Basic Information | |
---|---|
Family ID | F057276 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 136 |
Average Sequence Length | 49 residues |
Representative Sequence | MKTVTRIVIVAAIAGVIYFATIGRDQFYDLLDFFYEIISAIAGGYLKK |
Number of Associated Samples | 100 |
Number of Associated Scaffolds | 136 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 54.41 % |
% of genes near scaffold ends (potentially truncated) | 27.21 % |
% of genes from short scaffolds (< 2000 bps) | 86.03 % |
Associated GOLD sequencing projects | 84 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.46 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (97.059 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere (11.029 % of family members) |
Environment Ontology (ENVO) | Unclassified (47.059 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (71.324 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 57.89% β-sheet: 0.00% Coil/Unstructured: 42.11% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 136 Family Scaffolds |
---|---|---|
PF04226 | Transgly_assoc | 26.47 |
PF11954 | DUF3471 | 15.44 |
PF00144 | Beta-lactamase | 12.50 |
PF06831 | H2TH | 5.88 |
PF01149 | Fapy_DNA_glyco | 5.88 |
PF07676 | PD40 | 3.68 |
PF01061 | ABC2_membrane | 2.21 |
PF05016 | ParE_toxin | 2.21 |
PF04255 | DUF433 | 1.47 |
PF13620 | CarboxypepD_reg | 0.74 |
PF02675 | AdoMet_dc | 0.74 |
PF13304 | AAA_21 | 0.74 |
PF06276 | FhuF | 0.74 |
PF02452 | PemK_toxin | 0.74 |
COG ID | Name | Functional Category | % Frequency in 136 Family Scaffolds |
---|---|---|---|
COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 26.47 |
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 12.50 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 12.50 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 12.50 |
COG0266 | Formamidopyrimidine-DNA glycosylase | Replication, recombination and repair [L] | 11.76 |
COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 1.47 |
COG1586 | S-adenosylmethionine decarboxylase | Amino acid transport and metabolism [E] | 0.74 |
COG2337 | mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module | Defense mechanisms [V] | 0.74 |
COG4114 | Ferric iron reductase protein FhuF, involved in iron transport | Inorganic ion transport and metabolism [P] | 0.74 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 97.06 % |
Unclassified | root | N/A | 2.94 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2162886007|SwRhRL2b_contig_3297144 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1010 | Open in IMG/M |
2162886012|MBSR1b_contig_725019 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
3300000953|JGI11615J12901_12302876 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
3300002568|C688J35102_118752278 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 593 | Open in IMG/M |
3300002568|C688J35102_119883170 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
3300004114|Ga0062593_101980843 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 646 | Open in IMG/M |
3300004156|Ga0062589_100866732 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 827 | Open in IMG/M |
3300004156|Ga0062589_101332046 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 696 | Open in IMG/M |
3300004157|Ga0062590_101079458 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 771 | Open in IMG/M |
3300004157|Ga0062590_101129253 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 758 | Open in IMG/M |
3300004479|Ga0062595_101463735 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
3300004643|Ga0062591_100331051 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1218 | Open in IMG/M |
3300005093|Ga0062594_101457956 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
3300005288|Ga0065714_10246391 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 784 | Open in IMG/M |
3300005289|Ga0065704_10001322 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8964 | Open in IMG/M |
3300005290|Ga0065712_10454998 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 683 | Open in IMG/M |
3300005290|Ga0065712_10692113 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 523 | Open in IMG/M |
