038 | Populus Endosphere | EEFTADLNMKLGNLPVAPPAKDVLEPRFVDTSLKKFGPYQAK* |
Ga0074050_119842142 | 3300006577 | Soil | IEEFTAELNMKLGNLPVAPAAKDVLEPRFVDAALKKLGPYQAK* |
Ga0074057_116525142 | 3300006605 | Soil | IEEFTADLNVKLGNLPVAAPAKDVLEPRFVERALATLGNYQSK* |
Ga0066660_102316231 | 3300006800 | Soil | NMKLGNLPVAVPAKDVLEARFVEAALKKFGPYQKQ* |
Ga0066660_104311011 | 3300006800 | Soil | TADLNMKLGNLPVAPAPKDVLEPRFVDAALMKLGRYQKK* |
Ga0075425_1026800122 | 3300006854 | Populus Rhizosphere | DGGLDPKIEEFTAELNMKLGNLPVAAPAKDVLDPRFVDAALKKLGGYKKK* |
Ga0074063_100614791 | 3300006953 | Soil | DLNMKLGNLPVAPPPKDVLEPRFVTAAIRKLGAYQNR* |
Ga0099828_101222654 | 3300009089 | Vadose Zone Soil | WGVNGGLDPAIEEFTADLNVKLGNLPVAAPAKDVLEPRFVERALATLGNYQSK* |
Ga0111539_104253132 | 3300009094 | Populus Rhizosphere | MQLGNLPVAPAASAVLEARFVDAALKRLGSYQKK* |
Ga0075418_105262051 | 3300009100 | Populus Rhizosphere | MKLGNLPVAAPAKDVLEQRFVEAALNKLGVYRKQ* |
Ga0126307_110740191 | 3300009789 | Serpentine Soil | DLNVKLGNLPVAAPAKDVLDTRFVDAALNRLGAYPKN* |
Ga0126384_108560371 | 3300010046 | Tropical Forest Soil | FTADLNMKLGNLPVAPPPKDVLEPRFVDHALAKLGSYQKK* |
Ga0126372_120621232 | 3300010360 | Tropical Forest Soil | PAIEEFTAELNMKLGNLPVAAPPKDVLEPRFVERALAKLGSYRKN* |
Ga0126379_122362921 | 3300010366 | Tropical Forest Soil | ELNMKLGNLPVAAPAKDVLEPRFVDRALAKLGSYQAK* |
Ga0126381_1022800401 | 3300010376 | Tropical Forest Soil | TADLNMKLGNLPVALPAQDVLDQRFVAAAIRKLGQYQQ* |
Ga0126383_103054363 | 3300010398 | Tropical Forest Soil | EEYTADLNMKLGNLPVALPAQDVLDQRFVAAAIRKLGQYQQ* |
Ga0126383_129700772 | 3300010398 | Tropical Forest Soil | EFTADLNMKLGNLPVAAPAKDVLEPRFVDRALEKLGSYQAK* |
Ga0124844_11339452 | 3300010868 | Tropical Forest Soil | MKLGNLPVAPPAKDVLEPRFVDRALAKLGRYQTK* |
Ga0137393_109523542 | 3300011271 | Vadose Zone Soil | GVNGGLDPAIEEFTAELNMKLGNLPVAAPAKDVLDPRFVEAALKKLGKYQKK* |
Ga0137388_101554821 | 3300012189 | Vadose Zone Soil | KIEEFTADLNVKLGNLPRAATPAEVLDPRFVDAALKKLGPSKK* |
Ga0137363_109182741 | 3300012202 | Vadose Zone Soil | TADLNMKLGNLPVAAPAKDVLEPRFVDRALEKLGSYQTK* |
Ga0137385_106595842 | 3300012359 | Vadose Zone Soil | LNVKLGNLPVAAPAKDVLEPRFVERALATLGNYQSK* |
Ga0137385_107072361 | 3300012359 | Vadose Zone Soil | MKLGNLPVAAPAKDVLEPGFVERALAKLGTYQKK* |
Ga0157286_103499322 | 3300012908 | Soil | GGLDPAVEEFTADLNMKLGNLPVAPPAKDVLEPRFVDAALKKFGPYQAK* |
Ga0137416_118385192 | 3300012927 | Vadose Zone Soil | VDGGLDPAVEEFTANLNMKLGNLPIAPPAKDVLEPRFVDAALKQLGPYQKK* |
Ga0162650_1000599832 | 3300012939 | Soil | GRRRDRQVAELNMKLGNLPVAPAAKDVLEPRFVDAALRKLGPYQAK* |
