| Basic Information | |
|---|---|
| Family ID | F057342 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 136 |
| Average Sequence Length | 49 residues |
| Representative Sequence | QLGARLQPIVDRASADLVATINQHVGELLRAYVAEAIEREIDSWRRNH |
| Number of Associated Samples | 122 |
| Number of Associated Scaffolds | 136 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 92.65 % |
| % of genes from short scaffolds (< 2000 bps) | 85.29 % |
| Associated GOLD sequencing projects | 112 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.62 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (61.029 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen (9.559 % of family members) |
| Environment Ontology (ENVO) | Unclassified (49.265 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (46.324 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 60.53% β-sheet: 0.00% Coil/Unstructured: 39.47% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.62 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 136 Family Scaffolds |
|---|---|---|
| PF00793 | DAHP_synth_1 | 33.82 |
| PF01042 | Ribonuc_L-PSP | 8.82 |
| PF00133 | tRNA-synt_1 | 5.88 |
| PF01475 | FUR | 4.41 |
| PF00005 | ABC_tran | 2.94 |
| PF00950 | ABC-3 | 2.94 |
| PF00884 | Sulfatase | 1.47 |
| PF04962 | KduI | 1.47 |
| PF01266 | DAO | 0.74 |
| PF07311 | Dodecin | 0.74 |
| PF04120 | Iron_permease | 0.74 |
| PF00211 | Guanylate_cyc | 0.74 |
| PF04413 | Glycos_transf_N | 0.74 |
| PF00591 | Glycos_transf_3 | 0.74 |
| PF10458 | Val_tRNA-synt_C | 0.74 |
| COG ID | Name | Functional Category | % Frequency in 136 Family Scaffolds |
|---|---|---|---|
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 8.82 |
| COG0060 | Isoleucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 5.88 |
| COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 5.88 |
| COG0495 | Leucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 5.88 |
| COG0525 | Valyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 5.88 |
| COG0735 | Fe2+ or Zn2+ uptake regulation protein Fur/Zur | Inorganic ion transport and metabolism [P] | 4.41 |
| COG0609 | ABC-type Fe3+-siderophore transport system, permease component | Inorganic ion transport and metabolism [P] | 2.94 |
| COG1108 | ABC-type Mn2+/Zn2+ transport system, permease component | Inorganic ion transport and metabolism [P] | 2.94 |
| COG4606 | ABC-type enterochelin transport system, permease component | Inorganic ion transport and metabolism [P] | 2.94 |
| COG3717 | 5-keto 4-deoxyuronate isomerase | Carbohydrate transport and metabolism [G] | 1.47 |
| COG1519 | 3-deoxy-D-manno-octulosonic-acid transferase | Cell wall/membrane/envelope biogenesis [M] | 0.74 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.74 |
| COG3360 | Flavin-binding protein dodecin | General function prediction only [R] | 0.74 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 61.03 % |
| All Organisms | root | All Organisms | 38.97 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000559|F14TC_100449161 | Not Available | 762 | Open in IMG/M |
| 3300004778|Ga0062383_10319584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → Clostridium → environmental samples → uncultured Clostridium sp. | 749 | Open in IMG/M |
| 3300005093|Ga0062594_100751082 | Not Available | 891 | Open in IMG/M |
| 3300005329|Ga0070683_101580068 | Not Available | 631 | Open in IMG/M |
| 3300005331|Ga0070670_101660675 | Not Available | 588 | Open in IMG/M |
| 3300005335|Ga0070666_11463279 | Not Available | 511 | Open in IMG/M |
| 3300005338|Ga0068868_100210225 | Not Available | 1626 | Open in IMG/M |
| 3300005343|Ga0070687_100567532 | Not Available | 775 | Open in IMG/M |
| 3300005347|Ga0070668_100070588 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2719 | Open in IMG/M |
| 3300005354|Ga0070675_100486406 | Not Available | 1111 | Open in IMG/M |
| 3300005364|Ga0070673_100731593 | Not Available | 910 | Open in IMG/M |
| 3300005364|Ga0070673_101141296 | Not Available | 729 | Open in IMG/M |
| 3300005365|Ga0070688_100391090 | Not Available | 1027 | Open in IMG/M |
| 3300005367|Ga0070667_101959024 | Not Available | 552 | Open in IMG/M |
| 3300005438|Ga0070701_10902078 | Not Available | 610 | Open in IMG/M |