3300005293|Ga0065715_10146009 | All Organisms → cellular organisms → Bacteria | 1788 | Open in IMG/M |
3300005293|Ga0065715_10270811 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1111 | Open in IMG/M |
3300005293|Ga0065715_10811253 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 594 | Open in IMG/M |
3300005293|Ga0065715_11181936 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 502 | Open in IMG/M |
3300005294|Ga0065705_10106215 | All Organisms → cellular organisms → Bacteria | 6888 | Open in IMG/M |
3300005294|Ga0065705_10950976 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
3300005295|Ga0065707_10696409 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 636 | Open in IMG/M |
3300005329|Ga0070683_101694733 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 608 | Open in IMG/M |
3300005331|Ga0070670_101941559 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
3300005338|Ga0068868_101251979 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 688 | Open in IMG/M |
3300005338|Ga0068868_101926268 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 560 | Open in IMG/M |
3300005343|Ga0070687_100940077 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
3300005345|Ga0070692_10678511 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 691 | Open in IMG/M |
3300005355|Ga0070671_101046871 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 716 | Open in IMG/M |
3300005364|Ga0070673_100074864 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 2729 | Open in IMG/M |
3300005440|Ga0070705_100199404 | All Organisms → cellular organisms → Bacteria | 1371 | Open in IMG/M |
3300005459|Ga0068867_101631416 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300005468|Ga0070707_100389758 | All Organisms → cellular organisms → Bacteria | 1353 | Open in IMG/M |
3300005468|Ga0070707_101743561 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 590 | Open in IMG/M |
3300005518|Ga0070699_100007962 | All Organisms → cellular organisms → Bacteria | 9201 | Open in IMG/M |
3300005536|Ga0070697_100581611 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
3300005543|Ga0070672_101926246 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 532 | Open in IMG/M |
3300005545|Ga0070695_100881470 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
3300005547|Ga0070693_100815555 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 693 | Open in IMG/M |
3300005578|Ga0068854_100892790 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 781 | Open in IMG/M |
3300005617|Ga0068859_102906608 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
3300005840|Ga0068870_11098311 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 572 | Open in IMG/M |
3300005841|Ga0068863_100458219 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1252 | Open in IMG/M |
3300005841|Ga0068863_101879326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 609 | Open in IMG/M |
3300005841|Ga0068863_101972684 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 594 | Open in IMG/M |
3300005842|Ga0068858_100441261 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1254 | Open in IMG/M |
3300005843|Ga0068860_100824368 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 942 | Open in IMG/M |
3300005843|Ga0068860_100998427 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
3300005873|Ga0075287_1011944 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
3300005888|Ga0075289_1065034 | Not Available | 588 | Open in IMG/M |
3300006058|Ga0075432_10030321 | All Organisms → cellular organisms → Bacteria | 1869 | Open in IMG/M |
3300006755|Ga0079222_10041199 | All Organisms → cellular organisms → Bacteria | 2070 | Open in IMG/M |
3300006852|Ga0075433_10014608 | All Organisms → cellular organisms → Bacteria | 6419 | Open in IMG/M |
3300006871|Ga0075434_101988728 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
3300006931|Ga0097620_103136620 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 504 | Open in IMG/M |
3300009093|Ga0105240_11533894 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 698 | Open in IMG/M |
3300009093|Ga0105240_11931319 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 614 | Open in IMG/M |