Ga0164241_105619342 | 3300012943 | Soil | GLDPAIEEFTAELNMKLGNLPVAPAAKDVLEPRFVDAALKKLGPYQAK* |
Ga0134087_107882311 | 3300012977 | Grasslands Soil | DPKIEEFTAELNMKLGNLPVVVPAKDVLEPRFVEAALKKFGPYQKQ* |
Ga0163162_120366902 | 3300013306 | Switchgrass Rhizosphere | VDGGLDPAVEEFTADLNMKLGNLPVAAPAKDVLEPRFVERALAKLGTHQKK* |
Ga0163162_122739062 | 3300013306 | Switchgrass Rhizosphere | DPAIEKFTAELNMKLGNLPVAPAAKDVFEPRFVDAALKKLGPYQAK* |
Ga0157375_130291682 | 3300013308 | Miscanthus Rhizosphere | NGGLDPAVEEFTADLNMKLGNLPVAPPAKDVLEPRFVDTSLKKFGPYQAK* |
Ga0132257_1044277251 | 3300015373 | Arabidopsis Rhizosphere | TAALNKELGNLPVAAPASDVREQHFVAAAMKKLGPYQKK* |
Ga0182036_101870403 | 3300016270 | Soil | EEFTADLNMKLGNLPVAAPAKDVLEPRFVDRALEKLGSYQAK |
Ga0182035_121016242 | 3300016341 | Soil | WGVNGGLDPAIEEFTADLNMKLGNLPVAPPAKDVLEPRFVNHALATLGSYQTK |
Ga0182040_109897341 | 3300016387 | Soil | DPAIEEFTADLNMKLGNLPVAAPAKDVLEPRFVDRALEKLGSYQAK |
Ga0182037_104673761 | 3300016404 | Soil | DLNMKLGNLPVAAPAKDVLEPRFVERALATLGSYQTK |
Ga0182037_114674052 | 3300016404 | Soil | DLNMKLGNLPVAPPAKDVLEPRFVDRALATLGGYQTK |
Ga0182039_101801633 | 3300016422 | Soil | LDPAIEEFTADLNMKLGNLPVAAPAKDVLEPRFVDRALEKLGSYQAK |
Ga0193697_11151602 | 3300020005 | Soil | EFTAELNMKLGNLPVAPAAKDVLEPRFVDAALKKLGPYQAK |
Ga0210399_101139471 | 3300020581 | Soil | LDPAIEEFTADLNVKLGNLPVAAPAKEVLEPRFVERALATLGNYQTK |
Ga0210378_101613471 | 3300021073 | Groundwater Sediment | PAIQEFTADLNMKLGNLPVAAPAKDVLEQRFVEAALNKLGVYRKQ |
Ga0210384_103469763 | 3300021432 | Soil | PAIEEFTADLNVKLGNLPVAAPAKDVLEPRFVERALATLGNYQTK |
Ga0210410_109509422 | 3300021479 | Soil | NVWGVDGGLDPAVEEFTADLNMKLGNLPVAAPAKDVLEPRFVDRALVKLGTYQKK |
Ga0126371_103501073 | 3300021560 | Tropical Forest Soil | EEFTADLNMKLGNLPVAPPAKDVLEPRFVDRALAKLGRYQTK |
Ga0126371_114622772 | 3300021560 | Tropical Forest Soil | AELNMKLGNLPVAAPAKDVLEPRFVDRALAKLGSYQAK |
Ga0126371_118485542 | 3300021560 | Tropical Forest Soil | ADLNVKLGNLPVAAPAKDVLEPRFVDRALATLGNYQTK |
Ga0213853_101591312 | 3300021861 | Watersheds | DTAGLNVKLGNLPVAAPAADVLDRRFVESALGKLGPYRRK |
Ga0213853_114888801 | 3300021861 | Watersheds | IYHDTADLNIKLGNLPMAAPAKAVLEPRFVEAAIGKLGPYRGK |
Ga0207656_100883273 | 3300025321 | Corn Rhizosphere | VNGGLDPAIDEFTAELNMKLGNLPVAPAAKDVLEPRFVDAALKKLGPYQAK |
Ga0207684_100396714 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | WGVNGGLDPAIEEFTADLNVKLGNLPVAAPAKDVLEPRFVERALATLGNYQSK |
Ga0209688_10769821 | 3300026305 | Soil | LNMKLGNLPVAPPPKDVLEPRFVDRALAKLGTYQKK |
Ga0209474_100293231 | 3300026550 | Soil | DLNMKLGNLPVAPPPKDVLEPRFVDRALAKLGTYQKK |