| 3300005455|Ga0070663_100201204 | Not Available | 1555 | Open in IMG/M |
| 3300005455|Ga0070663_100245580 | All Organisms → cellular organisms → Bacteria | 1415 | Open in IMG/M |
| 3300005455|Ga0070663_101644651 | Not Available | 573 | Open in IMG/M |
| 3300005459|Ga0068867_101984569 | Not Available | 550 | Open in IMG/M |
| 3300005539|Ga0068853_102044398 | Not Available | 556 | Open in IMG/M |
| 3300005616|Ga0068852_100355960 | All Organisms → cellular organisms → Bacteria | 1431 | Open in IMG/M |
| 3300005618|Ga0068864_101920624 | Not Available | 598 | Open in IMG/M |
| 3300005718|Ga0068866_10188500 | Not Available | 1224 | Open in IMG/M |
| 3300005718|Ga0068866_10879570 | Not Available | 629 | Open in IMG/M |
| 3300005841|Ga0068863_101585036 | Not Available | 664 | Open in IMG/M |
| 3300005842|Ga0068858_101539926 | Not Available | 656 | Open in IMG/M |
| 3300005843|Ga0068860_100820830 | Not Available | 944 | Open in IMG/M |
| 3300005937|Ga0081455_10532896 | Not Available | 781 | Open in IMG/M |
| 3300005940|Ga0073913_10061615 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 610 | Open in IMG/M |
| 3300006041|Ga0075023_100246121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 712 | Open in IMG/M |
| 3300006604|Ga0074060_11959565 | Not Available | 919 | Open in IMG/M |
| 3300006642|Ga0075521_10084072 | Not Available | 1441 | Open in IMG/M |
| 3300006871|Ga0075434_100179183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2139 | Open in IMG/M |
| 3300006880|Ga0075429_100714173 | Not Available | 878 | Open in IMG/M |
| 3300009131|Ga0115027_10663693 | Not Available | 777 | Open in IMG/M |
| 3300009148|Ga0105243_11293336 | Not Available | 746 | Open in IMG/M |
| 3300009179|Ga0115028_10089247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1710 | Open in IMG/M |
| 3300009545|Ga0105237_10876840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → unclassified Polynucleobacter → Polynucleobacter sp. es-GGE-1 | 904 | Open in IMG/M |
| 3300009551|Ga0105238_12901054 | Not Available | 515 | Open in IMG/M |
| 3300010373|Ga0134128_10818684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → unclassified Polynucleobacter → Polynucleobacter sp. es-GGE-1 | 1032 | Open in IMG/M |
| 3300010396|Ga0134126_10441333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1507 | Open in IMG/M |
| 3300010396|Ga0134126_10982986 | Not Available | 946 | Open in IMG/M |
| 3300010396|Ga0134126_11776380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → unclassified Polynucleobacter → Polynucleobacter sp. es-GGE-1 | 676 | Open in IMG/M |
| 3300010403|Ga0134123_10249521 | Not Available | 1544 | Open in IMG/M |
| 3300012200|Ga0137382_10979319 | Not Available | 608 | Open in IMG/M |
| 3300012208|Ga0137376_11055959 | Not Available | 695 | Open in IMG/M |
| 3300012527|Ga0136633_1228375 | Not Available | 688 | Open in IMG/M |
| 3300012910|Ga0157308_10265039 | Not Available | 613 | Open in IMG/M |
| 3300012960|Ga0164301_11199945 | Not Available | 609 | Open in IMG/M |
| 3300012961|Ga0164302_10312326 | Not Available | 1032 | Open in IMG/M |
| 3300013102|Ga0157371_10164465 | All Organisms → cellular organisms → Bacteria | 1585 | Open in IMG/M |
| 3300013102|Ga0157371_11099861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → unclassified Polynucleobacter → Polynucleobacter sp. es-GGE-1 | 609 | Open in IMG/M |
| 3300013104|Ga0157370_10032246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 5117 | Open in IMG/M |
| 3300013105|Ga0157369_10693282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1049 | Open in IMG/M |
| 3300013308|Ga0157375_10625687 | All Organisms → cellular organisms → Bacteria | 1234 | Open in IMG/M |
| 3300014261|Ga0075360_1085610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 599 | Open in IMG/M |
| 3300014308|Ga0075354_1146050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 535 | Open in IMG/M |
| 3300014323|Ga0075356_1065522 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 816 | Open in IMG/M |
| 3300015203|Ga0167650_1020905 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1791 | Open in IMG/M |