3300009101|Ga0105247_10005623 | All Organisms → cellular organisms → Bacteria | 7866 | Open in IMG/M |
3300009101|Ga0105247_10203539 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1331 | Open in IMG/M |
3300009101|Ga0105247_10784355 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 725 | Open in IMG/M |
3300009147|Ga0114129_12786542 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 581 | Open in IMG/M |
3300009148|Ga0105243_10746678 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 959 | Open in IMG/M |
3300009162|Ga0075423_11637227 | Not Available | 692 | Open in IMG/M |
3300009162|Ga0075423_11781877 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 664 | Open in IMG/M |
3300009174|Ga0105241_10030096 | All Organisms → cellular organisms → Bacteria | 4055 | Open in IMG/M |
3300009177|Ga0105248_11655121 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 725 | Open in IMG/M |
3300009551|Ga0105238_11854851 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300009553|Ga0105249_11618630 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 720 | Open in IMG/M |
3300009553|Ga0105249_13021108 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
3300009789|Ga0126307_10257969 | All Organisms → cellular organisms → Bacteria | 1401 | Open in IMG/M |
3300010039|Ga0126309_11275280 | Not Available | 508 | Open in IMG/M |
3300010042|Ga0126314_10658353 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 766 | Open in IMG/M |
3300010044|Ga0126310_10001775 | All Organisms → cellular organisms → Bacteria | 8463 | Open in IMG/M |
3300010044|Ga0126310_11778237 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 514 | Open in IMG/M |
3300010045|Ga0126311_10007671 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5879 | Open in IMG/M |
3300010045|Ga0126311_10035999 | All Organisms → cellular organisms → Bacteria | 3085 | Open in IMG/M |
3300010359|Ga0126376_10026457 | All Organisms → cellular organisms → Bacteria | 3867 | Open in IMG/M |
3300010362|Ga0126377_12427433 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
3300010373|Ga0134128_10321070 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1732 | Open in IMG/M |
3300010375|Ga0105239_10070827 | All Organisms → cellular organisms → Bacteria | 3830 | Open in IMG/M |
3300010375|Ga0105239_10601080 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1255 | Open in IMG/M |
3300010375|Ga0105239_12004785 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
3300010397|Ga0134124_11751087 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 654 | Open in IMG/M |
3300010397|Ga0134124_12273525 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
3300010399|Ga0134127_10011682 | All Organisms → cellular organisms → Bacteria | 6546 | Open in IMG/M |
3300010399|Ga0134127_10727471 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1035 | Open in IMG/M |
3300010399|Ga0134127_12994404 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
3300010400|Ga0134122_11024850 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 811 | Open in IMG/M |
3300011333|Ga0127502_10339038 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
3300012948|Ga0126375_10640003 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
3300012958|Ga0164299_10440256 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 849 | Open in IMG/M |
3300013297|Ga0157378_10455358 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1271 | Open in IMG/M |
3300013307|Ga0157372_11959811 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 673 | Open in IMG/M |
3300013308|Ga0157375_11240308 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 875 | Open in IMG/M |
3300013308|Ga0157375_12082051 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 675 | Open in IMG/M |
3300014968|Ga0157379_10925135 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 828 | Open in IMG/M |
3300015371|Ga0132258_10009144 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 20353 | Open in IMG/M |
3300015374|Ga0132255_101855093 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
3300015374|Ga0132255_104464915 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 593 | Open in IMG/M |
