NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F057255

Metagenome / Metatranscriptome Family F057255

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F057255
Family Type Metagenome / Metatranscriptome
Number of Sequences 136
Average Sequence Length 39 residues
Representative Sequence MSQIGEPLRIIEVEPLEEPVPEKEVPFEQPADPVKEPA
Number of Associated Samples 113
Number of Associated Scaffolds 136

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 77.94 %
% of genes near scaffold ends (potentially truncated) 21.32 %
% of genes from short scaffolds (< 2000 bps) 91.91 %
Associated GOLD sequencing projects 106
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (69.118 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil
(13.235 % of family members)
Environment Ontology (ENVO) Unclassified
(27.206 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(47.059 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 0.00%    Coil/Unstructured: 100.00%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 136 Family Scaffolds
PF08811DUF1800 2.94
PF00589Phage_integrase 1.47
PF13414TPR_11 1.47
PF11954DUF3471 0.74
PF13453zf-TFIIB 0.74
PF13577SnoaL_4 0.74
PF02641DUF190 0.74
PF12697Abhydrolase_6 0.74
PF13505OMP_b-brl 0.74
PF01872RibD_C 0.74
PF13683rve_3 0.74
PF07676PD40 0.74
PF00654Voltage_CLC 0.74
PF04986Y2_Tnp 0.74
PF00486Trans_reg_C 0.74
PF07609DUF1572 0.74
PF00127Copper-bind 0.74
PF00034Cytochrom_C 0.74
PF13432TPR_16 0.74

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 136 Family Scaffolds
COG5267Uncharacterized conserved protein, DUF1800 familyFunction unknown [S] 2.94
COG0038H+/Cl- antiporter ClcAInorganic ion transport and metabolism [P] 0.74
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 0.74
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 0.74
COG1993PII-like signaling proteinSignal transduction mechanisms [T] 0.74


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms69.85 %
UnclassifiedrootN/A30.15 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459010|GIO7OMY02JWIBDNot Available501Open in IMG/M
3300004025|Ga0055433_10086029All Organisms → cellular organisms → Bacteria695Open in IMG/M
3300004633|Ga0066395_10776478Not Available573Open in IMG/M
3300005332|Ga0066388_100251211All Organisms → cellular organisms → Bacteria2407Open in IMG/M
3300005332|Ga0066388_100394744All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2029Open in IMG/M
3300005332|Ga0066388_108610361All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300005334|Ga0068869_100717978All Organisms → cellular organisms → Bacteria854Open in IMG/M
3300005367|Ga0070667_100720330All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium924Open in IMG/M
3300005434|Ga0070709_10956260All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium680Open in IMG/M
3300005507|Ga0074259_10892405All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300005537|Ga0070730_10701985Not Available641Open in IMG/M
3300005617|Ga0068859_101711714Not Available694Open in IMG/M
3300005713|Ga0066905_101238294Not Available669Open in IMG/M
3300005764|Ga0066903_100466790All Organisms → cellular organisms → Bacteria → Proteobacteria2119Open in IMG/M
3300005764|Ga0066903_101721460All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1194Open in IMG/M
3300005764|Ga0066903_102029359All Organisms → cellular organisms → Bacteria1105Open in IMG/M
3300005764|Ga0066903_102798267All Organisms → cellular organisms → Bacteria → Proteobacteria946Open in IMG/M
3300005764|Ga0066903_103143255All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium893Open in IMG/M
3300005764|Ga0066903_103667138Not Available826Open in IMG/M
3300005764|Ga0066903_105723318All Organisms → cellular organisms → Bacteria → Acidobacteria653Open in IMG/M
3300005764|Ga0066903_106173175Not Available626Open in IMG/M