| 3300015372|Ga0132256_103513866 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 527 | Open in IMG/M |
| 3300018481|Ga0190271_10933823 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 992 | Open in IMG/M |
| 3300018481|Ga0190271_12129595 | Not Available | 668 | Open in IMG/M |
| 3300021602|Ga0194060_10472689 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 593 | Open in IMG/M |
| 3300025878|Ga0209584_10052012 | Not Available | 1455 | Open in IMG/M |
| 3300025907|Ga0207645_10090446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1968 | Open in IMG/M |
| 3300025913|Ga0207695_11067185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → unclassified Polynucleobacter → Polynucleobacter sp. es-GGE-1 | 687 | Open in IMG/M |
| 3300025918|Ga0207662_10514666 | Not Available | 825 | Open in IMG/M |
| 3300025920|Ga0207649_10598009 | Not Available | 848 | Open in IMG/M |
| 3300025921|Ga0207652_10395090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1248 | Open in IMG/M |
| 3300025930|Ga0207701_11170159 | Not Available | 635 | Open in IMG/M |
| 3300025933|Ga0207706_10980297 | Not Available | 711 | Open in IMG/M |
| 3300025972|Ga0207668_10102922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → environmental samples → uncultured beta proteobacterium | 2125 | Open in IMG/M |
| 3300025986|Ga0207658_11601943 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300025986|Ga0207658_11669467 | Not Available | 582 | Open in IMG/M |
| 3300026035|Ga0207703_11718072 | Not Available | 603 | Open in IMG/M |
| 3300026088|Ga0207641_11928106 | Not Available | 592 | Open in IMG/M |
| 3300026095|Ga0207676_10725215 | Not Available | 965 | Open in IMG/M |
| 3300026095|Ga0207676_11010640 | Not Available | 820 | Open in IMG/M |
| 3300026116|Ga0207674_11129301 | Not Available | 753 | Open in IMG/M |
| 3300026121|Ga0207683_11247647 | Not Available | 689 | Open in IMG/M |
| 3300026142|Ga0207698_10517712 | Not Available | 1164 | Open in IMG/M |
| 3300027471|Ga0209995_1008732 | Not Available | 1636 | Open in IMG/M |
| 3300027894|Ga0209068_10805099 | Not Available | 553 | Open in IMG/M |
| 3300027899|Ga0209668_10093752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1731 | Open in IMG/M |
| 3300028381|Ga0268264_11421478 | Not Available | 704 | Open in IMG/M |
| 3300028587|Ga0247828_10036609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2048 | Open in IMG/M |
| 3300028652|Ga0302166_10005276 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2381 | Open in IMG/M |
| 3300028770|Ga0302258_1161865 | Not Available | 552 | Open in IMG/M |
| 3300028861|Ga0302259_1015258 | All Organisms → cellular organisms → Bacteria | 1712 | Open in IMG/M |
| 3300028868|Ga0302163_10050576 | Not Available | 982 | Open in IMG/M |
| 3300029990|Ga0311336_10031502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → environmental samples → uncultured beta proteobacterium | 4080 | Open in IMG/M |
| 3300029990|Ga0311336_12100672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300030003|Ga0302172_10129697 | Not Available | 778 | Open in IMG/M |
| 3300030010|Ga0302299_10344566 | Not Available | 769 | Open in IMG/M |
| 3300030943|Ga0311366_11852310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 515 | Open in IMG/M |
| 3300031232|Ga0302323_100757789 | Not Available | 1064 | Open in IMG/M |
| 3300031546|Ga0318538_10086056 | All Organisms → cellular organisms → Bacteria | 1603 | Open in IMG/M |
| 3300031562|Ga0310886_10796933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → unclassified Polynucleobacter → Polynucleobacter sp. es-GGE-1 | 595 | Open in IMG/M |
| 3300031681|Ga0318572_10082997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → environmental samples → uncultured beta proteobacterium | 1783 | Open in IMG/M |
| 3300031720|Ga0307469_10506867 | Not Available | 1059 | Open in IMG/M |
| 3300031726|Ga0302321_102409543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 614 | Open in IMG/M |
| 3300031805|Ga0318497_10857599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 510 | Open in IMG/M |
| 3300031847|Ga0310907_10664144 | Not Available | 573 | Open in IMG/M |
| 3300031854|Ga0310904_10913303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → unclassified Polynucleobacter → Polynucleobacter sp. es-GGE-1 | 621 | Open in IMG/M |
