| Basic Information | |
|---|---|
| Family ID | F057176 |
| Family Type | Metagenome |
| Number of Sequences | 136 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MNDEQGQAIRNELKRFAGDLNLSDEQKTKLHERLAFAAGRLH |
| Number of Associated Samples | 79 |
| Number of Associated Scaffolds | 136 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 90.44 % |
| % of genes near scaffold ends (potentially truncated) | 99.26 % |
| % of genes from short scaffolds (< 2000 bps) | 91.91 % |
| Associated GOLD sequencing projects | 68 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (77.206 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (40.441 % of family members) |
| Environment Ontology (ENVO) | Unclassified (52.941 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (70.588 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 136 Family Scaffolds |
|---|---|---|
| PF04226 | Transgly_assoc | 2.94 |
| PF01594 | AI-2E_transport | 2.21 |
| PF04367 | DUF502 | 1.47 |
| PF04264 | YceI | 1.47 |
| PF14023 | DUF4239 | 1.47 |
| PF14534 | DUF4440 | 1.47 |
| PF00691 | OmpA | 1.47 |
| PF07366 | SnoaL | 0.74 |
| PF10518 | TAT_signal | 0.74 |
| PF07478 | Dala_Dala_lig_C | 0.74 |
| PF02796 | HTH_7 | 0.74 |
| PF02656 | DUF202 | 0.74 |
| PF06415 | iPGM_N | 0.74 |
| PF02563 | Poly_export | 0.74 |
| PF03992 | ABM | 0.74 |
| PF03544 | TonB_C | 0.74 |
| PF00011 | HSP20 | 0.74 |
| PF03279 | Lip_A_acyltrans | 0.74 |
| PF07992 | Pyr_redox_2 | 0.74 |
| PF13474 | SnoaL_3 | 0.74 |
| PF05239 | PRC | 0.74 |
| PF00072 | Response_reg | 0.74 |
| COG ID | Name | Functional Category | % Frequency in 136 Family Scaffolds |
|---|---|---|---|
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 2.94 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 2.21 |
| COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 1.47 |
| COG2928 | Uncharacterized membrane protein | Function unknown [S] | 1.47 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.74 |
| COG0696 | Phosphoglycerate mutase (BPG-independent), AlkP superfamily | Carbohydrate transport and metabolism [G] | 0.74 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.74 |
| COG1560 | Palmitoleoyl-ACP: Kdo2-lipid-IV acyltransferase (lipid A biosynthesis) | Lipid transport and metabolism [I] | 0.74 |
| COG1596 | Periplasmic protein Wza involved in polysaccharide export, contains SLBB domain of the beta-grasp fold | Cell wall/membrane/envelope biogenesis [M] | 0.74 |
| COG2149 | Uncharacterized membrane protein YidH, DUF202 family | Function unknown [S] | 0.74 |
| COG4261 | Predicted acyltransferase, LPLAT superfamily | General function prediction only [R] | 0.74 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 77.21 % |
| Unclassified | root | N/A | 22.79 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459009|GA8DASG01CMPQB | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 520 | Open in IMG/M |
| 2170459011|GKWS7RC01EZH3G | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 515 | Open in IMG/M |
| 2189573000|GPBTN7E01CC5QF | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 534 | Open in IMG/M |
| 3300000579|AP72_2010_repI_A01DRAFT_1043641 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300000893|AP72_2010_repI_A001DRAFT_1014160 | All Organisms → cellular organisms → Bacteria | 1343 | Open in IMG/M |
| 3300002128|JGI24036J26619_10109772 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300005093|Ga0062594_101473343 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 696 | Open in IMG/M |
| 3300005289|Ga0065704_10682289 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 569 | Open in IMG/M |
| 3300005294|Ga0065705_10849913 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 591 | Open in IMG/M |
| 3300005332|Ga0066388_102070811 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1023 | Open in IMG/M |