3300005764|Ga0066903_106303193Not Available619Open in IMG/M
3300005764|Ga0066903_108446976Not Available525Open in IMG/M
3300005829|Ga0074479_10269394Not Available830Open in IMG/M
3300006047|Ga0075024_100362122Not Available728Open in IMG/M
3300006059|Ga0075017_101662205All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300006086|Ga0075019_10576382Not Available704Open in IMG/M
3300006791|Ga0066653_10045491All Organisms → cellular organisms → Bacteria → Acidobacteria1804Open in IMG/M
3300006797|Ga0066659_10616822All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium881Open in IMG/M
3300006844|Ga0075428_100527803All Organisms → cellular organisms → Bacteria → Acidobacteria1262Open in IMG/M
3300006845|Ga0075421_100030268All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae6845Open in IMG/M
3300006854|Ga0075425_100935142Not Available990Open in IMG/M
3300006854|Ga0075425_102263941Not Available604Open in IMG/M
3300006969|Ga0075419_10215680All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1274Open in IMG/M
3300009092|Ga0105250_10319092All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300009094|Ga0111539_10096984All Organisms → cellular organisms → Bacteria → Acidobacteria3463Open in IMG/M
3300009094|Ga0111539_10866847All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1050Open in IMG/M
3300009098|Ga0105245_11543133All Organisms → cellular organisms → Bacteria715Open in IMG/M
3300009100|Ga0075418_10106772All Organisms → cellular organisms → Bacteria2973Open in IMG/M
3300009147|Ga0114129_12566966Not Available608Open in IMG/M
3300010043|Ga0126380_10738253All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium797Open in IMG/M
3300010048|Ga0126373_10021804All Organisms → cellular organisms → Bacteria5427Open in IMG/M
3300010329|Ga0134111_10331352Not Available640Open in IMG/M
3300010360|Ga0126372_10202044All Organisms → cellular organisms → Bacteria1656Open in IMG/M
3300010360|Ga0126372_12446615Not Available573Open in IMG/M
3300010366|Ga0126379_11217695Not Available859Open in IMG/M
3300010366|Ga0126379_12886573Not Available575Open in IMG/M
3300010366|Ga0126379_13545978All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300010376|Ga0126381_101366558Not Available1024Open in IMG/M
3300010379|Ga0136449_101223710Not Available1180Open in IMG/M
3300010398|Ga0126383_10701641All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1090Open in IMG/M
3300010398|Ga0126383_11642274Not Available732Open in IMG/M
3300010937|Ga0137776_1849832All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1576Open in IMG/M
3300011120|Ga0150983_10387828Not Available587Open in IMG/M
3300012189|Ga0137388_12017279All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium505Open in IMG/M
3300012203|Ga0137399_10181641All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1699Open in IMG/M
3300012211|Ga0137377_10545654All Organisms → cellular organisms → Bacteria1097Open in IMG/M
3300012469|Ga0150984_103022433All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1116Open in IMG/M
3300012469|Ga0150984_108154214All Organisms → cellular organisms → Bacteria868Open in IMG/M
3300012498|Ga0157345_1018873All Organisms → cellular organisms → Bacteria684Open in IMG/M
3300012505|Ga0157339_1006894All Organisms → cellular organisms → Bacteria940Open in IMG/M
3300012506|Ga0157324_1013366Not Available741Open in IMG/M
3300012511|Ga0157332_1036145Not Available653Open in IMG/M
3300012515|Ga0157338_1010014All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium949Open in IMG/M
3300012683|Ga0137398_11132716All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300012905|Ga0157296_10086264Not Available827Open in IMG/M
3300012917|Ga0137395_10265433All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1209Open in IMG/M