| 3300031892|Ga0310893_10208296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 792 | Open in IMG/M |
| 3300031902|Ga0302322_100970638 | Not Available | 1022 | Open in IMG/M |
| 3300031918|Ga0311367_11056070 | Not Available | 811 | Open in IMG/M |
| 3300031939|Ga0308174_10044091 | Not Available | 2970 | Open in IMG/M |
| 3300031939|Ga0308174_10150405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1732 | Open in IMG/M |
| 3300031995|Ga0307409_100987035 | Not Available | 860 | Open in IMG/M |
| 3300031996|Ga0308176_11534790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 710 | Open in IMG/M |
| 3300032004|Ga0307414_10440904 | Not Available | 1140 | Open in IMG/M |
| 3300032144|Ga0315910_11638862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 502 | Open in IMG/M |
| 3300032156|Ga0315295_11911013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 560 | Open in IMG/M |
| 3300032157|Ga0315912_10474424 | Not Available | 994 | Open in IMG/M |
| 3300032173|Ga0315268_11182112 | Not Available | 774 | Open in IMG/M |
| 3300032256|Ga0315271_11731928 | Not Available | 537 | Open in IMG/M |
| 3300032275|Ga0315270_10161491 | Not Available | 1355 | Open in IMG/M |
| 3300032397|Ga0315287_10119085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3022 | Open in IMG/M |
| 3300032401|Ga0315275_10817686 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
| 3300032897|Ga0335071_10538554 | Not Available | 1120 | Open in IMG/M |
| 3300033408|Ga0316605_11492277 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 656 | Open in IMG/M |
| 3300033483|Ga0316629_10335348 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1038 | Open in IMG/M |
| 3300033493|Ga0316631_10090897 | Not Available | 1064 | Open in IMG/M |
| 3300033521|Ga0316616_104607349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → Candidatus Accumulibacter vicinus | 519 | Open in IMG/M |
| 3300034127|Ga0370489_0005952 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2999 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 9.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 7.35% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 7.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.15% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.15% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 4.41% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 4.41% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.68% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 2.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.94% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.21% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.21% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.21% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.21% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 1.47% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.47% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.47% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.47% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.47% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.47% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.74% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.74% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.74% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.74% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.74% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.74% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.74% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.74% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.74% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.74% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.74% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.74% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.74% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.74% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.74% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.74% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.74% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.74% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005940 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006604 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012527 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ83 (22.06) | Environmental | Open in IMG/M |