| 3300005332|Ga0066388_105048176 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300005364|Ga0070673_101624576 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300005713|Ga0066905_101734177 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 574 | Open in IMG/M |
| 3300005764|Ga0066903_100693023 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1793 | Open in IMG/M |
| 3300005764|Ga0066903_100719035 | All Organisms → cellular organisms → Bacteria | 1765 | Open in IMG/M |
| 3300005764|Ga0066903_101535209 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1259 | Open in IMG/M |
| 3300005764|Ga0066903_105026237 | Not Available | 701 | Open in IMG/M |
| 3300005764|Ga0066903_105587930 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 662 | Open in IMG/M |
| 3300005764|Ga0066903_106964168 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 586 | Open in IMG/M |
| 3300006852|Ga0075433_10517717 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
| 3300006871|Ga0075434_100580125 | All Organisms → cellular organisms → Bacteria | 1141 | Open in IMG/M |
| 3300006871|Ga0075434_101301636 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 738 | Open in IMG/M |
| 3300009012|Ga0066710_100907637 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1356 | Open in IMG/M |
| 3300009147|Ga0114129_10295366 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2161 | Open in IMG/M |
| 3300010043|Ga0126380_10853011 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 751 | Open in IMG/M |
| 3300010046|Ga0126384_11205591 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 698 | Open in IMG/M |
| 3300010329|Ga0134111_10177849 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 853 | Open in IMG/M |
| 3300010358|Ga0126370_12642812 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 503 | Open in IMG/M |
| 3300010361|Ga0126378_12741147 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 563 | Open in IMG/M |
| 3300010366|Ga0126379_10724813 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1089 | Open in IMG/M |
| 3300010366|Ga0126379_12923331 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 572 | Open in IMG/M |
| 3300010375|Ga0105239_12141382 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 650 | Open in IMG/M |
| 3300010376|Ga0126381_100390725 | All Organisms → cellular organisms → Bacteria | 1935 | Open in IMG/M |
| 3300010376|Ga0126381_103567292 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 610 | Open in IMG/M |
| 3300010376|Ga0126381_104404581 | Not Available | 544 | Open in IMG/M |
| 3300010398|Ga0126383_12042606 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 660 | Open in IMG/M |
| 3300010398|Ga0126383_12412961 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niastella → Niastella caeni | 611 | Open in IMG/M |
| 3300010868|Ga0124844_1031159 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1705 | Open in IMG/M |
| 3300012204|Ga0137374_10004067 | All Organisms → cellular organisms → Bacteria | 17393 | Open in IMG/M |
| 3300012948|Ga0126375_10845022 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300012948|Ga0126375_12116381 | Not Available | 500 | Open in IMG/M |
| 3300013307|Ga0157372_11026510 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
| 3300015371|Ga0132258_13866185 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1019 | Open in IMG/M |
| 3300015373|Ga0132257_104596953 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 502 | Open in IMG/M |
| 3300015374|Ga0132255_101562337 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 999 | Open in IMG/M |
| 3300015374|Ga0132255_103537894 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 664 | Open in IMG/M |
| 3300016270|Ga0182036_10545875 | Not Available | 923 | Open in IMG/M |
| 3300016270|Ga0182036_10779437 | Not Available | 778 | Open in IMG/M |
| 3300016270|Ga0182036_11035988 | Not Available | 677 | Open in IMG/M |
| 3300016270|Ga0182036_11232203 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 623 | Open in IMG/M |
