| Basic Information | |
|---|---|
| Family ID | F057119 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 136 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MTFLLGMGLGSLLTIGAAFIFAADRNILDEGDENYYN |
| Number of Associated Samples | 79 |
| Number of Associated Scaffolds | 136 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 68.38 % |
| % of genes near scaffold ends (potentially truncated) | 19.12 % |
| % of genes from short scaffolds (< 2000 bps) | 71.32 % |
| Associated GOLD sequencing projects | 76 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (38.971 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (25.735 % of family members) |
| Environment Ontology (ENVO) | Unclassified (51.471 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (55.147 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 44.62% β-sheet: 0.00% Coil/Unstructured: 55.38% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 136 Family Scaffolds |
|---|---|---|
| PF13759 | 2OG-FeII_Oxy_5 | 5.88 |
| PF04851 | ResIII | 5.15 |
| PF07460 | NUMOD3 | 4.41 |
| PF02086 | MethyltransfD12 | 1.47 |
| PF07669 | Eco57I | 0.74 |
| PF05014 | Nuc_deoxyrib_tr | 0.74 |
| PF14328 | DUF4385 | 0.74 |
| PF16724 | T4-gp15_tss | 0.74 |
| PF01555 | N6_N4_Mtase | 0.74 |
| PF07963 | N_methyl | 0.74 |
| PF13392 | HNH_3 | 0.74 |
| PF00111 | Fer2 | 0.74 |
| PF06044 | DpnI | 0.74 |
| PF00856 | SET | 0.74 |
| PF13469 | Sulfotransfer_3 | 0.74 |
| PF04023 | FeoA | 0.74 |
| COG ID | Name | Functional Category | % Frequency in 136 Family Scaffolds |
|---|---|---|---|
| COG0338 | DNA-adenine methylase | Replication, recombination and repair [L] | 1.47 |
| COG3392 | Adenine-specific DNA methylase | Replication, recombination and repair [L] | 1.47 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.74 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.74 |
| COG1918 | Fe2+ transport protein FeoA | Inorganic ion transport and metabolism [P] | 0.74 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.74 |
| COG3613 | Nucleoside 2-deoxyribosyltransferase | Nucleotide transport and metabolism [F] | 0.74 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 61.03 % |
| Unclassified | root | N/A | 38.97 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000756|JGI12421J11937_10012125 | All Organisms → Viruses → Predicted Viral | 3294 | Open in IMG/M |
| 3300001968|GOS2236_1005167 | Not Available | 790 | Open in IMG/M |
| 3300002131|M2t2BS1_1478320 | All Organisms → Viruses → Predicted Viral | 3026 | Open in IMG/M |
| 3300002144|M2t2BS2_10845253 | Not Available | 818 | Open in IMG/M |
| 3300002835|B570J40625_100455073 | All Organisms → Viruses → Predicted Viral | 1220 | Open in IMG/M |
| 3300005581|Ga0049081_10001683 | Not Available | 8345 | Open in IMG/M |
| 3300005581|Ga0049081_10166293 | Not Available | 802 | Open in IMG/M |
| 3300005583|Ga0049085_10048180 | All Organisms → Viruses → Predicted Viral | 1539 | Open in IMG/M |
| 3300005805|Ga0079957_1003801 | Not Available | 12731 | Open in IMG/M |
| 3300005805|Ga0079957_1004100 | Not Available | 12201 | Open in IMG/M |
| 3300005805|Ga0079957_1004709 | Not Available | 11279 | Open in IMG/M |
| 3300005805|Ga0079957_1022861 | All Organisms → Viruses → Predicted Viral | 4309 | Open in IMG/M |
| 3300005805|Ga0079957_1064873 | All Organisms → Viruses → Predicted Viral | 2142 | Open in IMG/M |
| 3300005940|Ga0073913_10063676 | Not Available | 602 | Open in IMG/M |
| 3300005941|Ga0070743_10088734 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 1042 | Open in IMG/M |
| 3300006005|Ga0073910_1005501 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 815 | Open in IMG/M |
| 3300007538|Ga0099851_1332799 | Not Available | 532 | Open in IMG/M |