| 3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014261 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014308 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014312 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D1 | Environmental | Open in IMG/M |
| 3300014323 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailB_D1 | Environmental | Open in IMG/M |
| 3300015203 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3c, vegetated patch on medial moraine) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300021602 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L222-5m | Environmental | Open in IMG/M |
| 3300025878 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028652 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_3 | Environmental | Open in IMG/M |
| 3300028770 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_4 | Environmental | Open in IMG/M |
| 3300028861 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N3_4 | Environmental | Open in IMG/M |
| 3300028868 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_3 | Environmental | Open in IMG/M |
| 3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300030003 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_3 | Environmental | Open in IMG/M |
| 3300030010 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_4 | Environmental | Open in IMG/M |
| 3300030943 | III_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
| 3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
| 3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
| 3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
| 3300033416 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
| 3300033483 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033493 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D3_A | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300034127 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deeps_02471460 | 2199352024 | Soil | MQVLQRVDLFTDTGLKTQLAGHLQPIVDRASAELVKAITEHVGGVLRTYVA |
| F14TC_1004491612 | 3300000559 | Soil | LQPIVDRASADLVTTINREVGQILRAYVAEAIEREIETWRESNP* |
| Ga0062383_103195841 | 3300004778 | Wetland Sediment | QLGARLQPIVDRASEELVTTINEQVGELLRSYIAEAIAREIEKSRKEGG* |
| Ga0062594_1007510821 | 3300005093 | Soil | QLGARLQPIVDRASADLVRTINQHVGELLRSYVAEAIEREIENWRRGT* |
| Ga0070683_1015800682 | 3300005329 | Corn Rhizosphere | GMRDQLGARLQPIVARASAELVETINHALGELVRGYVAEAIEREIESWRKRDG* |
| Ga0070670_1016606751 | 3300005331 | Switchgrass Rhizosphere | IVDRASQDLVATINQHVGVLLRAYVAEAIEREIERWRADRP* |
| Ga0070666_114632791 | 3300005335 | Switchgrass Rhizosphere | PIVDRASADLVATINQHVGQILRGYVAEAIEREIEKWRQEPR* |
| Ga0068868_1002102251 | 3300005338 | Miscanthus Rhizosphere | RDQLGARLQPIVNRASAELVATINRELGELVRGYVAEAIEREIESWRKRGES* |
| Ga0070687_1005675321 | 3300005343 | Switchgrass Rhizosphere | ARLQPIVARASAELVETINHALGELVRGYVAEAIEREIESWRKRDG* |
| Ga0070668_1000705883 | 3300005347 | Switchgrass Rhizosphere | GLREQLNQRLQPIVDRASADLVAAINQHVGQILREYVAEAIEREIEKWRQEPR* |
| Ga0070675_1004864061 | 3300005354 | Miscanthus Rhizosphere | DQLGARLQPIVDRASADLVATINQHVGDLLRTYVAEAIEREIENWRRGN* |
| Ga0070673_1007315932 | 3300005364 | Switchgrass Rhizosphere | QPIVDRASADLVRTINQHVGELLRSYVAEAIEREIENWRRGT* |
| Ga0070673_1011412961 | 3300005364 | Switchgrass Rhizosphere | LQPIVDRASADLVATINQHVGDLLRTYVAEAIEREIENWRRGN* |
| Ga0070688_1003910902 | 3300005365 | Switchgrass Rhizosphere | TDTGMRDQLGARLQPIVDRASAELVETINRELGELVRGYVAEAIEREIESWRNRGDS* |
| Ga0070667_1019590241 | 3300005367 | Switchgrass Rhizosphere | PIVDRASADLVATINQHVGELLRAYVAEAIEREIVNWRQNH* |
| Ga0070701_109020781 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | TGLREQLGARLQPIVDRASADLVATINLHVGDLLRAYVAEAIEREIESWKRNT* |
| Ga0070663_1002012041 | 3300005455 | Corn Rhizosphere | GARLQPIVDRASADLVATINQHVGDLLRTYVAEAIEREIENWRRGN* |