3300012944|Ga0137410_10868328All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium761Open in IMG/M
3300012951|Ga0164300_10160760All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1063Open in IMG/M
3300012971|Ga0126369_10996387Not Available925Open in IMG/M
3300012971|Ga0126369_12392535Not Available614Open in IMG/M
3300012986|Ga0164304_10589868All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium827Open in IMG/M
3300013296|Ga0157374_11012969Not Available850Open in IMG/M
3300015251|Ga0180070_1025828All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium725Open in IMG/M
3300015356|Ga0134073_10199762All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300015359|Ga0134085_10137202All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1033Open in IMG/M
3300015371|Ga0132258_10301411All Organisms → cellular organisms → Bacteria3941Open in IMG/M
3300015371|Ga0132258_13519834All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1072Open in IMG/M
3300015372|Ga0132256_101108469All Organisms → cellular organisms → Bacteria906Open in IMG/M
3300015373|Ga0132257_100742861All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1222Open in IMG/M
3300015374|Ga0132255_104073852All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2620Open in IMG/M
3300015374|Ga0132255_106068404Not Available511Open in IMG/M
3300016294|Ga0182041_10500264All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1054Open in IMG/M
3300016341|Ga0182035_10645074All Organisms → cellular organisms → Bacteria918Open in IMG/M
3300016371|Ga0182034_10409522All Organisms → cellular organisms → Bacteria1114Open in IMG/M
3300016387|Ga0182040_10795186All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium779Open in IMG/M
3300017792|Ga0163161_10714436Not Available835Open in IMG/M
3300017823|Ga0187818_10083488All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1379Open in IMG/M
3300017928|Ga0187806_1045227All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1330Open in IMG/M
3300017961|Ga0187778_10190816Not Available1303Open in IMG/M
3300017961|Ga0187778_10249081All Organisms → cellular organisms → Bacteria1140Open in IMG/M
3300017966|Ga0187776_10184054All Organisms → cellular organisms → Bacteria1305Open in IMG/M
3300017972|Ga0187781_10348194All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1054Open in IMG/M
3300017995|Ga0187816_10431941All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300018028|Ga0184608_10431736Not Available569Open in IMG/M
3300018053|Ga0184626_10354394Not Available597Open in IMG/M
3300018060|Ga0187765_10240544All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1062Open in IMG/M
3300018469|Ga0190270_10143098All Organisms → cellular organisms → Bacteria1927Open in IMG/M
3300019264|Ga0187796_1332162All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300020580|Ga0210403_10463321All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1032Open in IMG/M
3300022532|Ga0242655_10101588All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium791Open in IMG/M
3300022533|Ga0242662_10055706All Organisms → cellular organisms → Bacteria1033Open in IMG/M
3300024219|Ga0247665_1024019All Organisms → cellular organisms → Bacteria770Open in IMG/M
3300025313|Ga0209431_10511482All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Baekduiaceae → Baekduia → Baekduia soli913Open in IMG/M
3300025915|Ga0207693_11286576Not Available548Open in IMG/M
3300025921|Ga0207652_10737435All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium877Open in IMG/M
3300025925|Ga0207650_11281615Not Available624Open in IMG/M
3300025933|Ga0207706_10815193All Organisms → cellular organisms → Bacteria792Open in IMG/M
3300025942|Ga0207689_10694235All Organisms → cellular organisms → Bacteria858Open in IMG/M
3300025947|Ga0210067_1024898All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium800Open in IMG/M