3300025900|Ga0207710_10081563 | All Organisms → cellular organisms → Bacteria | 1501 | Open in IMG/M |
3300025900|Ga0207710_10309936 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 799 | Open in IMG/M |
3300025904|Ga0207647_10069034 | All Organisms → cellular organisms → Bacteria | 2137 | Open in IMG/M |
3300025904|Ga0207647_10105738 | All Organisms → cellular organisms → Bacteria | 1667 | Open in IMG/M |
3300025907|Ga0207645_10757167 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 660 | Open in IMG/M |
3300025913|Ga0207695_11459653 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
3300025914|Ga0207671_11530740 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
3300025918|Ga0207662_10592562 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
3300025918|Ga0207662_10764319 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 680 | Open in IMG/M |
3300025922|Ga0207646_11071487 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 710 | Open in IMG/M |
3300025922|Ga0207646_11339350 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300025924|Ga0207694_11023640 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
3300025927|Ga0207687_10439952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1080 | Open in IMG/M |
3300025941|Ga0207711_10156438 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 2060 | Open in IMG/M |
3300025941|Ga0207711_10265256 | All Organisms → cellular organisms → Bacteria | 1579 | Open in IMG/M |
3300025941|Ga0207711_10869665 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
3300025949|Ga0207667_10613966 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
3300025960|Ga0207651_10349170 | All Organisms → cellular organisms → Bacteria | 1245 | Open in IMG/M |
3300025981|Ga0207640_10171065 | All Organisms → cellular organisms → Bacteria | 1619 | Open in IMG/M |
3300026035|Ga0207703_10179130 | All Organisms → cellular organisms → Bacteria | 1870 | Open in IMG/M |
3300026035|Ga0207703_11097960 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 764 | Open in IMG/M |
3300026035|Ga0207703_11723817 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 602 | Open in IMG/M |
3300026041|Ga0207639_10901313 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
3300026041|Ga0207639_11518123 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
3300026088|Ga0207641_11357682 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 712 | Open in IMG/M |
3300026089|Ga0207648_10054774 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 3483 | Open in IMG/M |
3300026095|Ga0207676_11471711 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 678 | Open in IMG/M |
3300027765|Ga0209073_10116934 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 957 | Open in IMG/M |
3300027775|Ga0209177_10306526 | Not Available | 607 | Open in IMG/M |
3300028380|Ga0268265_10263003 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1535 | Open in IMG/M |
3300028381|Ga0268264_10035241 | All Organisms → cellular organisms → Bacteria | 4119 | Open in IMG/M |
3300030511|Ga0268241_10016360 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1426 | Open in IMG/M |
3300031716|Ga0310813_12173469 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 525 | Open in IMG/M |
3300031939|Ga0308174_10945334 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 729 | Open in IMG/M |
3300033412|Ga0310810_10884555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 788 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 11.03% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 8.09% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.35% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 7.35% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 5.88% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 5.88% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 5.15% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 5.15% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 