| 3300016294|Ga0182041_10352306 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1238 | Open in IMG/M |
| 3300016294|Ga0182041_10964579 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 769 | Open in IMG/M |
| 3300016294|Ga0182041_11098846 | Not Available | 722 | Open in IMG/M |
| 3300016319|Ga0182033_10109236 | All Organisms → cellular organisms → Bacteria | 2053 | Open in IMG/M |
| 3300016319|Ga0182033_10658080 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 914 | Open in IMG/M |
| 3300016319|Ga0182033_10800196 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 831 | Open in IMG/M |
| 3300016319|Ga0182033_11263375 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300016319|Ga0182033_12103280 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 515 | Open in IMG/M |
| 3300016341|Ga0182035_10462627 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae | 1077 | Open in IMG/M |
| 3300016341|Ga0182035_11323063 | Not Available | 645 | Open in IMG/M |
| 3300016341|Ga0182035_11629026 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
| 3300016357|Ga0182032_11130961 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 672 | Open in IMG/M |
| 3300016371|Ga0182034_10220119 | All Organisms → cellular organisms → Bacteria | 1480 | Open in IMG/M |
| 3300016371|Ga0182034_10521078 | Not Available | 994 | Open in IMG/M |
| 3300016371|Ga0182034_10974931 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 731 | Open in IMG/M |
| 3300016371|Ga0182034_11568608 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 578 | Open in IMG/M |
| 3300016387|Ga0182040_11278147 | Not Available | 619 | Open in IMG/M |
| 3300016387|Ga0182040_11295760 | Not Available | 615 | Open in IMG/M |
| 3300016387|Ga0182040_11442943 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 583 | Open in IMG/M |
| 3300016404|Ga0182037_10133479 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1846 | Open in IMG/M |
| 3300016404|Ga0182037_10290650 | Not Available | 1309 | Open in IMG/M |
| 3300016404|Ga0182037_10912376 | Not Available | 762 | Open in IMG/M |
| 3300016404|Ga0182037_11634696 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 573 | Open in IMG/M |
| 3300016422|Ga0182039_10184972 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1648 | Open in IMG/M |
| 3300016422|Ga0182039_11348803 | Not Available | 647 | Open in IMG/M |
| 3300016445|Ga0182038_10543775 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 996 | Open in IMG/M |
| 3300016445|Ga0182038_11836739 | Not Available | 547 | Open in IMG/M |
| 3300017654|Ga0134069_1250389 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 616 | Open in IMG/M |
| 3300017656|Ga0134112_10422686 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 554 | Open in IMG/M |
| 3300017657|Ga0134074_1156605 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300017792|Ga0163161_10623522 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
| 3300018051|Ga0184620_10350413 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 501 | Open in IMG/M |
| 3300019362|Ga0173479_10712930 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 543 | Open in IMG/M |
| 3300025315|Ga0207697_10407644 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 604 | Open in IMG/M |
| 3300025972|Ga0207668_11018169 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 741 | Open in IMG/M |
| 3300025981|Ga0207640_11508733 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 604 | Open in IMG/M |
| 3300026530|Ga0209807_1116746 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
| 3300027019|Ga0207857_1037350 | Not Available | 753 | Open in IMG/M |
| 3300027045|Ga0207726_1040436 | Not Available | 641 | Open in IMG/M |
| 3300027680|Ga0207826_1001220 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria | 7332 | Open in IMG/M |
| 3300027680|Ga0207826_1007129 | All Organisms → cellular organisms → Bacteria | 3027 | Open in IMG/M |