| Ga0070663_1002455801 | 3300005455 | Corn Rhizosphere | TGLREQLAARLQPIVDRASADLVATINQHVGVLLRAYVAEAIEREIERWRDQSR* |
| Ga0070663_1016446511 | 3300005455 | Corn Rhizosphere | RLQPIVDRASADLVATINQHVGELLRAYVAEAIEREIDS* |
| Ga0068867_1019845692 | 3300005459 | Miscanthus Rhizosphere | TGLQEQLKARLQPIVDDASARLVATINQQVGQLLRAYVAEAIEREIEKWRQGSK* |
| Ga0068853_1020443981 | 3300005539 | Corn Rhizosphere | QPIVDRASQDLVATINQHVGVLLRAYVAEAIEREIERWRADRP* |
| Ga0068852_1003559601 | 3300005616 | Corn Rhizosphere | ARLQPIVDRASADLVATINQHVGDLLRTYVAEAIEREIENWRRGN* |
| Ga0068864_1019206243 | 3300005618 | Switchgrass Rhizosphere | IVDRASADLVATINQHVGELLRAYVAEAIEREIVNWRQNH* |
| Ga0068866_101885002 | 3300005718 | Miscanthus Rhizosphere | ERLKPIVDRASADLVATINQHVGQILRAYVAEAIEREIEKWRQEPR* |
| Ga0068866_108795702 | 3300005718 | Miscanthus Rhizosphere | RLQPIVDRASADLVATINQHVGELLRAYVAEAIEREIDSWRRNH* |
| Ga0068863_1015850361 | 3300005841 | Switchgrass Rhizosphere | LQPIVDRASADLVTAINQHVGQLLRAYVAEAIEREIEKWRANSR* |
| Ga0068858_1015399262 | 3300005842 | Switchgrass Rhizosphere | LGARLQPIVDRASADLVRTINQHVGELLRSYVAEAIEREIENWRRGT* |
| Ga0068860_1008208302 | 3300005843 | Switchgrass Rhizosphere | RLQPIVDRASADLVATINQHVGELLRAYVAEAIEREIVNWRQSH* |
| Ga0068860_1008290992 | 3300005843 | Switchgrass Rhizosphere | RLGERLKPIVDRASADLVDAINQHVGEILRAYVSEAIEREIDRWKSGR* |
| Ga0081455_105328962 | 3300005937 | Tabebuia Heterophylla Rhizosphere | QLNQRLQPIVDRASADLVAAINQHVGQILREYVAEAIEREIEKWRQEPR* |
| Ga0073913_100616151 | 3300005940 | Sand | TDTGLQEQLARRLQPIVDRASGELVTAINQHVGQLMRAYVAEAIEREIEKWRQGG* |
| Ga0075023_1002461211 | 3300006041 | Watersheds | HGELAARLQPIVDRASVDLVTTINREVGQILRAYVAEAIEREIEKWREANP* |
| Ga0074060_119595653 | 3300006604 | Soil | TGLREQLTARLQPVVDRASADLVATINREVGQMLRTYVAEAIEREIEHWRHGGG* |
| Ga0075521_100840721 | 3300006642 | Arctic Peat Soil | TGLREQLGRRLQPVVDRASADLVATINLHVGEILRAYVAEAIEREIESWRKNN* |
| Ga0075434_1001791831 | 3300006871 | Populus Rhizosphere | DAGLRDQLGAHLRPIVDRASGELVATINRELGELVRGYVAEAIEREIESWRAKEK* |
| Ga0075429_1007141732 | 3300006880 | Populus Rhizosphere | RDQLGARLQPIVVRASAELVETINQALGELVRGYVAEAIEREIESWRKRDG* |
| Ga0102851_127031702 | 3300009091 | Freshwater Wetlands | TLRAKLGEQLQPLVERASADLVAAINQHVGDLLRTYVAEALEREIERWRDSQR* |
| Ga0115027_106636931 | 3300009131 | Wetland | PIVDRASADLVATINQQVGQLLRAYVAEAIEREIEKWRHGSGRR* |
| Ga0105243_112933361 | 3300009148 | Miscanthus Rhizosphere | PIVDRASADLVRTINQHVGELLRSYVAEAIEREIENWRRGT* |
| Ga0115028_100892471 | 3300009179 | Wetland | DTGLQEQLARRLQPMVDRASADLVATINHHVGALMRAYVAEAIEREIEKWRAGGR* |
| Ga0105237_108768401 | 3300009545 | Corn Rhizosphere | ARLSPIVERASAALVETINRELGELVRGYVAEAIEREIESWRNRGA* |
| Ga0105238_129010542 | 3300009551 | Corn Rhizosphere | ARLQPIVDRASADLVATINQHVGDLLRSYVAEAIEREIENWRRGN* |
| Ga0134128_108186843 | 3300010373 | Terrestrial Soil | LLPDAGLRDQLGAHLRPIVDRASGELVATINRELGELVRGYVAEAIEREIESWRAKEK* |
| Ga0134126_104413331 | 3300010396 | Terrestrial Soil | LGARLAPIVERASAQLIETINREIGELVRSYVAEAIEREIESWRKQNPTPK* |
| Ga0134126_109829861 | 3300010396 | Terrestrial Soil | DQLGARLQPIVDRASAELVTTINRELGELVRGYVADAIEREIESWRKRGT* |
| Ga0134126_117763801 | 3300010396 | Terrestrial Soil | LREQLGARLSPIVERASAQLVETINRELGELVRGYVAEAIEREIESWRTQHPK* |
| Ga0134123_102495211 | 3300010403 | Terrestrial Soil | REQLGQRLQPIVDRASADLVATINLHVGELLRAYVAEAIDREIERWRTDVTKS* |
| Ga0137364_107068853 | 3300012198 | Vadose Zone Soil | DIFTDTGLKDQLNQRLQPIVDRASADLVAAINQHGGQLLRAYVAEEIER* |
| Ga0137382_109793191 | 3300012200 | Vadose Zone Soil | DTGLQGELAARLQPIGDRASADLVTTINREVGQILRAYVAEAIEREIETWRESNP* |
| Ga0137376_110559591 | 3300012208 | Vadose Zone Soil | GLHGELAARLQPIVDRASADLMATINREVGQILRAYVAEAIEREIETWRESNP* |
| Ga0136633_12283751 | 3300012527 | Polar Desert Sand | QPIVDRASADLVTTINREVGELLRAYVAEAIEREIERWRQEKGEMR* |
| Ga0157308_102650391 | 3300012910 | Soil | QLGARLQPIVARASAELVETINQALGELVRGYVAEAIEREIESWRKRDG* |
| Ga0164301_111999451 | 3300012960 | Soil | ALREQLGARLSPIVEHASAALVETINRELGELVRGYVAEAIEREIESWRKRDG* |
| Ga0164302_103123262 | 3300012961 | Soil | LGARLQPIVARASAELVETINQALGELVRGYVAEAIEREIESWRKRDG* |
| Ga0157371_101644653 | 3300013102 | Corn Rhizosphere | QLAARMQPIVDRASADLVATINQHVGVLLRAYVAEAIEREIERWRDQSR* |
| Ga0157371_110998611 | 3300013102 | Corn Rhizosphere | TDTGLREQLGARLSPIVERASAELIETINRELGELVRGYVAEAIEREIESWRSREDT* |