5.15% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.41% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.68% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.21% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.21% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.21% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.21% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.21% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.21% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.21% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.47% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.47% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.47% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.47% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.47% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.74% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.74% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.74% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.74% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.74% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.74% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.74% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 | Host-Associated | Open in IMG/M |
3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005873 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_301 | Environmental | Open in IMG/M |
3300005888 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_103 | Environmental | Open in IMG/M |
3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) | Host-Associated | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300011333 | Cornfield soil microbial communities from Stanford, California, USA - CI-CA-CRN metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300030511 | Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2) | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
SwRhRL2b_0546.00001480 | 2162886007 | Switchgrass Rhizosphere | MKTVTRVVVVAAIIAAIYFATVGRAQFYDLLDFFYEMIQAIASGYLKK |
MBSR1b_0638.00005460 | 2162886012 | Miscanthus Rhizosphere | MKTLTRIVIVAAIAAAIYFSTIGRDQFYGLLDFFNEIIQAIASGYLKK |
JGI11615J12901_123028762 | 3300000953 | Soil | MKTITRIVIVAAIAGVIYFATIGRNQFYDLLDFFYELIAAIAAGYLKK* |
C688J35102_1187522781 | 3300002568 | Soil | MKTVTRIVFVAAIVGVIYFATIGRDQFYDLLDFFYDFIAAIAGGYLKK* |
C688J35102_1198831701 | 3300002568 | Soil | MKTVTRIVLVAAIAGGIYFATIGRDQFYDLLDFFYEIIAAVAGGYLKK* |
Ga0062593_1019808432 | 3300004114 | Soil | MKTLTRIVVVALIVGAIYFATIGREQFYGLLDFFYEIINAIAAGYLKK* |
Ga0062589_1008667321 | 3300004156 | Soil | MKTVTRIVILAAIAGAIYFATIGRDQFYDLLDFFYEFIAAIAGGYLKK* |
Ga0062589_1013320462 | 3300004156 | Soil | MKTLTRLVVIALIAGVIYFATIGRDQFYDLLDFFYEMIAAIAAGYLKK* |
Ga0062590_1010794582 | 3300004157 | Soil | MKTISRIVLVAVIACGIYFFTVGKDQFNDLLHFFYEIIQAVAAGYLKK* |
Ga0062590_1011292532 | 3300004157 | Soil | MKTVTRIVILAAIAGVIYFATIGRDQFYDLLDFFYEFIAAIAGGYLKK* |
Ga0062595_1014637351 | 3300004479 | Soil | MKMVTGIVIVAVVIVVIYFATIGRDQFYDLLDFFYEILSAIAGGYLKK* |
Ga0062591_1003310511 | 3300004643 | Soil | MKTITRIVIVALIACAIYFGTIGRDQFYDLMDFFYEIIQAVAAGYLKK* |
Ga0062594_1014579562 | 3300005093 | Soil | MKTITRIVVVAAIAAAIYFATIGRAQFYDLLDFFYDMIQAVAAGYLKK* |
Ga0065714_102463912 | 3300005288 | Miscanthus Rhizosphere | MKSVTRIVIVALIAAVIYFATIGRDQFYDLLDFFSEFISAIAGGYLKK* |
Ga0065704_100013222 | 3300005289 | Switchgrass Rhizosphere | MKTVTRVVVVAAIIAAIYFATVGRAQFYDLLDFFYEMIQAIASGYLKK* |
Ga0065712_104549981 | 3300005290 | Miscanthus Rhizosphere | MKTLTRIVVVALIVGVIYFATIGREQFYGLVDFFYEIINAIAAGYLKK* |
Ga0065712_106921131 | 3300005290 | Miscanthus Rhizosphere | MIKQLNYWRIVRMKSVTRIVLVALIVAVIYFATIGREQFYDLLDFFSEFISAIAGGYLKK |
Ga0065715_101460092 | 3300005293 | Miscanthus Rhizosphere | MKTLTRIVIVAAIAAAIYFSTIGRDQFYGLLDFFNEIIQAIASGYLKK* |
Ga0065715_102708111 | 3300005293 | Miscanthus Rhizosphere | MKTIMRLVFVAAIIGVIYFATIGRDQFYDLLDFFYEILGAIAGGYLKK* |
Ga0065715_108112531 | 3300005293 | Miscanthus Rhizosphere | MKTVTRIVVVALIVAAIYFATIGREQFYGLLDFFYEIINAIAAGYLKK* |
Ga0065715_111819361 | 3300005293 | Miscanthus Rhizosphere | VALIVGVIYFATIGREQFYGLVDFFYEIINAIAAGYLKK* |
Ga0065705_101062152 | 3300005294 | Switchgrass Rhizosphere | MKTVTRVVVVAAIVAAIYFATIGRAQFYDLLDFFYEMIQAIASGYLKK* |
Ga0065705_109509762 | 3300005294 | Switchgrass Rhizosphere | VKTITRIVIVAVLAGVIYFATIGRDQFYDLLDFFYEIVQAVAAGYL |