| 3300027703|Ga0207862_1058699 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1159 | Open in IMG/M |
| 3300031057|Ga0170834_102503320 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 2124 | Open in IMG/M |
| 3300031446|Ga0170820_14553282 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
| 3300031446|Ga0170820_16449392 | Not Available | 1810 | Open in IMG/M |
| 3300031682|Ga0318560_10616148 | Not Available | 588 | Open in IMG/M |
| 3300031719|Ga0306917_10055631 | All Organisms → cellular organisms → Bacteria | 2681 | Open in IMG/M |
| 3300031719|Ga0306917_11177576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dyella → Dyella soli | 595 | Open in IMG/M |
| 3300031719|Ga0306917_11475644 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 523 | Open in IMG/M |
| 3300031736|Ga0318501_10593461 | Not Available | 608 | Open in IMG/M |
| 3300031736|Ga0318501_10609064 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 600 | Open in IMG/M |
| 3300031744|Ga0306918_11024088 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 641 | Open in IMG/M |
| 3300031771|Ga0318546_11258128 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 520 | Open in IMG/M |
| 3300031833|Ga0310917_10352458 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 999 | Open in IMG/M |
| 3300031879|Ga0306919_11230498 | Not Available | 568 | Open in IMG/M |
| 3300031880|Ga0318544_10363230 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 563 | Open in IMG/M |
| 3300031890|Ga0306925_10203929 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2133 | Open in IMG/M |
| 3300031890|Ga0306925_10310260 | Not Available | 1696 | Open in IMG/M |
| 3300031890|Ga0306925_10369249 | Not Available | 1540 | Open in IMG/M |
| 3300031890|Ga0306925_11054611 | Not Available | 825 | Open in IMG/M |
| 3300031890|Ga0306925_11707434 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 607 | Open in IMG/M |
| 3300031890|Ga0306925_11865280 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 573 | Open in IMG/M |
| 3300031910|Ga0306923_11530637 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 696 | Open in IMG/M |
| 3300031910|Ga0306923_12145674 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 562 | Open in IMG/M |
| 3300031912|Ga0306921_10083997 | All Organisms → cellular organisms → Bacteria | 3670 | Open in IMG/M |
| 3300031912|Ga0306921_10589049 | All Organisms → cellular organisms → Bacteria | 1287 | Open in IMG/M |
| 3300031912|Ga0306921_11152279 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 866 | Open in IMG/M |
| 3300031912|Ga0306921_11401770 | Not Available | 768 | Open in IMG/M |
| 3300031941|Ga0310912_10994786 | Not Available | 643 | Open in IMG/M |
| 3300031942|Ga0310916_10642116 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 900 | Open in IMG/M |
| 3300031942|Ga0310916_10971074 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 710 | Open in IMG/M |
| 3300031945|Ga0310913_10194784 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1414 | Open in IMG/M |
| 3300031945|Ga0310913_10631792 | Not Available | 759 | Open in IMG/M |
| 3300031946|Ga0310910_11318760 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 557 | Open in IMG/M |
| 3300031946|Ga0310910_11547274 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 508 | Open in IMG/M |
| 3300031954|Ga0306926_10835409 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
| 3300031954|Ga0306926_11799287 | Not Available | 695 | Open in IMG/M |
| 3300032001|Ga0306922_10204717 | All Organisms → cellular organisms → Bacteria | 2118 | Open in IMG/M |
| 3300032001|Ga0306922_12130509 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 543 | Open in IMG/M |
| 3300032001|Ga0306922_12262839 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 522 | Open in IMG/M |
| 3300032001|Ga0306922_12414395 | Not Available | 501 | Open in IMG/M |
| 3300032042|Ga0318545_10166022 | Not Available | 787 | Open in IMG/M |