Ga0209577_101065001 | 3300026552 | Soil | NMKLGNLPVAVPAKDVLEARFVEAALKKFGPYQKQ |
Ga0208983_11027161 | 3300027381 | Forest Soil | ADLNMRLGNLPVAPPAKDVLDARFVDAALKQLGTYQKK |
Ga0209213_10016611 | 3300027383 | Forest Soil | ANLNMKLGNLPVAPPAKDVLEPRFVDAALKQLGPYQKK |
Ga0209622_10332982 | 3300027502 | Forest Soil | AIEEFTADLNVKLGNLPVAAPAKDVLEPRFVERALATLGNYQTK |
Ga0209106_11489092 | 3300027616 | Forest Soil | FTADLNMRLGNLPVAPPAKDVLDARFVDAALKQLGTYQKK |
Ga0209177_104997481 | 3300027775 | Agricultural Soil | DLNMKLGNLPVAPPPKDVLEPRFVDHALAKLGSYQKK |
Ga0209814_104140032 | 3300027873 | Populus Rhizosphere | GVNGGLDPAIEEFTADLNMKLGNLPVAAPAKDVLEPRFVDRALEKLGSYQTK |
Ga0209481_102638541 | 3300027880 | Populus Rhizosphere | VNGGLDPAIQEFTADLNMKLGNLPVAAPAKDVLEQRFVEAALNKLGVYRKQ |
Ga0209590_107518231 | 3300027882 | Vadose Zone Soil | EEFTAELNMRLGNLPVAIPAKDVLDQRFVEAALKKLGTYRKQ |
Ga0209488_105946751 | 3300027903 | Vadose Zone Soil | DPAIEEFTADLNMKLGNLPVAPPAKDVLDARFVDAALKQLGTYQKK |
Ga0209382_100669213 | 3300027909 | Populus Rhizosphere | VDGGLDPAIEQFTADLNMQLGNLPVAPAASAVLEARFVDAALKRLGSYQKK |
Ga0307295_101392862 | 3300028708 | Soil | EEFTANLNMKLGNLPIAPPAKDVLEPRFVDAALKQLGPYQKK |
Ga0307285_100035322 | 3300028712 | Soil | VFDGAYSVQLSDPAVEEFTANLNMKLGNLPIAPPAKDILEPRFVDAALKQLGPYQKK |
Ga0307285_101142191 | 3300028712 | Soil | TAELNMKLGNLPVAPAAKDVLDPRFVDAALKKLGPYQAK |
Ga0307317_100630393 | 3300028720 | Soil | GGLDPAVEEFTANLNMKLGNLPIAPPAKDILEPRFVDAALKQLGPYQKK |
Ga0307297_101835621 | 3300028754 | Soil | AIEEFTAELNMKLGNLPVAPAAKDVLEPRFVDAALKKLGPYQAK |
Ga0307288_103454902 | 3300028778 | Soil | DGAYSVQLSDPAVEEFTANLNMKLGNLPIAPPAKDILEPRFVDAALKQLGPYQKK |
Ga0307314_101305871 | 3300028872 | Soil | GGLDPAVEEFTANLNMKLGNLPIAPPAKDVLEPRFVDAALKQLGPYQKK |
Ga0307500_102508091 | 3300031198 | Soil | FTAELNMKLGNLPVAPAAKDVLEPRFVDAALKKLGPYQAK |
Ga0318541_103718742 | 3300031545 | Soil | VNGGLDPAIEEFTADLNMKLGNLPVAAPAKDVLEPRFVERALATLGSYQTK |
Ga0318538_101257943 | 3300031546 | Soil | LNMKLGNLPVAAPAKDVLEPRFVDRALAKLGSYQAK |
Ga0318528_105406212 | 3300031561 | Soil | ELNMKLGNLPVAAPAKDVLEPRFVDRALAKLGSYQAK |
Ga0318515_104609171 | 3300031572 | Soil | NMKLGNLPVAAPAKDVLEPRFVDRALAKLGSYQAK |
Ga0318555_100720501 | 3300031640 | Soil | RSQINARRKLGNLPVAAPAKDVLEPRFVDRALAKLGSYQAK |
Ga0318555_104898051 | 3300031640 | Soil | EEFTAELNMKLGNLPVAAPAKDVLEPRFVDRALAKLGSYQAK |
Ga0318555_106299632 | 3300031640 | Soil | AIEEFTADLNMKLGNLPVAPPAKDVLEPRFVDRALATLGGYQTK |
Ga0318542_104525481 | 3300031668 | Soil | ARRKLGNLPVAAPAKDVLEPRFVDRALAKLGSYQAK |
Ga0318574_100024047 | 3300031680 | Soil | VSWKLGNLPVAAPAKDVLEPRFVDRALAKLGSYQAK |