Ga0065707_106964092 | 3300005295 | Switchgrass Rhizosphere | GGLVAGLRLMKTLTRIVVVALIVGAIYFATIGREQFYGLLDFFYEIINAIAAGYLKK* |
Ga0070683_1016947331 | 3300005329 | Corn Rhizosphere | MKTLTRLVVIALIAGVIYFATLGETQFYDLLDFFYEMIAAIGAGYLKK* |
Ga0070670_1019415591 | 3300005331 | Switchgrass Rhizosphere | MKTLTRLVVIALIAGVIYFATIGRDQFYDLLDFFYEMIATIGSGYLKK* |
Ga0068868_1012519792 | 3300005338 | Miscanthus Rhizosphere | MKSVTRIVILALIAAVIYFATIGRDQFYDLLDFFAEFISAIAGGYLKK* |
Ga0068868_1019262682 | 3300005338 | Miscanthus Rhizosphere | MKTVTRIVVVALIVAAIYFATIGREQFYGLVDFFYEIINAIAAGYLKK* |
Ga0070687_1009400773 | 3300005343 | Switchgrass Rhizosphere | MITQLNYWRIVRMKSVTRIVIVALIAAVIYFATIGRDQFYDLLDFFSE |
Ga0070692_106785112 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTLTRIVVVALIVGAIYFATIGREQFYGLVDFFYEIINAIAAGYLKK* |
Ga0070671_1010468712 | 3300005355 | Switchgrass Rhizosphere | MKALTRLVVIALIAGVIYFATIGRDQFYDLLDFFYEMIAAIGAGYLKK* |
Ga0070673_1000748644 | 3300005364 | Switchgrass Rhizosphere | MKSVTRIVIVALIVAVIYFATIGREQFYDLLDFFSEFISAIAGGYLKK* |
Ga0070705_1001994041 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | VAAIAAAIYFATIGRAQFYDLLDFFYDMIQAVAAGYLKK* |
Ga0068867_1016314162 | 3300005459 | Miscanthus Rhizosphere | MKTVTRIVFVAAIAGVIYFATIGRDQFYDLLDFFYEIIQAIAGGYLKK* |
Ga0070707_1003897584 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTVTRIVIVAAIAGAIYFATIGRSQFYDLLDFFNEIIQAIASGYLKK* |
Ga0070707_1017435612 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTLTRIVIVAAVAGAIYFLTIGREQLYDLLDFFYEIIDAIAKGYLKK* |
Ga0070699_1000079624 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTVTRIVIVAAIAGAIYFATIGRSQFYDLLDFFNDIIQAIASGYLKK* |
Ga0070697_1005816115 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTVTRIVIVAAIAGAIYFATIGRSQFYDLLDFFNDIIQAIA |
Ga0070672_1019262461 | 3300005543 | Miscanthus Rhizosphere | IKQLNYWRIVRMKSVTRIVLVALIVAVIYFATIGREQFYDLLDFFSEFISAIAGGYLKK* |
Ga0070695_1008814703 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | DNHEAVRRNRLMKTITRIVVVAAIAAAIYFATIGRAQFYDLLDFFYDMIQAVAAGYLKK* |
Ga0070693_1008155552 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTITRIVIVALIAGGIYFATIGRDQFYDVLDFFYDFIQAIAGGYLKK* |
Ga0068854_1008927902 | 3300005578 | Corn Rhizosphere | MKTVTRIVMVAVIAGVIYFATIGRDQFYDLLDFFYDFIAAIANGYLKK* |
Ga0068859_1029066082 | 3300005617 | Switchgrass Rhizosphere | MKTVTRIVFVAAIVGVIYFATIGRDQFYDLLDFFYDFIAAIA |
Ga0068870_110983112 | 3300005840 | Miscanthus Rhizosphere | ILAAIAGVIYFATIGRDQFYDLLDFFYEMIAAIAAGYLKK* |
Ga0068863_1004582192 | 3300005841 | Switchgrass Rhizosphere | IIGVIYFATIGRDQFYDLLDFFYEILGAIAGGYLKK* |
Ga0068863_1018793261 | 3300005841 | Switchgrass Rhizosphere | MVTGIVIVAVVIVVIYFATIGRDQFYDLLDFFYEILSAIA |
Ga0068863_1019726842 | 3300005841 | Switchgrass Rhizosphere | VRMKTLTRLVVIALIVGVIYFATIGRDQFYDLLDFFYGMIAAIAAGYLKK* |
Ga0068858_1004412612 | 3300005842 | Switchgrass Rhizosphere | MKTIMRLVFVAAIIGVIYFATIGRDQFYDLLDFLYEILGAIAGGYLKK* |
Ga0068860_1008243682 | 3300005843 | Switchgrass Rhizosphere | MIKQLNYWRIVRMKSVTRIVIVALIAAVIYFATIGREQFYDLLDFFSEFISAIAGGYLKK |
Ga0068860_1009984271 | 3300005843 | Switchgrass Rhizosphere | MKTVTRIVVVALIAGAIYFATIGRDQFYDLLDTFYEFVAAIAGGYLKK* |
Ga0075287_10119441 | 3300005873 | Rice Paddy Soil | MKTVTRIVILAAIAGVIYFATIGRDQFYDLLDFFSELISAIARGYLKK* |
Ga0075289_10650342 | 3300005888 | Rice Paddy Soil | MKTVARIVIVALIAGVIYFATIGRDQFYDLLDLFYDFIAAIAGGYLKK* |
Ga0075432_100303213 | 3300006058 | Populus Rhizosphere | MKTVTRVVVVAAIIAAIYFATIGRAQFYDLLDFFYEMIQAIASGYLKK* |
Ga0079222_100411993 | 3300006755 | Agricultural Soil | MKMVTGIVIVAVVIVVIYFASIGRDQFYDLLDFFYEILSAIAGGYLKK* |
Ga0075433_100146082 | 3300006852 | Populus Rhizosphere | MKTITRIVVVAAIACAIYFATIGRDQLNSLLDFLYELAQLIAQGYLKK* |
Ga0075434_1019887282 | 3300006871 | Populus Rhizosphere | MKTVTRVVVVAAIIAAIYFATVGRAQFYDLLDFFYEMIQAI |
Ga0097620_1031366202 | 3300006931 | Switchgrass Rhizosphere | MKTVTRIVIVALIAGVIYFATIGRDQFYDLLDLFYDFIAAIAGGYLKK* |
Ga0105240_115338942 | 3300009093 | Corn Rhizosphere | MKTVTRVVIVAAIVAAIYFATMGRAQFYDLLDFFYEMIQAIASGYLKK* |
Ga0105240_119313193 | 3300009093 | Corn Rhizosphere | MKTVTRIVMVAAIAGVIYFATIGRDQFYDLLDFFYDFIAAIANGYLKK* |
Ga0105247_100056237 | 3300009101 | Switchgrass Rhizosphere | VAGLRLMKTLTRIVVVALIVGVIYFATIGREQFYGLVDFFYEIINAIAAGYLKK* |