| 3300032261|Ga0306920_101127486 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1136 | Open in IMG/M |
| 3300033289|Ga0310914_10089053 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2632 | Open in IMG/M |
| 3300033289|Ga0310914_10577755 | Not Available | 1014 | Open in IMG/M |
| 3300033289|Ga0310914_11743451 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 527 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 40.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.50% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 11.03% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.56% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.68% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.94% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.94% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.94% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 2.21% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.47% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.74% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.74% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.74% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.74% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.74% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.74% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.74% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.74% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.74% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.74% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.74% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459009 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 indirect DNA Tissue lysis 0-10cm | Environmental | Open in IMG/M |
| 2170459011 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 indirect Gram positive lysis 0-10cm | Environmental | Open in IMG/M |
| 2189573000 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms) | Environmental | Open in IMG/M |
| 3300000579 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A01 | Environmental | Open in IMG/M |
| 3300000893 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A001 | Environmental | Open in IMG/M |
| 3300002128 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300027019 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 22 (SPAdes) | Environmental | Open in IMG/M |
| 3300027045 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F47_12195310 | 2170459009 | Grass Soil | MIRDELKRFAGDINLSDEQKTKLHERLAFAAGRLFEYKKS |
| F64_02133020 | 2170459011 | Grass Soil | MNDEQGQAIRNELKRFAGDLNLSDEQKTKLHERLAFAAGRLH |
| N55_10169790 | 2189573000 | Grass Soil | MGISDEQGQAIRNELKRFAGDMNLSDEQKTKLHERLAFAAGRLFE |
| AP72_2010_repI_A01DRAFT_10436411 | 3300000579 | Forest Soil | MNDEQAQAIRSELRRIAGDLNLSDEQKTKLHERMAFAAG |
| AP72_2010_repI_A001DRAFT_10141601 | 3300000893 | Forest Soil | MNDEQAQAIRSELRRIAGDLNLSDEQKTKLHERMAFAAGRLFEYKKSH |
| JGI24036J26619_101097721 | 3300002128 | Corn, Switchgrass And Miscanthus Rhizosphere | MGISDEQGQMIGNELRRFAGDINLSDEQKTKLHERLAFAA |
| Ga0062594_1014733431 | 3300005093 | Soil | MNEEQAQALGNELKRFAGDLNLSDEQKTKLRERLAFAAGRLHEY |
| Ga0065704_106822891 | 3300005289 | Switchgrass Rhizosphere | MGISDEQGQMIGNELRRFAGDINLSDEQKTKLHERLAFAAGRLFE |
| Ga0065705_108499132 | 3300005294 | Switchgrass Rhizosphere | MNEEQGQAIRNELKRFAGDLNLSDEQKTKLHERMAFAAGRLHE |
| Ga0066388_1020708111 | 3300005332 | Tropical Forest Soil | MDISTEQGQMIRDEIKRFAGDINLSDEQKTKLHERLAFAA |
| Ga0066388_1050481761 | 3300005332 | Tropical Forest Soil | MNDEQAQAIRNELKRFAGDLNLSDEQKTKLHERLVFAAGRLHEY |
| Ga0070673_1016245762 | 3300005364 | Switchgrass Rhizosphere | MNDEQGQAIRNEIKRFAGDLNLSDEQKTKLHERMAFAAGRLHEYKKSNP |
| Ga0066905_1017341771 | 3300005713 | Tropical Forest Soil | MTDEQAQAIGSELKRIAGDLNLSDEQKTKLRERMAFAAGRLHEYKKSHP |
| Ga0066903_1006930235 | 3300005764 | Tropical Forest Soil | MNDEQAQAIRNELKRFAGDLNLSDEQKTKLHERMAFAAGRLHEYKKSHPD |