Ga0318560_100643243 | 3300031682 | Soil | VWGVNGGLDPAIEEFTADLNMKLGNLPVAPPAKDVLEPRFVDRALATLGGYQTK |
Ga0306918_105817592 | 3300031744 | Soil | WGVNGGLDPAIEEFTADLNMKLGNLPVAAPAKDVLEPRFVDRALEKLGSYQAK |
Ga0318494_100483261 | 3300031751 | Soil | QNNSRRKLGNLPVAAPAKDVLEPRFVDRALAKLGSYQAK |
Ga0318535_102472612 | 3300031764 | Soil | GVNGGLDPAIEEFTAELNMKLGNLPVAAPAKDVLEPRFVDRALAKLGSYQAK |
Ga0318521_103704061 | 3300031770 | Soil | LNMKLGNLPIAPPAKDVLEPRFVDRALAKLGRHQTK |
Ga0318498_100987011 | 3300031778 | Soil | LNMKLGNLPVAAPAKDVLEPRFVDRALEKLGSYQAK |
Ga0318557_102710331 | 3300031795 | Soil | NVWGVNGGLDPAIEEFTADLNMKLGNLPVAPPAKDVLEPRFVNHALATLGSYQTK |
Ga0307473_109870262 | 3300031820 | Hardwood Forest Soil | DPAIEEFTADLNMKLGNLPVAAPAKDVLDARFVESALKTLGPYQKK |
Ga0318512_103929322 | 3300031846 | Soil | TAELNMKLGNLPVAAPAKDVLEPRFVDRALAKLGSYQAK |
Ga0318520_105747112 | 3300031897 | Soil | IEEFTAELNMKLGNLPVAAPAKDVLEPRFVDRALAKLGSYQAK |
Ga0318520_108274781 | 3300031897 | Soil | LNMKLGNLPVAAPAKDVLERRFVDRALEKLGSYQAK |
Ga0310912_109279861 | 3300031941 | Soil | WGVNGGLDPAIEEFTAELNMKLGNLPLAAPAKDVLEPRFVDRALEKLGSYQAK |
Ga0310885_108978511 | 3300031943 | Soil | YTATLNKELGNLPVAAPASDVLEQRFVEAAMTKLGPYKKK |
Ga0318507_101211343 | 3300032025 | Soil | VWGVNGGLDPAIEEFTADLNVKLGNLPVAAPAKDVLEPRFVDRALATLGNYQTK |
Ga0318559_101024181 | 3300032039 | Soil | DLNMKLGNLPVAAPAKDVLEPRFVDRALEKLGSYQAK |
Ga0318558_102127261 | 3300032044 | Soil | VNGGLDTKIEEFTAELNMKLGNLPVAVPAKDVLESRFVEAALKNFGLYQKN |
Ga0318532_101804571 | 3300032051 | Soil | NVWGVNGGLDPAIEEFTAELNMKLGNLPVAAPAKDVLEPRFVDRALAKLGSYQAK |
Ga0318570_105547802 | 3300032054 | Soil | GINGGLDPAVEEFTADLNMKLGNLPIAPPAKDVLEPRFVDRALAKLGRHQTK |
Ga0318575_100669223 | 3300032055 | Soil | NGGLDPAIEEFTADLNMKLGNLPVAAPAKDVLEPRFVDRALEKLGSYQAK |
Ga0318504_105944122 | 3300032063 | Soil | INLTGKLGNLPVAAPAKDVLEPRFVDRALEKLGSYQAK |
Ga0318524_102166251 | 3300032067 | Soil | NVWGVNGGLDPAIEEFTADLNMKLGNLPVAAPAKDVLEPRFVDRALEKLGSYQAK |
Ga0310890_110532742 | 3300032075 | Soil | VDGGIDPKIQEYTATLNKELGNLPVAAPASDVLDQRFVAAAMTKLGPYKKK |
Ga0318518_100072731 | 3300032090 | Soil | DPKIEEFTAELNMKLGNLPVAVPAKDVLESRFVEAALKNFGLYQKN |
Ga0318518_100224181 | 3300032090 | Soil | LHVELGNLPVAAPAKDVLEPRFVDRALAKLGSYQAK |
Ga0310895_103796641 | 3300032122 | Soil | DPAVEEFTAELNMKLGNLPVAPAAKDVLEPRFVDAALKKLGPYQAK |
Ga0306920_1008996391 | 3300032261 | Soil | MPAMKLGNLPVAAPAKDVLEPRFVDRALATLGNYQTK |
Ga0370515_0330900_2_136 | 3300034163 | Untreated Peat Soil | KVEEFTADLNVKLGNLTTAPAPKDVLDTRYVDVAMKKLGPYEQK |
⦗Top⦘ |