3300025972|Ga0207668_10870287All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium801Open in IMG/M
3300025986|Ga0207658_10705869All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium912Open in IMG/M
3300026548|Ga0209161_10274728Not Available849Open in IMG/M
3300027018|Ga0208475_1009599All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium etli → Rhizobium etli CNPAF512949Open in IMG/M
3300027041|Ga0209876_1007607All Organisms → cellular organisms → Bacteria766Open in IMG/M
3300027527|Ga0209684_1054191All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium619Open in IMG/M
3300027654|Ga0209799_1024943All Organisms → cellular organisms → Bacteria1317Open in IMG/M
3300027824|Ga0209040_10499659All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300027842|Ga0209580_10286247All Organisms → cellular organisms → Bacteria820Open in IMG/M
3300027873|Ga0209814_10228340All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium806Open in IMG/M
3300027874|Ga0209465_10355566All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium734Open in IMG/M
3300027909|Ga0209382_10038872All Organisms → cellular organisms → Bacteria → Acidobacteria5706Open in IMG/M
3300027909|Ga0209382_10207135All Organisms → cellular organisms → Bacteria2244Open in IMG/M
3300028145|Ga0247663_1055937All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300028803|Ga0307281_10288105All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium611Open in IMG/M
3300031547|Ga0310887_10222612All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1038Open in IMG/M
3300031573|Ga0310915_11090089All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus555Open in IMG/M
3300031716|Ga0310813_11811492Not Available573Open in IMG/M
3300031744|Ga0306918_11365479All Organisms → cellular organisms → Bacteria → Terrabacteria group544Open in IMG/M
3300031753|Ga0307477_10719644Not Available667Open in IMG/M
3300031946|Ga0310910_10460119All Organisms → Viruses → Predicted Viral1010Open in IMG/M
3300032000|Ga0310903_10210635Not Available915Open in IMG/M
3300032261|Ga0306920_100283909All Organisms → cellular organisms → Bacteria2468Open in IMG/M
3300032782|Ga0335082_10395849All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1246Open in IMG/M
3300033004|Ga0335084_10724417All Organisms → cellular organisms → Bacteria1013Open in IMG/M
3300033158|Ga0335077_12088111Not Available524Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil13.24%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil8.82%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere8.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.15%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.15%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.41%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.41%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere4.41%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.68%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere2.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.94%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.21%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.21%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.21%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.21%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.21%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.47%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.47%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.47%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.47%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.47%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.47%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere1.47%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.74%
SedimentEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment0.74%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.74%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.74%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.74%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.74%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.74%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.74%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.74%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.74%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.74%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.74%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.74%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.74%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.74%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.74%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.74%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.74%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.74%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.74%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459010Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!)EnvironmentalOpen in IMG/M
3300004025Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D1EnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005507Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5Host-AssociatedOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005829Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBCEnvironmentalOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010937Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012498Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410Host-AssociatedOpen in IMG/M
3300012505Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610Host-AssociatedOpen in IMG/M
3300012506Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610Host-AssociatedOpen in IMG/M
3300012511Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_10EnvironmentalOpen in IMG/M
3300012515Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610Host-AssociatedOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012905Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2EnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300015251Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT293_16_10DEnvironmentalOpen in IMG/M
3300015356Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018053Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1EnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300019264Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300022532Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022533Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024219Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK06EnvironmentalOpen in IMG/M
3300025313Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025947Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300027018Grasslands soil microbial communities from Kansas, USA, that are Nitrogen fertilized - NN575 (SPAdes)EnvironmentalOpen in IMG/M
3300027041Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_30_40 (SPAdes)EnvironmentalOpen in IMG/M
3300027527Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027654Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027824Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028145Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK04EnvironmentalOpen in IMG/M
3300028803Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120EnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300032000Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
F62_072309902170459010Grass SoilMSQIGEPLRIIEVEPREEPVPEKEVPFEEPADPVEEPA
Ga0055433_1008602923300004025Natural And Restored WetlandsKEYSMSEIGEPLRIIEVEPREEPVPEKEIPFEQPADPVKEPA*