| Ga0066903_1007190354 | 3300005764 | Tropical Forest Soil | MNDEQAQAIGNELRRIGGELNLSDEQKTKLRERMAFA |
| Ga0066903_1015352091 | 3300005764 | Tropical Forest Soil | MNDEQAQAVRNEIKRFAGDLNLSDEQKTKLHERMAFAAGRLYEYKKSH |
| Ga0066903_1050262371 | 3300005764 | Tropical Forest Soil | MNDEQAQMIGNELKRIGGELNLSDEQKTKLRERLAFAA |
| Ga0066903_1055879302 | 3300005764 | Tropical Forest Soil | MSLSPEQGQAIREALTRFAGDMNLSDEQKTKLHERLAF |
| Ga0066903_1069641683 | 3300005764 | Tropical Forest Soil | MNLSDEQSQAIKNELKRFAGDINLSDEQKTKLHERLAFAAGRLHE |
| Ga0075433_105177171 | 3300006852 | Populus Rhizosphere | MGISDEQGQMIGNELKRFAGDINLSDEQKTRLHERLAFAA |
| Ga0075434_1005801251 | 3300006871 | Populus Rhizosphere | MNDEQAQAIRNELKRFAGDLNLSDEQKTKLHERMAFA |
| Ga0075434_1013016361 | 3300006871 | Populus Rhizosphere | MNDEQGQAIRNELKRIAGDLNLSDEQKTKLHERMAFAAG |
| Ga0066710_1009076373 | 3300009012 | Grasslands Soil | MSISEEQGQMIRNELKRFAGDINLSDEQKTKLHERLAFA |
| Ga0114129_102953663 | 3300009147 | Populus Rhizosphere | MNEEQGQAIRNELKRFAGDLNLSDEQKTKLHERMAFAAGRLHEYK |
| Ga0126380_108530111 | 3300010043 | Tropical Forest Soil | MNLTAEQAEAIKNELKRFAGDLNLSDEQKTKLHERLASAAEKLHEYKKSHPN* |
| Ga0126384_112055913 | 3300010046 | Tropical Forest Soil | MNDEQAQAIRNELKRFAGDINLSDEQKTKLHERLAFAAGRLHEYK |
| Ga0134111_101778492 | 3300010329 | Grasslands Soil | MGISDEQGQMIGNELKRFAGDINLSDEQKTRLHERLAFAAGRLFEY |
| Ga0126370_126428122 | 3300010358 | Tropical Forest Soil | MTDEQGQAIRNELKRFAGDLNLSDEQKTKLHERMAFAAGRL |
| Ga0126378_127411471 | 3300010361 | Tropical Forest Soil | MTDEQGQAIRNELKRFAGDLNLSDEQKAKLHERMAFAAGRLHE |
| Ga0126379_107248134 | 3300010366 | Tropical Forest Soil | MNDEQAQAIRNELKRIGGNLNLSDEQKTKLHERMAFAAGRLHEYKK |
| Ga0126379_129233311 | 3300010366 | Tropical Forest Soil | MSLSDEQGQAIRNELKRFAGDMNLSDEQKTKLHERLAFAAGRLHE |
| Ga0105239_121413823 | 3300010375 | Corn Rhizosphere | MNEEQGQAIRNELKRFAGDLNLSDEQKTKLHERMAFAAGRLH |
| Ga0126381_1003907251 | 3300010376 | Tropical Forest Soil | MNDEQAQALRNEIKRFAGDLNLSDEQKTKLHERMAFAAGRLFE |
| Ga0126381_1035672921 | 3300010376 | Tropical Forest Soil | MNDEQGQAIRDELKRFAGDLNLSDEQKTKLHERMA |
| Ga0126381_1044045811 | 3300010376 | Tropical Forest Soil | MNLTAEQVEGIKNELKRFGGDLNLSDEQKAKLHER |
| Ga0126383_120426061 | 3300010398 | Tropical Forest Soil | MSLSPEQGQAIREALTRFAGDMNLSDEQKTKLHDRLA |
| Ga0126383_124129611 | 3300010398 | Tropical Forest Soil | MSLTAEQAEAIKNELKRFAGDLNLSDEQKTKLHER |
| Ga0124844_10311593 | 3300010868 | Tropical Forest Soil | MNEEQGQAIRNELKRFAGDLNLSDEQKTKLHERMAFAAGRLHEYKK |
| Ga0137374_1000406720 | 3300012204 | Vadose Zone Soil | MNDEQAQAIRNELKRFAGDLNLSDEQKTKLHERLAFAAGRLHEYKKSHP |
| Ga0126375_108450221 | 3300012948 | Tropical Forest Soil | MNDEQGQAIRNELKRIGGELNLSDEQKAKLHERMAFAAGRLH |
| Ga0126375_121163811 | 3300012948 | Tropical Forest Soil | MNLTEEQGLAIRNELKRIGGELNLSDEQKAKLHERLTVAAGR |
| Ga0157372_110265103 | 3300013307 | Corn Rhizosphere | MGISDEQGQMIGNELKRFAGDINLSDEQKTKLHERLAFAAGRLF |
| Ga0132258_138661851 | 3300015371 | Arabidopsis Rhizosphere | MGISDEQGQMIGNELKRFAGDINLSDEQKTRLHERLA |
| Ga0132257_1045969531 | 3300015373 | Arabidopsis Rhizosphere | MNDEQAQALRNEIKRFAGDLNLSDEQKTKLHERMAFAAGRL |
| Ga0132255_1015623371 | 3300015374 | Arabidopsis Rhizosphere | MNDEQGQAIRNELKRFAGDLNLSDEQKTKLHERMAFAAGRL |
| Ga0132255_1035378942 | 3300015374 | Arabidopsis Rhizosphere | MNEEQGQAIRNELKRFAGDLNLSDEQKTKLHERMAFAAGRLHEYKKS |
| Ga0182036_105458751 | 3300016270 | Soil | MNLTAEQVEGIKSELKRIGGNLNLSDEQKTKLHERLTSAAEKLHEYKQ |
| Ga0182036_107794371 | 3300016270 | Soil | MNLTAEQVEGIKSELKRIGGELNLSDEQKTKLHERLTSAAEKLHEYKQSH |
| Ga0182036_110359881 | 3300016270 | Soil | MSLTAEQAEAIRNELKRIAVILNLSDEQKTKLHEHLN |
| Ga0182036_112322032 | 3300016270 | Soil | MNLTAEQVDAIKNELKRIAGDLNLSDEQKTKLHERLASAAEKLHEYKKSHPNV |
| Ga0182041_103523061 | 3300016294 | Soil | MSLSVEQAEAIKNELKRFAGDLNLSDEQKTKLHERLASAAEK |
| Ga0182041_109645793 | 3300016294 | Soil | MTDEQGQAIRNELKRFAGDLNLSDEQKAKLHERMAFAAGRLHEY |