Ga0105247_102035392 | 3300009101 | Switchgrass Rhizosphere | MIKQLNYWRIVRMKSVTRIVIVALIAAVIYFATIGRDQFYDLLDFFSEFISAIAGGYLKK |
Ga0105247_107843552 | 3300009101 | Switchgrass Rhizosphere | MKTVTRIVFVAAIVGVIYFATIGRDQFYDLLDLFYDFVAAIAGGYLKK* |
Ga0114129_127865422 | 3300009147 | Populus Rhizosphere | MKTVTRIVVVAVIVAVIYFSTIGRDQLYDLFDFFYDMINAIAAGY |
Ga0105243_107466782 | 3300009148 | Miscanthus Rhizosphere | MKTVTRIVMVTAIAGVIYFATIGRDQFYDLLDFFYDFIAAIANGYLKK* |
Ga0075423_116372271 | 3300009162 | Populus Rhizosphere | RRTCPMKTLTRIVIVALVAGAIYFLTIGREQFYDLLDFFYDIINAIAKGYLKK* |
Ga0075423_117818772 | 3300009162 | Populus Rhizosphere | MKTVTRVVVVAAIVAAIYFATVGRAQFYDLLDFFYEMIQAIASGYLKK* |
Ga0105241_100300965 | 3300009174 | Corn Rhizosphere | MKTVTRIVIVAAIAAAIYFATIGRSQFYDLLDFFNEIIQAIASGYLKK* |
Ga0105248_116551211 | 3300009177 | Switchgrass Rhizosphere | VALIAAVIYFATIGRDQFYDLLDFFSEFISAIAGGYLKK* |
Ga0105238_118548512 | 3300009551 | Corn Rhizosphere | MKTITRIVTVAAIAGVIYFATIGRNQFYDLLDFFYELIAAIAAGYLKK* |
Ga0105249_116186302 | 3300009553 | Switchgrass Rhizosphere | MKTVTRIVVVALIAGAIYFATIGRDQFYDLLDLFYDFVAAIAGGYLKK* |
Ga0105249_130211082 | 3300009553 | Switchgrass Rhizosphere | MKTVTRIVMVAVIAGVIYFATIGRDQFYDLLNFFYDFIAAIANGYLKK* |
Ga0126307_102579693 | 3300009789 | Serpentine Soil | MKTVTRIVIVAAIAGVIYFATIGRDQFYDLLDFFYEIISAIAGGYLKK* |
Ga0126309_112752801 | 3300010039 | Serpentine Soil | VKTVTRILLVAAIAGVIYFSTIGRDQFYDLLDFFSRLIEAIASGYLKK* |
Ga0126314_106583532 | 3300010042 | Serpentine Soil | VKTVTRIVVLAAIAGAIYFATVGRSQFYDLLDFFYEMIQAIAAGYLKK* |
Ga0126310_100017758 | 3300010044 | Serpentine Soil | MKAVTRIVIVAAIAGVIYFATIGRDQFYDLLDFFYEIISAIAGGYLKK* |
Ga0126310_117782371 | 3300010044 | Serpentine Soil | MKTIMRIVVLAAIAGAIYFSTIGKDQFYALLDFFSEMIQAIAGGYLRK* |
Ga0126311_100076716 | 3300010045 | Serpentine Soil | MKTVTRIVILAAIAGVIYFATIGRNQFYDLLDLFYEFIQAIAGGYLKK* |
Ga0126311_100359994 | 3300010045 | Serpentine Soil | MKAVTRIVIVAAIAGVIYFATIGRDQFYDLLDFFYEIISAIAGVYLKK* |
Ga0126376_100264577 | 3300010359 | Tropical Forest Soil | MILAAIVAAIYFSTIGRDQFYDLLDFFYEMINAIAAGYLKK* |
Ga0126377_124274332 | 3300010362 | Tropical Forest Soil | MKMITRLVIVALIVCVIYFATIGRNQFYDLMDFFSELIDAIAKGYLKK* |
Ga0134128_103210701 | 3300010373 | Terrestrial Soil | RRNRLMKTITRIVVVAAIAAAIYFATIGRAQFYDLLDFFYDMIQAVAAGYLKK* |
Ga0105239_100708274 | 3300010375 | Corn Rhizosphere | MIKQLNYWRIVRMKSVTRIVIVALIVAVIYFATIGREQFYDLLDFFSEFISAIAGGYLKK |
Ga0105239_106010801 | 3300010375 | Corn Rhizosphere | VAGLRLMKTVTRIVVVALIVAAIYFATIGREQFYGLLDFFYEIINAIAAGYLKK* |
Ga0105239_120047852 | 3300010375 | Corn Rhizosphere | PQRYLDSLRTVELVAGSWSMKTIMRLVFVAAIIGVIYFATIGRDQFYDLLDFFYEILGAIAGGYLKK* |
Ga0134124_117510872 | 3300010397 | Terrestrial Soil | MKTLTRLVVIALIAGVIYFATIGRDQFYDLLDLFYDFIAAIAGGYLKK* |
Ga0134124_122735252 | 3300010397 | Terrestrial Soil | VAGLRLMKTLTRIVVVALIVGAIYFATIGREQFYGLVDFFYEIINAIAAGYLKK* |
Ga0134127_100116822 | 3300010399 | Terrestrial Soil | VKTITRIVIVAVLAGVIYFATIGRDQFYDLLDFFYEIVQAVAAGYLKK* |
Ga0134127_107274713 | 3300010399 | Terrestrial Soil | MKTITRIVVVAAIAAAIYFATIGRAQFYDLLDFFSEMIQAVAAGYLKK* |
Ga0134127_129944042 | 3300010399 | Terrestrial Soil | MKTVTRIVIVALIAGVIYFATIGRDQFYDLLDFFYDFIAAIAAGYLKK* |
Ga0134122_110248501 | 3300010400 | Terrestrial Soil | VKLLTRIVIVAAIAGVIYFATIGRDQFYDLLDFFYGFIQAIAGGYLKK* |
Ga0127502_103390381 | 3300011333 | Soil | VKTITRIVLVAAIAGVIYFATIGRDHFYDLLDFFYDIINAIAAGYLKK* |
Ga0126375_106400031 | 3300012948 | Tropical Forest Soil | MKTVTRIVIVAVIVAAIYFSTFGRDQLYDLLDFFYDIINAIAAGYLRK* |
Ga0164299_104402562 | 3300012958 | Soil | MKTVTRIVIVALIAGVIYFATIGRDQFYDLLDLFYDFIAAIAGGYRKK* |
Ga0157378_104553582 | 3300013297 | Miscanthus Rhizosphere | MKTLMRIVVVVLVIGVIYFATIGRDQFYDLLDFFSEFISAIAGGYLKK* |
Ga0157372_119598112 | 3300013307 | Corn Rhizosphere | MKTVTRVVVVAAIVAAIYFATMGRAQFYDLLDFFYEMIQAIASGYLKK* |
Ga0157375_112403083 | 3300013308 | Miscanthus Rhizosphere | VAGLRLMKTLTRIVVVALIVGAIYFATIGREQFYGLLDFFYEIINAIAAGYLKK* |
Ga0157375_120820511 | 3300013308 | Miscanthus Rhizosphere | MIKQLNYWRIVRMKSVTRIVIVALIVAVIYFATIGREQFYDLLDFFSELISAIAGGYLKK |
Ga0157379_109251351 | 3300014968 | Switchgrass Rhizosphere | VELVAGSWSMKTIMRLVFVAAIIGVIYFATIGRDQFYDLLDFFYEILGAIAGGYLKK* |