| Ga0157370_100322465 | 3300013104 | Corn Rhizosphere | DTALREQLGARLSPIVERASAALVETINRELGELVRGYVAEAIEREIESWRNRDS* |
| Ga0157369_106932821 | 3300013105 | Corn Rhizosphere | LREQLGARLSPIVERASAELIETINRELGELVRGYVAEAIEREIESWRSREDT* |
| Ga0157375_106256871 | 3300013308 | Miscanthus Rhizosphere | GARLQPIVDRASDDLVAAINRDLGELLRAYVAEAIEREIEKLTRG* |
| Ga0075360_10856102 | 3300014261 | Natural And Restored Wetlands | DRASADLVATINQHVGELLRAYVAEAIEREIESWRKSTK* |
| Ga0075354_11460501 | 3300014308 | Natural And Restored Wetlands | IVDRASADLVTAINHHLGALLRGYVAEAIEREIDKLRGTE* |
| Ga0075345_10203211 | 3300014312 | Natural And Restored Wetlands | PLVERASADLVAAINQHVGDLMRTYVAEAIEQEIERWRNGQH* |
| Ga0075356_10655221 | 3300014323 | Natural And Restored Wetlands | QEQLARRLQPIVDRASGELVTAINQHVGQLMRAYVAEAIEREIEKWRAGGL* |
| Ga0167650_10209051 | 3300015203 | Glacier Forefield Soil | VDRASADLVATINQQVGQILRGYVAEAIEREIEKWRQEPR* |
| Ga0132256_1035138661 | 3300015372 | Arabidopsis Rhizosphere | GLQGELAARLQPIVDRASADLVTTINREVGQILRAYVAEAIEREIETWRESNP* |
| Ga0190271_109338232 | 3300018481 | Soil | GERLKPLVDRASAELVDAINQHVGEILRSYVAEAIEREIESWRNRQS |
| Ga0190271_121295951 | 3300018481 | Soil | IVDRASADLVDAINQHVGEILRAYVAEAIEREIDRWKSSR |
| Ga0194060_104726891 | 3300021602 | Anoxic Zone Freshwater | IVDRASADLVATINQQVGQLLRTYVAEAIEREIDKWRHGGGA |
| Ga0209584_100520122 | 3300025878 | Arctic Peat Soil | QLGRRLQPVVDRASADLVATINLHVGEILRAYVAEAIEREIESWRKNN |
| Ga0207645_100904463 | 3300025907 | Miscanthus Rhizosphere | LYADTGLREQLGVRLQPIVDRASAELVTTINRELGELVRGYVADAIEREIEAWRKREA |
| Ga0207705_102387161 | 3300025909 | Corn Rhizosphere | QLGARLSPIVERASAQLIETINRELGELVRGYVAEAIEREIDSWRNQNPK |
| Ga0207695_110671852 | 3300025913 | Corn Rhizosphere | ARLAPIVERASAQLIETINRELGELVRSYVAEAIEREIDSWRKQNPDPA |
| Ga0207662_105146662 | 3300025918 | Switchgrass Rhizosphere | LGARLQPIVARASAELVETINHALGELVRGYVAEAIEREIESWRKRDG |
| Ga0207649_105980091 | 3300025920 | Corn Rhizosphere | EQLAARMQPIVDRASQDLVATINQHVGVLLRAYVAEAIEREIERWRADRP |
| Ga0207652_103950903 | 3300025921 | Corn Rhizosphere | QLGVRLQPIVDRASAELVTTINRELGELVRGYVADAIEREIEAWRKREA |
| Ga0207701_111701592 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | KPIVDRASADLVATINQHVGQILRAYVAEAIEREIEKWRQEPR |
| Ga0207706_109802972 | 3300025933 | Corn Rhizosphere | LYADTGLREQLGVRLQPIVDRASAELVTTISRELGELVRGYVADAIEREIESWRKRGA |
| Ga0207651_102808102 | 3300025960 | Switchgrass Rhizosphere | VDRASADLVRTINQHVGELLRSYVAEAIEREIENWRRGT |
| Ga0207668_101029223 | 3300025972 | Switchgrass Rhizosphere | DTGLREQLGARLQPIVDRASADLVTTINLHVGELLRAYMAEAIEREIESWKRNN |
| Ga0207658_116019432 | 3300025986 | Switchgrass Rhizosphere | TARLQPIVDRASDDLVAAINRDLGELLRAYVAEAIEREIEKLTRG |
| Ga0207658_116694671 | 3300025986 | Switchgrass Rhizosphere | GARLQPIVDRASADLVATINQHVGELLRAYVAEAIEREIVNWRQSH |
| Ga0207703_117180722 | 3300026035 | Switchgrass Rhizosphere | QLNARLQPIVDRASADLVAAINQHVGQLLREYVAEAIEREIESWRKRDG |
| Ga0207641_119281061 | 3300026088 | Switchgrass Rhizosphere | LQPIVDRASADLVTAINQHVGQLLRAYVAEAIEREIEKWRANSR |
| Ga0207676_107252151 | 3300026095 | Switchgrass Rhizosphere | QLGARLQPIVDRASADLVTTINLHVGELLRAYMAEAIEREIESWKRNN |
| Ga0207676_110106401 | 3300026095 | Switchgrass Rhizosphere | FTDTGLREQLGSRLQPIVDRASADLVATINQHVGELLRAYVAEAIEREIVNWRQNH |
| Ga0207674_111293011 | 3300026116 | Corn Rhizosphere | LFTDTGMRDQLGARLQPIVDRASAELVETINHQLGELVRGYVAEAIEREIESWRKRSG |
| Ga0207683_112476471 | 3300026121 | Miscanthus Rhizosphere | VDRASADLVATINQHVGDLLRTYVAEAIEREIENWRRGN |
| Ga0207698_105177122 | 3300026142 | Corn Rhizosphere | ARLQPIVDRASADLVATINQHVGDLLRTYVAEAIEREIENWRRGN |
| Ga0209995_10087321 | 3300027471 | Arabidopsis Thaliana Rhizosphere | RLQPIVDRASAELVTTINRELGELVRGYVADAIEREIESWRKRSG |
| Ga0209068_108050992 | 3300027894 | Watersheds | IVDRASADLVTTINREVGQILRAYVAEAIEREIATWREGNS |
| Ga0209668_100937521 | 3300027899 | Freshwater Lake Sediment | TDTGLQEQLARRLQPMVDRASADLVATINHHVGALMRAYVAEAIEREIEKWRAGGR |
| Ga0268264_114214781 | 3300028381 | Switchgrass Rhizosphere | EQLGARLQPIVDRASADLVATINQHVGELLRAYVAEAIEREIVNWRQSH |
| Ga0247828_100366093 | 3300028587 | Soil | LGARLQPIVDRASAELVTTINRELGELVRGYVADAIEREIEAWRKREA |