| Ga0182041_110988461 | 3300016294 | Soil | MSLTAEQAEAIRNELKRIAVILNLSDEQKTKLHEHLNSAAESLHTEYQG |
| Ga0182033_101092361 | 3300016319 | Soil | MNLTAEQVEGIKSELKRIGGDLKLSDEQKTKLHERLAFAAGRLHEYKKSH |
| Ga0182033_106580801 | 3300016319 | Soil | MSLSAEQVEGIKNELKRFAGDLNLSDEQKTKLHERLASAAEKLHEYK |
| Ga0182033_108001961 | 3300016319 | Soil | MNLTAEQVEAIKNELKRIAGDLNLSDEQKTKLHERLASAAEKL |
| Ga0182033_112633752 | 3300016319 | Soil | MSLTIEQGETIRNELRRFAGDLNLSDEQKTKLHEQLAFAAGRLHEYKKSHP |
| Ga0182033_121032802 | 3300016319 | Soil | MSISVEQGQAIRNELKRIAGDLNLSDEQKTKLHEQMAFAAGRL |
| Ga0182035_104626271 | 3300016341 | Soil | MNDEQAQAIRNEIKRFAGDLNLSDEQKTKLHERMAFAAGRLH |
| Ga0182035_113230631 | 3300016341 | Soil | MSLTAEQAEAIKSELKRIGGELNLSDEQKTKLHERLTS |
| Ga0182035_116290261 | 3300016341 | Soil | MSLTAEQVDVIKNEIKRIGGDLNLSDEQKTKLHERLASAAEKLHEYKASHPN |
| Ga0182032_111309612 | 3300016357 | Soil | MNDEQAQALRNEIKRFAGDLNLSDEQKTKLHERMAFAAGRLHEYK |
| Ga0182034_102201191 | 3300016371 | Soil | MSLSAEQVEGIKNELKRFAGDLNLSDEQKTKLHERLASAAEKLH |
| Ga0182034_105210781 | 3300016371 | Soil | MSLSIEQAEAIKNELKRFAGDLNLSDEQKTKLHERLA |
| Ga0182034_109749312 | 3300016371 | Soil | MNDEQGQAIRNELKRFAGDLNLSDEQKTKLHERMAFAAGRLHEYKKS |
| Ga0182034_115686082 | 3300016371 | Soil | VGLSVEQAEAIKNELKRFAGDLNLSDEQKTKLHERLASAAE |
| Ga0182040_112781471 | 3300016387 | Soil | MNLTAEQVDGIKSELKRIGGDLNLSDEQKTKLHERLTSAAEKLHEYKQ |
| Ga0182040_112957601 | 3300016387 | Soil | MSLSAEQVEGIKNELKRIGGDLNLSDEQKTKLHERLASAAEKLHEYKKSHPNVT |
| Ga0182040_114429431 | 3300016387 | Soil | MSLTAEQVEAIKNELKRIAGDLNLSDEQKTKLHERLASAAEKLHEYKKSHPN |
| Ga0182037_101334793 | 3300016404 | Soil | MNDEQAQAIGSELKRIAGDLNLSDEQKTKLRERLVFAAGRLHEYKKSHPG |
| Ga0182037_102906502 | 3300016404 | Soil | MSLTAEQADAIKNELKRFAGDLNLSDEQKTKLHERLASAAEKLHEY |
| Ga0182037_109123761 | 3300016404 | Soil | MNLTAEQVEGIKSELKRIGGELNLSDEQKTKLHERLTSAAEK |
| Ga0182037_116346962 | 3300016404 | Soil | MNDEQAQAIRNELKRIGGELNLSDEQKTKLHERMAFAAG |
| Ga0182039_101849721 | 3300016422 | Soil | MNLTAEQVEGIKNELKRFAGDLNLSDEQKAKLHERLTSAAEKLHEYKKSHP |
| Ga0182039_113488031 | 3300016422 | Soil | MNLTAEQVDGIKSELKRIGGELKLSDEQKTKLHERLT |
| Ga0182038_105437752 | 3300016445 | Soil | MSLSVEQVEGIKNELKRFAGDLNLSDEQKTKLHERLASAAEKL |
| Ga0182038_118367391 | 3300016445 | Soil | MSLTAEQAEAIKSELKRIGGDLNLSDEQKTKLHERLASAAEKLHEYK |
| Ga0134069_12503891 | 3300017654 | Grasslands Soil | MSISEEQGQMIRNELKRFAGDINLSDEQKTKLHER |
| Ga0134112_104226861 | 3300017656 | Grasslands Soil | MGISDEQGQMIGNELKRFAGDINLSDEQKTRLHERLAFAAGRLYEYKKSH |
| Ga0134074_11566052 | 3300017657 | Grasslands Soil | MNDEQAQAIRNELKRFAGDLNLSDEQKTKLHERLAFAAGRLFEYKKSHPE |
| Ga0163161_106235221 | 3300017792 | Switchgrass Rhizosphere | MNDEQGQAIRNELKRFAGDINLSDEQKTRLHERLAFAAGRLFEYKKSH |
| Ga0184620_103504132 | 3300018051 | Groundwater Sediment | MGISDEQGQMIGNELKRFAGDINLSDEQRTRLHERLAFA |
| Ga0173479_107129301 | 3300019362 | Soil | MNEEQAQALRNELKRFAGDLNLSDEQKTKLHERMAFAAGRLH |
| Ga0207697_104076442 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MNEEQGQAIRNELKRFAGDLNLSDEQKTKLHERMAFAAGRL |
| Ga0207668_110181691 | 3300025972 | Switchgrass Rhizosphere | MGISDEQGQMIGNELRRFAGDINLSDEQQTKLHERLAFAAGR |
| Ga0207640_115087331 | 3300025981 | Corn Rhizosphere | MGISDEQGQMIGNELKRFAGDINLSDEQKTRLHARLAFAAGRL |
| Ga0209807_11167463 | 3300026530 | Soil | MNDEEGKAIRHELKRFAGDLNLSDEQKIKLHERMAFAAGRLHEYK |
| Ga0207857_10373502 | 3300027019 | Tropical Forest Soil | MSLSAEQGQMIRNELKRFAGDLHLSDEQKSKLHEQ |
| Ga0207726_10404361 | 3300027045 | Tropical Forest Soil | MSLTAEQAEAIKNELKRIAGDLNLSDEQKTKLHERLTSAADKLHEYKKSHP |
| Ga0207826_10012201 | 3300027680 | Tropical Forest Soil | MSLTAEQAEAIKNELKRIAGDLNLSDEQKTKLHERL |
| Ga0207826_10071291 | 3300027680 | Tropical Forest Soil | MSLSAEQAEAIKNELKRIAGDLNLSDEQKTKLHERL |
| Ga0207862_10586993 | 3300027703 | Tropical Forest Soil | MNLSAEQTEAIKSELKRFAGDLNLSDEQKTKLHERLTSAAEKLHE |
| Ga0170834_1025033201 | 3300031057 | Forest Soil | MSFSEEQGQAIRNELKRFAGDINLSDEQRTKLHERL |