| 3300007541|Ga0099848_1219717 | Not Available | 675 | Open in IMG/M |
| 3300007544|Ga0102861_1015160 | All Organisms → Viruses → Predicted Viral | 1880 | Open in IMG/M |
| 3300007735|Ga0104988_10532 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 17049 | Open in IMG/M |
| 3300008055|Ga0108970_11389142 | All Organisms → Viruses → Predicted Viral | 2365 | Open in IMG/M |
| 3300008510|Ga0110928_1048500 | Not Available | 612 | Open in IMG/M |
| 3300009001|Ga0102963_1226695 | Not Available | 742 | Open in IMG/M |
| 3300009152|Ga0114980_10029615 | All Organisms → Viruses → Predicted Viral | 3390 | Open in IMG/M |
| 3300009155|Ga0114968_10680819 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 540 | Open in IMG/M |
| 3300009159|Ga0114978_10880155 | Not Available | 501 | Open in IMG/M |
| 3300009183|Ga0114974_10020332 | All Organisms → Viruses → Predicted Viral | 4694 | Open in IMG/M |
| 3300010354|Ga0129333_10006194 | Not Available | 11319 | Open in IMG/M |
| 3300010354|Ga0129333_10012154 | Not Available | 8165 | Open in IMG/M |
| 3300010354|Ga0129333_10024088 | Not Available | 5771 | Open in IMG/M |
| 3300010354|Ga0129333_10028518 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5281 | Open in IMG/M |
| 3300010354|Ga0129333_10070656 | All Organisms → Viruses → Predicted Viral | 3244 | Open in IMG/M |
| 3300010354|Ga0129333_10145960 | All Organisms → Viruses → Predicted Viral | 2172 | Open in IMG/M |
| 3300010354|Ga0129333_10340156 | All Organisms → Viruses → Predicted Viral | 1336 | Open in IMG/M |
| 3300010354|Ga0129333_10755511 | Not Available | 832 | Open in IMG/M |
| 3300010354|Ga0129333_10755512 | Not Available | 832 | Open in IMG/M |
| 3300010354|Ga0129333_11380655 | Not Available | 580 | Open in IMG/M |
| 3300010354|Ga0129333_11408521 | Not Available | 573 | Open in IMG/M |
| 3300010370|Ga0129336_10377460 | Not Available | 777 | Open in IMG/M |
| 3300010885|Ga0133913_13078679 | All Organisms → Viruses → Predicted Viral | 1108 | Open in IMG/M |
| 3300011268|Ga0151620_1000197 | Not Available | 23568 | Open in IMG/M |
| 3300011268|Ga0151620_1012649 | All Organisms → Viruses → Predicted Viral | 3002 | Open in IMG/M |
| 3300012970|Ga0129338_1090975 | Not Available | 524 | Open in IMG/M |
| 3300013087|Ga0163212_1090444 | Not Available | 990 | Open in IMG/M |
| 3300013087|Ga0163212_1093998 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 967 | Open in IMG/M |
| 3300013087|Ga0163212_1208029 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 611 | Open in IMG/M |
| 3300013087|Ga0163212_1208780 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Synechococcus phage S-CBM2 | 610 | Open in IMG/M |
| 3300013087|Ga0163212_1221017 | Not Available | 591 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10453260 | Not Available | 714 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10554435 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 750 | Open in IMG/M |
| 3300013372|Ga0177922_10024825 | All Organisms → Viruses → Predicted Viral | 1917 | Open in IMG/M |
| 3300017788|Ga0169931_10392186 | Not Available | 1031 | Open in IMG/M |
| 3300018682|Ga0188851_1025730 | Not Available | 672 | Open in IMG/M |
| 3300018775|Ga0188848_1002165 | All Organisms → Viruses → Predicted Viral | 2278 | Open in IMG/M |
| 3300018775|Ga0188848_1007100 | All Organisms → Viruses → Predicted Viral | 1248 | Open in IMG/M |
| 3300019096|Ga0188835_1005155 | All Organisms → Viruses → Predicted Viral | 1265 | Open in IMG/M |
| 3300020074|Ga0194113_10067180 | All Organisms → Viruses → Predicted Viral | 3332 | Open in IMG/M |
| 3300020074|Ga0194113_10114497 | All Organisms → Viruses → Predicted Viral | 2322 | Open in IMG/M |
| 3300020074|Ga0194113_10200435 | All Organisms → Viruses → Predicted Viral | 1598 | Open in IMG/M |