| Ga0302166_100052764 | 3300028652 | Fen | DTGLRTQLGARLQPIVDRASADLVATINQHVGELLRAYVAEAIEREIDSWRRDH |
| Ga0302258_11618651 | 3300028770 | Fen | PIVDRASADLVATINQHVGELLRAYVAEAIEREIDSWRRNH |
| Ga0302259_10152583 | 3300028861 | Fen | RTQLGERLQPIVDRASADLVATINQHVGELLRAYVAEAIEREIDSWRRNH |
| Ga0302163_100505761 | 3300028868 | Fen | TGLRTQLGARLQPIVDRASADLVATINEHVGELLRAYVAEAIEREIDSWRRSH |
| Ga0311336_100315026 | 3300029990 | Fen | RTQLGARLQPIVDRASADLVATINQHVGELLRAYVAEAIEREIDSWRRNH |
| Ga0311336_121006721 | 3300029990 | Fen | LAARLQPIVDRASADLVATINQQVGQLLRAYVAEAIEREIDRWRENAG |
| Ga0302172_101296972 | 3300030003 | Fen | TGLRTQLGARLQPIVDRASADLVATINQHVGELLRAYVAEAIEREIDSWRRNH |
| Ga0302299_103445662 | 3300030010 | Fen | RTQLGARLQPIVDRASADLVATINEHVGELLRAYVAEAIEREIDSWRRSH |
| Ga0311366_118523102 | 3300030943 | Fen | QLGARLQPIVDRASADLVATINQHVGELLRAYVAEAIEREIDSWRRNH |
| Ga0302323_1007577892 | 3300031232 | Fen | QLGERLQPIVDRASADLVATINQHVGELLRAYVAEAIEREIDSWRRNH |
| Ga0318538_100860561 | 3300031546 | Soil | TDAGLREQLGERLKPIVDRASADLVATINTHVGELLRAYVAEAIEREIERWRDAH |
| Ga0310886_107969332 | 3300031562 | Soil | DQLGARLQPIVDRASAELVTTINRELGELVRGYVADAIEREIEAWRKREA |
| Ga0318572_100829973 | 3300031681 | Soil | QLGERLKPIVDRASADLVATINTHVGELLRAYVAEAIEREIERWRDAH |
| Ga0307469_105068671 | 3300031720 | Hardwood Forest Soil | PAARLQPIVDRASADLVTTINREVGQILRAYVAEAIEREIATWREGNP |
| Ga0302321_1024095432 | 3300031726 | Fen | LREQLGRRLQPIVDRASADLVATISLHVGELLRAYVAEAIEREIERWRRDN |
| Ga0318497_108575992 | 3300031805 | Soil | RLQPIVDRASADLVATINQHVGVLLRAYVAEAIEREIERWRDAH |
| Ga0310907_106641442 | 3300031847 | Soil | TGLRDQLGARLQPIVDRASADLVRTINQHVGELLRSYVAEAIEREIENWRRGT |
| Ga0310904_109133031 | 3300031854 | Soil | GLREQLGVRLQPIVDRASAELVTTINRELGELVRGYVADAIEREIEAWRKREA |
| Ga0310893_102082962 | 3300031892 | Soil | LRERLGERLKPIVDNASADLVAAINQHVGEILRAYVAEAIEREIDRWKSSR |
| Ga0302322_1009706382 | 3300031902 | Fen | ARLQPIVDRASADLVATINQHVGELLRAYVAEAIEREIDSWRRNH |
| Ga0311367_110560701 | 3300031918 | Fen | TDTGLRTQLGARLQPIVDRASADLVATINQHVGELLREYVAEAIEREIDSWRRNH |
| Ga0308174_100440914 | 3300031939 | Soil | REQLAARLQPIVDRAGADLVATINQHVGVLLRAYVAEAIEREIERWRADGR |
| Ga0308174_101504051 | 3300031939 | Soil | DTGLREQLGARLSPIVERASAQLIETINRELGELVRGYVAEAIEREIDSWRNQNAPKAE |
| Ga0307409_1009870352 | 3300031995 | Rhizosphere | RDQLGARLQPIVDRASADLVATINQRVGELLRTYVSEAIEREIENWRRGT |
| Ga0307409_1020222102 | 3300031995 | Rhizosphere | RLRPVVDRAAADLVTAINEHVGELLRAQVAEAIEREIESWRNR |
| Ga0308176_115347901 | 3300031996 | Soil | DRASADLVATINQQVGQLLRAYVAEAIEREIDKWRQDGSGS |
| Ga0307414_104409041 | 3300032004 | Rhizosphere | DTALQAQLAERLQPIVDRASAEFVAAINQHVGQLLRAYVAEAIEREIDTWRGTGR |
| Ga0315910_116388622 | 3300032144 | Soil | TGLRERLGERLKPIVDRASADLVDAINQHVGEILRAYVAEAIEREIDRWKSGR |
| Ga0315295_119110132 | 3300032156 | Sediment | TARLQPIVDRASADLVAAINQHVGQLLRTYVAEAIEREIETWRHGGG |
| Ga0315912_104744242 | 3300032157 | Soil | RERLGERLKPIVDRASADLVDAINQHVGEILRAYVAEAIEREIDRWKSGS |
| Ga0315268_111821121 | 3300032173 | Sediment | EQLTARLQPIVDRASADLVATINQHVGQLLRAYVAEAIEREIEKWRQNGA |
| Ga0315271_117319282 | 3300032256 | Sediment | LQPIADRASADFVKAINLHVGDLLRTYVAEAIEREIERWRRDH |
| Ga0315270_101614913 | 3300032275 | Sediment | DTRLGEQLAVQLQPIVDRASAELVTTINEHVGKLIRAYIAEAIEREIETWRKGNS |
| Ga0315287_101190855 | 3300032397 | Sediment | LQPIVDRASADLVATINQQVGHMLRAYVAEAIEREIDKWRQDGA |
| Ga0315275_108176862 | 3300032401 | Sediment | LQEQLTARLQPIVDRASADLVATINQHVGQLLRAYVAEAIEREIEKWRQNGA |
| Ga0335071_105385541 | 3300032897 | Soil | QPIVDRASADLVATINQHVGELLRAYVAEAIEREIESWRRNTAK |
| Ga0316605_114922771 | 3300033408 | Soil | VDRASADLVATINLHVGELLRAYVAEAIEREIENWRSNH |
| Ga0316622_1019102941 | 3300033416 | Soil | LGEQLQPLVERASADLVAAINQHVGDLLRTYVAEALEQEIERWRDSQR |
| Ga0316601_1007115791 | 3300033419 | Soil | TTLRAKLGEQLQPLVERASADLVAAINQHVGDLLRTYVAEALEQEIERWRDSQR |
| Ga0316629_103353481 | 3300033483 | Soil | LQPIVDRASADLVATINQHVGQLLRSYVAEAIEREIEKWRGGEG |
| Ga0316631_100908972 | 3300033493 | Soil | IVDRASADLVATINQQVGQILRGYVAEAIEREIEKWRHGSGRR |
| Ga0316616_1046073491 | 3300033521 | Soil | LQEQLAAKLRPIVDRASAELVATINQQVGQLLRAYVAEAVEREIDKLRQDGR |
| Ga0370489_0005952_1_123 | 3300034127 | Untreated Peat Soil | IVDRASADLVATINQHVGELLRAYVAEAIEREIDSWRRNH |
| ⦗Top⦘ |