Ga0066395_1077647813300004633Tropical Forest SoilMSQIGEPLRIIEVEPLEEPVPEKELPEKEVPFEQPADPVKEPA*
Ga0066388_10025121123300005332Tropical Forest SoilMSQIGEPLRIIEVEPREEPVPERDVPFEQPADPVAVPVKEPA*
Ga0066388_10039474423300005332Tropical Forest SoilMSQIGEPLRIIEVEPLEEPVPQKEVPFEQPADPIKEPAW*
Ga0066388_10861036113300005332Tropical Forest SoilKEYSMSQIGEPLRIIEVEPLEEPVPEKEVPFEQPADPVKEPA*
Ga0068869_10071797813300005334Miscanthus RhizosphereMSQIGEPLRIIEVEPLQEPVPEKEVPFEQPADPVKQPADPVKEPA*
Ga0070667_10072033023300005367Switchgrass RhizosphereYSMSQIGEPLRIIEVEPLEEPVPEKEVPFEQPAYPVKEPA*
Ga0070709_1095626023300005434Corn, Switchgrass And Miscanthus RhizosphereYSMSQIGEPLRIIEVEPREEPVPEKEVPFEQPADPVKEPA*
Ga0074259_1089240513300005507Arabidopsis RhizosphereMSQIGEPLRIIEVEPLEEPVPEKEVPFEQPADPVKEPA*
Ga0070730_1070198513300005537Surface SoilMSQIGEPLRIIEVEPREEPVPEKEVPFEQPADPVEEPA*
Ga0068859_10171171423300005617Switchgrass RhizosphereMSQIGEPLRIIEVEPLEEPVPEKEVPFEQPVDPVKEPA*
Ga0066905_10123829423300005713Tropical Forest SoilMSQIGEPLRIIEVEPLEEPVPEKEVPFVQPADPVKEPA*
Ga0066903_10046679043300005764Tropical Forest SoilMSQIGEPLRIIEVEPLEEPVPEKEVPFEQPADPVREPA*
Ga0066903_10172146033300005764Tropical Forest SoilMSQIGEPLRIIEVEPLEEPVPQREVPFEEPADPVKEPA*
Ga0066903_10202935923300005764Tropical Forest SoilMSQIGEPVRIIEVEPLEEPVPEKEVPFEQPADPVKEPA*
Ga0066903_10279826713300005764Tropical Forest SoilMSQIGEPLRIIEVEPLEEPVPQKEVPFEQPADPVKEPA*
Ga0066903_10314325523300005764Tropical Forest SoilMSQIGEPLRIIEVEPLEEPVPEKEVPFEQPAHPVKEPA*
Ga0066903_10366713823300005764Tropical Forest SoilMEYSMSQIGEPLRIIEVQPLEEPVPEKEVPFEQPADPVKEPA*
Ga0066903_10572331823300005764Tropical Forest SoilMSQIGEPLRIIEVEPLEEPVPEKEVPFEQPPNPIKEPDDPVKEPA*
Ga0066903_10617317523300005764Tropical Forest SoilMSEIGEPLRIIEVEPREEPVPEKEVPFEQPADPVKEPAE*
Ga0066903_10630319313300005764Tropical Forest SoilMSQMGEPLRIIEVEPLKEPVPEKEVPFEQPADPVKEPA*
Ga0066903_10844697623300005764Tropical Forest SoilMSQIGEPLRIIEVEPLDEPVPEKEVPFELPADPVKEPA*
Ga0074479_1026939423300005829Sediment (Intertidal)MSQIGEPLRIIEVEPQEEPVPEKEVPFEQPADPVKEPA*
Ga0075024_10036212223300006047WatershedsMSQIGEPLRIIEVEPREEPVPEREVPFEQPADPIKEPA*
Ga0075017_10166220523300006059WatershedsIGEPLRIIEVEPREEPVPEREVPFEQPADPVKEPA*
Ga0075019_1057638223300006086WatershedsMSQIGEPLRIIEVEPREEPVPEREVPFEQPADPVKEPA*
Ga0066653_1004549123300006791SoilMSQIGEPLRIIKVEPLEEPVPEKEVPFEQPADPVKEPA*
Ga0066659_1061682223300006797SoilQIGEPLRIIEVEPLEEPVPEKEVPFEQPADPVKETA*
Ga0075428_10052780313300006844Populus RhizosphereMSQIGEPLRIIEVEPLEEPVPEKEVPFEQPADPVKE
Ga0075421_10003026853300006845Populus RhizosphereMSQIGEPLRIIEVKPLEEPVPEKEVPFEQPADPVKEPA*
Ga0075425_10093514243300006854Populus RhizosphereVSQIGEPLRIIEVEPLEEPVPEKEVPFEQPADPVKE
Ga0075425_10226394113300006854Populus RhizosphereMSQIGEPLRIIEVEPLEEPVPEKEVPFEQPADPVKEP
Ga0075419_1021568033300006969Populus RhizosphereMSQIGEPLRIIEVEPLEEPVPEKEIPFEQPADPVKEPA*
Ga0105250_1031909223300009092Switchgrass RhizosphereMSQIGEPLRIIEVEPREEPVPEKEVPFEQPADPVKEPA*
Ga0111539_1009698443300009094Populus RhizosphereMSQIGEPLRIIEVEPLEEPVPEKEVPFEQPADPIKQPADPVKEPA*
Ga0111539_1086684723300009094Populus RhizosphereMSEIGEPLRIIEVEPLEEPVPEKEVPLEQPVDPVKEPA*
Ga0105245_1154313323300009098Miscanthus RhizosphereMSQIGEPLRIIEVEPRQEPVPEKEVPFEQPADPVEEPA*
Ga0075418_1010677233300009100Populus RhizosphereMSQIGEPLRIIEVEPLEEPIPEKEVPFEQPADPVKEPA*
Ga0114129_1256696613300009147Populus RhizosphereMSQIGEPLRIIEVEPLEEPVPEKEVPFEQPADPVK
Ga0126380_1073825323300010043Tropical Forest SoilMSQIGEPLRIIEVEPLEEPVPQKEVPFEQPTDPVKEPA*
Ga0126373_1002180423300010048Tropical Forest SoilMANIGEPLRIIEVEPREEPVPEKEVPFEQPADPVKEPA*
Ga0134111_1033135223300010329Grasslands SoilMSQIGEPLRIIEVEPLEEPVPEKEVPFEEPAEPVKEPA*
Ga0126372_1020204423300010360Tropical Forest SoilMSQIGEPLRIIEVEPLEEPVPERELPFEQPADPVKEPA*
Ga0126372_1244661523300010360Tropical Forest SoilMEYSMAQIGEPVRIIEVKPLEEPVPEKEVPFEQPADPVKEPA*