Ga0132258_100091443 | 3300015371 | Arabidopsis Rhizosphere | MLMKTVTRIVVVALIVCAIYFGTIGRDQFYSLLDFFYEIINAIAAGYLKK* |
Ga0132255_1018550931 | 3300015374 | Arabidopsis Rhizosphere | VGLVAGLGLMKTLTRIVVVALIVGAIYFATIGREQFYGLLDFFYEIINAIAAGYLKK* |
Ga0132255_1044649152 | 3300015374 | Arabidopsis Rhizosphere | TRIVVVALIVCAIYFGTIGRDQFYSLLDFFYEIINAIAAGYLKK* |
Ga0207710_100815632 | 3300025900 | Switchgrass Rhizosphere | MKSVTRIVIVALIAAVIYFATIGRDQFYDLLDFFSEFISAIAGGYLKK |
Ga0207710_103099362 | 3300025900 | Switchgrass Rhizosphere | MKTLTRIVVVALIVGVIYFATIGREQFYGLVDFFYEIINAIAAGYLKK |
Ga0207647_100690342 | 3300025904 | Corn Rhizosphere | GDNHGAVRRNRLMKTITRIVVVAAIAAAIYFATIGRAQFYDLLDFFYDMIQAVAAGYLKK |
Ga0207647_101057382 | 3300025904 | Corn Rhizosphere | MKTIMRLVFVAAIIGVIYFATIGRDQFYDLLDFFYEILGAIVGGYLKK |
Ga0207645_107571673 | 3300025907 | Miscanthus Rhizosphere | MKTVTRIVMVAAIAGVIYFATIGRDQFYDLLDLFYDFIAAIAGGYLKK |
Ga0207695_114596531 | 3300025913 | Corn Rhizosphere | MKTVTRVVIVAAIVAAIYFATMGRAQFYDLLDFFYEMIQAIASGYLKK |
Ga0207671_115307401 | 3300025914 | Corn Rhizosphere | MKTIMRLVFVAAIIGVIYFATIGRDQFYDLLDFFYEILGAIAG |
Ga0207662_105925622 | 3300025918 | Switchgrass Rhizosphere | MKTVTRIVFVAAIVGVIYFATIGRDQFYDLLDFFYDFIAAIAGGYLKK |
Ga0207662_107643192 | 3300025918 | Switchgrass Rhizosphere | MKTVTRIVVVALIVAAIYFATIGREQFYGLLDFFYEIINAIAAGYLKK |
Ga0207646_110714872 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTLTRIVIVAAVAGAIYFLTIGREQLYDLLDFFYEIIDAIAKGYLKK |
Ga0207646_113393501 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTVTRIVIVAAIAGAIYFATIGRSQFYDLLDFFNEIIQAIASGYLKK |
Ga0207694_110236401 | 3300025924 | Corn Rhizosphere | SGDNHEAVRRNRLMKTITRIVVVAAIAAAIYFATIGRAQFYDLLDFFYDMIQAVAAGYLK |
Ga0207687_104399523 | 3300025927 | Miscanthus Rhizosphere | MKTVTRIVILAAIAGVIYFATIGRDQFYDLLDFFYEIIAAIAGGYLKK |
Ga0207711_101564381 | 3300025941 | Switchgrass Rhizosphere | LFISQMIKQLNYWRIVRMKSVTRIVIVALIAAVIYFATIGRDQFYDLLDFFSEFISAIAGGYLKK |
Ga0207711_102652561 | 3300025941 | Switchgrass Rhizosphere | MKSVTRIVIVALIAAVIYFATIGREQFYDLLDFFSE |
Ga0207711_108696653 | 3300025941 | Switchgrass Rhizosphere | VAGLRLMKTLTRIVVVALIVGVIYFATIGREQFYGLVDFFYEIINAIAAGYLKK |
Ga0207667_106139663 | 3300025949 | Corn Rhizosphere | MKMVTGIVIVAVVIVVIYFATIGRDQFYDLLDFFYEILSAIAGGYLKK |
Ga0207651_103491702 | 3300025960 | Switchgrass Rhizosphere | MKSVTRIVIVALIVAVIYFATIGREQFYDLLDFFSEFISAIAGGYLKK |
Ga0207640_101710652 | 3300025981 | Corn Rhizosphere | MKTVTRIVMVAVIAGVIYFATIGRDQFYDLLDFFYDFIAAIANGYLKK |
Ga0207703_101791302 | 3300026035 | Switchgrass Rhizosphere | MKTIMRLVFVAAIIGVIYFATIGRDQFYDLLDFFYEILGAIAGGYLKK |
Ga0207703_110979602 | 3300026035 | Switchgrass Rhizosphere | TVTRIVVVALIVAAIYFATIGREQFYGLLDFFYEIINAIAAGYLKK |
Ga0207703_117238172 | 3300026035 | Switchgrass Rhizosphere | VVALIVGAIYFATIGREQFYGLVDFFYEIINAIAAGYLKK |
Ga0207639_109013132 | 3300026041 | Corn Rhizosphere | TITRIVVVAAIAAAIYFATIGRAQFYDLLDFFSEMIQAVAAGYLKK |
Ga0207639_115181231 | 3300026041 | Corn Rhizosphere | IVVVALIVAAIYFATIGREQFYGLLDFFYEIINAIAAGYLKK |
Ga0207641_113576821 | 3300026088 | Switchgrass Rhizosphere | MKTVTRIVFEAAIVGVIYFATIGRDQFYDLLDFFYGMIAAIAAGYLKK |
Ga0207648_100547744 | 3300026089 | Miscanthus Rhizosphere | MKTVTRIVFVAAIAGVIYFATIGRDQFYDLLDFFYEIIQAIAGGYLKK |
Ga0207676_114717112 | 3300026095 | Switchgrass Rhizosphere | IVGAIYFATIGREQFYGLVDFFYEIINAIAAGYLKK |
Ga0209073_101169341 | 3300027765 | Agricultural Soil | IVVIYFATIGRDQFYDLLDFFYEILSAIAGGYLKK |
Ga0209177_103065261 | 3300027775 | Agricultural Soil | MKTVTRIVVLALIAGVIYFATIGRDQFYDLVDFFYDFIAAIAAGYLKK |
Ga0268265_102630032 | 3300028380 | Switchgrass Rhizosphere | MKTLTRIVVVALIVGAIYFATIGREQFYGLLDFFYEIINAIAAGYLKK |
Ga0268264_100352413 | 3300028381 | Switchgrass Rhizosphere | MKTITRIVVVAAIAAAIYFATIGRAQFYDLLDFFYDMIQAVAAGYLKK |
Ga0268241_100163601 | 3300030511 | Soil | GIVIVAAIILVIYFATIGRDQFYDLLDFFYEIISAIAGGYLKK |
Ga0310813_121734692 | 3300031716 | Soil | TPLRFRKQLNWWQYRAVKTVTRIVIVAAIACVIYFATIGRNQFYDLLDLFYDFIQAIAGGYLKK |
Ga0308174_109453342 | 3300031939 | Soil | MKTITRIVVVALIAGVIYFATIGRDQFYDLLDFFYDFIQAIAGGYLKK |
Ga0310810_108845553 | 3300033412 | Soil | LRFRKQLNWWQYRAVKTVTRIVIVAAIACVIYFATIGRNQFYDLLDLFYDFIQAIAGGYLKK |
⦗Top⦘ |