| Ga0170820_145532821 | 3300031446 | Forest Soil | MGISDEQGQMIGNELKRFAGDINLSDEQKTRLHERL |
| Ga0170820_164493921 | 3300031446 | Forest Soil | MGISDEQGQMIGNELRRFAGDINLSDEQKTKLHERLAFAAGRLF |
| Ga0318560_106161481 | 3300031682 | Soil | MNLTPEQVDGIKSELKRIGGELNLSDEQKTKLHERLTSAA |
| Ga0306917_100556314 | 3300031719 | Soil | MNEEQGQAIRNELKRFARDLNLSDEQKTKLHERMAFAAGRLHEYKKSH |
| Ga0306917_111775761 | 3300031719 | Soil | MSLSAEQVEGIKNELKRFAGDLNLSDEQKTKLHERLASAAEK |
| Ga0306917_114756441 | 3300031719 | Soil | MNDEQAQALRNEIKRFAGDLNLSDEQKTKLHERMAFAA |
| Ga0318501_105934613 | 3300031736 | Soil | MSLTDEQVEAIKNELKRIAGDLNLSDEQKTKLHERLTSAADKLH |
| Ga0318501_106090641 | 3300031736 | Soil | MSLTDEQAGAIKNELKRIAGDLNLSDEQKTKLHERLA |
| Ga0306918_110240881 | 3300031744 | Soil | MNDEQAQAIGSELKRIAGDLNLSDEQKTKLHERMAFAAGRLHEYKKSHP |
| Ga0318546_112581282 | 3300031771 | Soil | MSLSAEQVEGIKNELKRIGGDLNLSDEQKTKLHERLASA |
| Ga0310917_103524581 | 3300031833 | Soil | MNDEQGQAIRNEIKRFAGDLNLSDEQKTKLHERMAFAAGRLHEYKKSH |
| Ga0306919_112304981 | 3300031879 | Soil | MSLSAEQVEGIKNELKRIGGDLNLSDEQKTKLHERLASAAEKLHEYKKS |
| Ga0318544_103632301 | 3300031880 | Soil | MNLSAEQTEAIKNELKRFAGDLNLSDEQKTKLHERLASAAEKLHEYKKS |
| Ga0306925_102039294 | 3300031890 | Soil | MNDEQAQALGNELKRFAGDLNLSDEQKTKLRERLAFAAGR |
| Ga0306925_103102602 | 3300031890 | Soil | MNLTAEQVEGIKSELKRIGGELNLSDEQKTKLHERLTSAAEKL |
| Ga0306925_103692491 | 3300031890 | Soil | MNLTAEQVDGIKSELKRIGGDLNLSDEQKTKLHERLTSAAEKLHE |
| Ga0306925_110546111 | 3300031890 | Soil | MSLTAEQAEAIKSELKRIGGELNLSDEQKTKLHERLTSAA |
| Ga0306925_117074342 | 3300031890 | Soil | MTDEQGQAIRNELKRFAGDLNLSDEQKAKLHERMA |
| Ga0306925_118652801 | 3300031890 | Soil | MNLTAEQAEAIKNELKRFAGDLNLSDEQKTKLHERLASAAEKLHEYKKSHP |
| Ga0306923_115306371 | 3300031910 | Soil | MSLSAEQVEGIKNELKRIGGDLNLSDEQKTKLHERLASAAEKLH |
| Ga0306923_121456742 | 3300031910 | Soil | MNDEQAQALRNEIKRFAGDLNLSDEQKTKLHERMAFAAGRLHEYKK |
| Ga0306921_100839976 | 3300031912 | Soil | MNEEQGQAIRNELKRFAGDLNLSDEQKTKLHERMAFAAG |
| Ga0306921_105890491 | 3300031912 | Soil | MTDEQGQAIRNELKRFAGDLNLSDEQKAKLHERMAFAAG |
| Ga0306921_111522792 | 3300031912 | Soil | MSISVEQGQAIRNELKRIAGDLNLSDEQKTKLHEQMAFAAG |
| Ga0306921_114017701 | 3300031912 | Soil | MNLTAEQVEGIKSELKRIGGELNLSDEQKTKLHERLTSAAEKLH |
| Ga0310912_109947862 | 3300031941 | Soil | MNLTPEQVEGIKSELKRFAGDLNLSDEQKAKLHERLASAAEKLN |
| Ga0310916_106421161 | 3300031942 | Soil | MSLSAEQVEGIKNELKRFAGDLNLSDEQKTKLHERLASAAEKLHEY |
| Ga0310916_109710741 | 3300031942 | Soil | MNLTAEQAEAIKNELKRFAGDLNLSDEQKTKLHERLASAAEKLHEY |
| Ga0310913_101947841 | 3300031945 | Soil | MSLSAEQVEGIKNELKRFAGDLNLSDEQKTKLHER |
| Ga0310913_106317921 | 3300031945 | Soil | MSLSAEQVEGIKNELKRIGGDLNLSDEQKTKLHDRLASAA |
| Ga0310910_113187602 | 3300031946 | Soil | MNEEQGQAIRNELKRFARDLNLSDEQKTKLHERMAFAA |
| Ga0310910_115472741 | 3300031946 | Soil | MTDEQGQAIRNELKRFAGDLNLSDEQKTKLHERMAFAAGRLHEYKKSHP |
| Ga0306926_108354092 | 3300031954 | Soil | MLSDEQGQAIRNELKRFAGDINLSDEQKTKLHERLAF |
| Ga0306926_117992872 | 3300031954 | Soil | MSLTAEQADAIKNELKRFAGDLNLSDEQKTKLHERLAS |
| Ga0306922_102047171 | 3300032001 | Soil | MNDEQAQALRNEIKRFAGDLNLSDEQKTKLHERMAFAAGR |
| Ga0306922_121305091 | 3300032001 | Soil | MSLTAEQVDGIKNELKRIGGDLNLSDEQKTKLHERMAAAA |
| Ga0306922_122628391 | 3300032001 | Soil | MDISTEQGQMIRDELKRFAGDINLSDEQKTKLHERLAFAA |
| Ga0306922_124143951 | 3300032001 | Soil | MNLTAEQVEGIKSELKRIGGNLNLSDEQKTKLHERLTSAAEKLH |
| Ga0318545_101660221 | 3300032042 | Soil | MSLTDEQVEAIKNELKRIAGDLNLSDEQKTKLHERLTSAADKLHEYKKSHP |
| Ga0306920_1011274862 | 3300032261 | Soil | MNLTAEQVDAIKNELKRIAGDLNLSDEQKTKLHERLASAAEKLHEYKK |
| Ga0310914_100890531 | 3300033289 | Soil | MNDEQAQALRNEIKRFAGDLNLSDEQKTKLHERMAF |
| Ga0310914_105777553 | 3300033289 | Soil | MNLTPEQVEGIKSELKRIGGDLNLSDEQKAKLHERLASAAEKL |
| Ga0310914_117434511 | 3300033289 | Soil | MNLSAEQTEAIKNELKRFAGDLNLSDEQKTKLHERLASAAEKLHEY |
| ⦗Top⦘ |