Ga0126379_1121769513300010366Tropical Forest SoilMSQIGEPLRIIEVEPIEEPVPEKEVPFEQPADPVKEPA*
Ga0126379_1288657323300010366Tropical Forest SoilMSQIGEPLRIIEVEPLEEPVPEKEVPFEQPGDPVKEPA*
Ga0126379_1354597823300010366Tropical Forest SoilGEPLRIIEVEPLEEPVPEKEVPFEQPADPVKEPA*
Ga0126381_10136655833300010376Tropical Forest SoilMSQLGEPLRVIEVEPLEEPVPEKEVPFEQPADPVK
Ga0136449_10122371013300010379Peatlands SoilMSQIGEPLRIIEVEPREEPVPEKELPFEQPADPVKEPAE*
Ga0126383_1070164123300010398Tropical Forest SoilMSQIGEPLRIIEIEPLEEPVPEKEVPFEQPAYPVK
Ga0126383_1164227423300010398Tropical Forest SoilMSQIGEPLKIIEVEPLEEPVPEKEVPFEQPADPVKEPA*
Ga0137776_184983233300010937SedimentMSQIGEPLRIIEVEPLEEPVPEKEPFEQPADPVKEPA*
Ga0150983_1038782813300011120Forest SoilMSQIGEPLRIIAVEPLEEPVPQKEVPFEQPADPVKEPA*
Ga0137388_1201727923300012189Vadose Zone SoilMSQIGEPLRVIEVEPLEEPVPEKEVPFEQPVDPVREPA*
Ga0137399_1018164123300012203Vadose Zone SoilMSQIGEPLTIIEVEPLEEPVPEKEVPFEQPADPVKEPA*
Ga0137377_1054565413300012211Vadose Zone SoilMSQIGEPQRIIEVEPLEEPVPEKEVPFEQPADPVKEPA*
Ga0150984_10302243323300012469Avena Fatua RhizosphereMSQIGEPLRIIEVEPLEEPVPQKEVPFEQPAHPVKEPA*
Ga0150984_10815421423300012469Avena Fatua RhizosphereMEYSMAQIGEPLRIIEVKPLEEPVPEKEVPFEQPVDPVKEPA*
Ga0157345_101887313300012498Arabidopsis RhizosphereMSQIGEPLRIIEVEPLEEPVPEREVPVPEKEVPFEQPADPVKEPA*
Ga0157339_100689423300012505Arabidopsis RhizosphereMSQMGEPVRIIEVEPLEEPVPEKEVPFEQPADPVKEPA*
Ga0157324_101336613300012506Arabidopsis RhizosphereMSQIGEPLRIIEVEPLKEPVPEKEVPFEQPADPVKEPA*
Ga0157332_103614523300012511SoilMSQIGEPLRIIEVEPLEEPVPEKEVPFEQPADPAKEPA*
Ga0157338_101001423300012515Arabidopsis RhizosphereMSQIGEPIRIIEVEPLEEPVPEKEVPFEQPADPVKEPA*
Ga0137398_1113271613300012683Vadose Zone SoilKEYSMSQIGEPLRIIEVEPREEPVPEREVPFEQPADPVKEPA*
Ga0157296_1008626423300012905SoilMSQIGEPLRIIEVEPLEEPVPEKEVPFEQPADPVKQPADPVKEPA*
Ga0137395_1026543323300012917Vadose Zone SoilMSQIGEPLRIIEVEPLEEPVPEKEVPFEQPAAPVKEPA*
Ga0137410_1086832823300012944Vadose Zone SoilMSQIGEPLRIIEVEPLGEPVPEKEVPFEQPADPVKEPA*
Ga0164300_1016076033300012951SoilMSQIGEPLRIIEIEPLEEPVPGKEVPFEQPADPVKEPA*
Ga0126369_1099638723300012971Tropical Forest SoilMANIGEPLRIIEVEPREEPVPEKEVPFEQPADPVEEPA*
Ga0126369_1239253513300012971Tropical Forest SoilMAQIGNPLKIIEVEPLEEPVPEKEVPFDQPADPFKEPV*
Ga0164304_1058986823300012986SoilIGEPLRIIEVEPLEEPVPEKEVPFEQPVDPVKEPA*
Ga0157374_1101296923300013296Miscanthus RhizosphereMSQIGGPVRIIEVEPLEEPVPEKEVPFEQPADPVKEPA*
Ga0180070_102582813300015251SoilQIGEPLRIIEVEPLEEPVPEKEVPFEQPADPVKEPA*
Ga0134073_1019976213300015356Grasslands SoilSQIGEPLRIIEVEPLQEPVPEKEVPFEQPADPVKEPA*
Ga0134085_1013720223300015359Grasslands SoilMSQIGEPLRIIEVEPLEEPVPEKEVPFEQPAYPVKEPA*
Ga0132258_1030141123300015371Arabidopsis RhizosphereMSQIGEPLRIIEVEPLEEPVPEKEVPFEQPADPIKEPA*
Ga0132258_1351983423300015371Arabidopsis RhizosphereMSQMGEPVRIIEVEPLEEPVPEKEVPFEQPADPAKEPA*
Ga0132256_10110846913300015372Arabidopsis RhizosphereMSQIGEPLRIIEVEPLEEPVPEKEVPFEQPDDPVKEPA*
Ga0132257_10074286133300015373Arabidopsis RhizosphereMSQIGEPVRIIEVEPLEEPVPQKEAPFEQPADPVKEPA*
Ga0132255_10407385223300015374Arabidopsis RhizosphereMSQIGEPLRIIEVEPLEEPVPEKEVPFEQPADPVKEPV*
Ga0132255_10606840423300015374Arabidopsis RhizosphereMSQIGEPLRTIEVEPLKDPVPEKEVPFEQPADPVREPA*
Ga0182041_1050026433300016294SoilMSQIGEPLRVIEVEPLEEPVPEKEVPFEQPAAPVKEPA
Ga0182035_1064507413300016341SoilMSEIGEPLRIIEVEPREEPVPEKEVPFEQPADPVKEPAE
Ga0182034_1040952233300016371SoilMSQIGEPLRIIEVEPIEEPVPEKEVPFEQPADPVKEPA
Ga0182040_1079518623300016387SoilMSQIGEPLRVIEVEPLEEPVPEKEVPFEQPADPVKEPA
Ga0163161_1071443623300017792Switchgrass RhizosphereMSQIGEPLRIIEVEPLEEPVPEKEVPFEQPADPVKEPA
Ga0187818_1008348813300017823Freshwater SedimentMSQIGEPLRIIEVEPREEPVPEREVPFEQPADPVKEPA
Ga0187806_104522713300017928Freshwater SedimentEYSMSQIGEPLRIIEVEPREEPVPEREVPFEQPADPVKEPA
Ga0187778_1019081613300017961Tropical PeatlandMSQIGEPIRIIEVEPREEPVPEKEVPFEQPADPVT
Ga0187778_1024908123300017961Tropical PeatlandMANIGEPLRIIEVEPREEPVPEKEVPFEQPADPVKEPE
Ga0187776_1018405413300017966Tropical PeatlandMSQIGEPLRVIEVEPLEEPVPAKEVPFEQPADPVKEPA
Ga0187781_1034819423300017972Tropical PeatlandMSQIGEPLRIIEVEPREEPVPEREAPFEQPADPVKEPA
Ga0187816_1043194113300017995Freshwater SedimentMSQIGEPLRIIEVEPFEEPVPEREVPFEQPADPVKEPA
Ga0184608_1043173623300018028Groundwater SedimentMSEIGEPLRIIEVEPLEEPVPEKEVPLEQPADPVKE
Ga0184626_1035439413300018053Groundwater SedimentMSEIGEPLRIIEVEPLEEPVPEKEVPFEQPADPVKEPA
Ga0187765_1024054433300018060Tropical PeatlandMSQIGEPVKIIEVEPREEPVPEKEIPFEEPADPVKEPA
Ga0190270_1014309843300018469SoilMSQIGEPIRIIEVEPLEEPVPEKEVPFEQPADPVKEPA
Ga0187796_133216213300019264PeatlandMSQIGEPLRIIEVEPREEPVPERDVPFEQPADPVAVPVKEPA
Ga0210403_1046332133300020580SoilMSQIGEPLRIIEVEPREEPVPEKEVPFEQPADPVKEPAY
Ga0242655_1010158823300022532SoilMSQIGEPLRIIEVEPREEPVPEKEVPFELPADPVEEPA
Ga0242662_1005570613300022533SoilMSQIGEPLRIIEVEPREEPVPEREVPFEQPSDPVKEPA
Ga0247665_102401913300024219SoilKEYSMSQIGEPLRIIEVEPLEEPVPEKEVPFEQPADPVKEPA
Ga0209431_1051148223300025313SoilMEIGEPEREIEVWPLEEPVPEEMPVEAPEPVRIPA
Ga0207693_1128657623300025915Corn, Switchgrass And Miscanthus RhizosphereMSQIGEPLRVIEVEPLEEPVPQKEVPFEQPADPVKEPA
Ga0207652_1073743523300025921Corn RhizosphereMAQIGEPLRIIEVEPLEEPVPEKEVPFEQPADPVKEPA
Ga0207650_1128161523300025925Switchgrass RhizosphereMSQIGEPVRIIEVEPLEEPVPEKEVPFEQPADPVKEPA
Ga0207706_1081519323300025933Corn RhizosphereMSQIGEPLIIIEVEPLEEPVPEKEVPFEQPADPVKEPA
Ga0207689_1069423513300025942Miscanthus RhizosphereMSQIGEPLRIIEVEPLQEPVPEKEVPFEQPADPVKQPADPVKEPA
Ga0210067_102489813300025947Natural And Restored WetlandsMSQIGEPLRIIEVEPLEKPVPEKEVPFEQPADPVKEPA
Ga0207668_1087028723300025972Switchgrass RhizosphereMSQIGEPLRIIEVEPLEEPVPEKQVPFEQPADPVKEPA
Ga0207658_1070586913300025986Switchgrass RhizosphereSSDLLRIIEVEPLEEPVPEKEVPFEQPAYPVKEPA
Ga0209161_1027472823300026548SoilMSQIGEPLRIIVVEPLEEPVPEKEVPFEQPADPVKEPA
Ga0208475_100959913300027018SoilSMSQIGEPLRIIEVEPLEEPVPEKEVPFEQPADPVKEPA
Ga0209876_100760723300027041Groundwater SandMSQIGEPLRIIEVEPLEEPVPEKEVPFEQPADPVKQPANPVKEPA
Ga0209684_105419113300027527Tropical Forest SoilGHARIIMKYSMSQIGEPLRIIEVEPLEEPVPEKEVPFEQPADPVKEPA
Ga0209799_102494323300027654Tropical Forest SoilMSQIGEPLRIIEVEPLEEPVPEKELPFEQPADPVKEPA
Ga0209040_1049965923300027824Bog Forest SoilIGEPLRIIEVEPREEPVPEREVPFEQPADPVKEPA
Ga0209580_1028624733300027842Surface SoilSQIGEPLRIIEVEPREEPVPEKEVPFEQPADPVEEPA
Ga0209814_1022834023300027873Populus RhizosphereMSQIGEPLRIIEVEPLEEPIPEKEVPFEQPADPVKEPA
Ga0209465_1035556623300027874Tropical Forest SoilMSQIGEPLRIIEVEPLEEPVPEKEVPFVQPADPVKEPA
Ga0209382_1003887233300027909Populus RhizosphereMSQIGEPLRIIEVKPLEEPVPEKEVPFEQPADPVKEPA
Ga0209382_1020713513300027909Populus RhizosphereMSQIGDPLRIIEVEPLEEPVPEKEVPFEQPADPVKEPA
Ga0247663_105593723300028145SoilMSQIGEPLRIIEVEPLKEPVPEKEVPFEQPADPVKEPA
Ga0307281_1028810523300028803SoilMSQIGEPLRIIEVEPLEEPVPEKEVPFEQPADPVQEPA
Ga0310887_1022261223300031547SoilMSEIGEPLRIIEVEPLEEPVPEKEVPLEQPVDPVKEPA
Ga0310915_1109008923300031573SoilMSQIGEPLRIIEVEPLEEPVPEKEVPFEQPADPIKEPA
Ga0310813_1181149223300031716SoilMSQIGEPLRIIEVQPLEEPVPEKEVPFEQPADPVKEPA
Ga0306918_1136547913300031744SoilRFCRKECGMSQIGEPLRIIEVEPLEEPVPQKEVPFEQPADPVKEPA
Ga0307477_1071964423300031753Hardwood Forest SoilMSQIGEPLRIIEVEPLREPVPEKEVPFEQPADPVKEPA
Ga0310910_1046011923300031946SoilECSMSQIGEPLRIIEVEPLEEPVPEKEVPFEQPADPVKEPA
Ga0310903_1021063513300032000SoilMSEIGEPLRIIEVEPLEEPVPEKEVPLEQPVDPVK
Ga0306920_10028390923300032261SoilMSQIGEPLRIIEVEPLEEPVPEKEVPFEQPADPVKDPA
Ga0335082_1039584923300032782SoilMSQIGEPIRIIEVEPREEPVPEKEVPFEQPADPVKEPA
Ga0335084_1072441733300033004SoilMSQIGEPLRIIEVEPLEEPVPEKEVPFEQPAYPVKEPA
Ga0335077_1208811123300033158SoilMSQIGEPLRIIEVKPREEPVPERDVPFEQPADPVAVPVKEPAQ


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.