| 3300020074|Ga0194113_10230137 | All Organisms → Viruses | 1456 | Open in IMG/M |
| 3300020074|Ga0194113_10366076 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 1069 | Open in IMG/M |
| 3300020074|Ga0194113_10407996 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 996 | Open in IMG/M |
| 3300020074|Ga0194113_10433063 | Not Available | 958 | Open in IMG/M |
| 3300020074|Ga0194113_10934502 | Not Available | 583 | Open in IMG/M |
| 3300020083|Ga0194111_10039303 | All Organisms → Viruses → Predicted Viral | 4330 | Open in IMG/M |
| 3300020083|Ga0194111_10457472 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Synechococcus phage S-CBM2 | 830 | Open in IMG/M |
| 3300020083|Ga0194111_10725917 | Not Available | 607 | Open in IMG/M |
| 3300020084|Ga0194110_10307158 | All Organisms → Viruses → Predicted Viral | 1117 | Open in IMG/M |
| 3300020084|Ga0194110_10358930 | Not Available | 1001 | Open in IMG/M |
| 3300020141|Ga0211732_1165579 | Not Available | 818 | Open in IMG/M |
| 3300020151|Ga0211736_10070449 | All Organisms → Viruses → Predicted Viral | 4110 | Open in IMG/M |
| 3300020151|Ga0211736_10634005 | Not Available | 849 | Open in IMG/M |
| 3300020159|Ga0211734_10570491 | All Organisms → Viruses → Predicted Viral | 1144 | Open in IMG/M |
| 3300020161|Ga0211726_11067808 | All Organisms → Viruses → Predicted Viral | 1222 | Open in IMG/M |
| 3300020172|Ga0211729_10686650 | All Organisms → Viruses → Predicted Viral | 2520 | Open in IMG/M |
| 3300020179|Ga0194134_10086383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1582 | Open in IMG/M |
| 3300020179|Ga0194134_10100235 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Synechococcus phage S-CBM2 | 1420 | Open in IMG/M |
| 3300020179|Ga0194134_10250951 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Synechococcus phage S-CBM2 | 725 | Open in IMG/M |
| 3300020179|Ga0194134_10302316 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Synechococcus phage S-CBM2 | 630 | Open in IMG/M |
| 3300020183|Ga0194115_10078512 | All Organisms → Viruses → Predicted Viral | 1924 | Open in IMG/M |
| 3300020183|Ga0194115_10154927 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1187 | Open in IMG/M |
| 3300020183|Ga0194115_10179206 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Tamkungvirus → Tamkungvirus ST4 | 1069 | Open in IMG/M |
| 3300020183|Ga0194115_10192847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1013 | Open in IMG/M |
| 3300020183|Ga0194115_10251007 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 836 | Open in IMG/M |
| 3300020183|Ga0194115_10270847 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 791 | Open in IMG/M |
| 3300020183|Ga0194115_10399111 | Not Available | 591 | Open in IMG/M |
| 3300020196|Ga0194124_10102743 | All Organisms → Viruses → Predicted Viral | 1622 | Open in IMG/M |
| 3300020197|Ga0194128_10069520 | All Organisms → Viruses → Predicted Viral | 2375 | Open in IMG/M |
| 3300020214|Ga0194132_10039864 | All Organisms → Viruses → Predicted Viral | 3842 | Open in IMG/M |
| 3300020220|Ga0194119_10161224 | All Organisms → Viruses → Predicted Viral | 1645 | Open in IMG/M |
| 3300021093|Ga0194123_10421780 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 606 | Open in IMG/M |
| 3300021323|Ga0210295_1204458 | Not Available | 6141 | Open in IMG/M |
| 3300021376|Ga0194130_10033618 | All Organisms → Viruses → Predicted Viral | 3943 | Open in IMG/M |
| 3300021376|Ga0194130_10159124 | All Organisms → Viruses → Predicted Viral | 1380 | Open in IMG/M |
| 3300021376|Ga0194130_10165271 | All Organisms → Viruses → Predicted Viral | 1345 | Open in IMG/M |
| 3300021376|Ga0194130_10194295 | All Organisms → Viruses → Predicted Viral | 1204 | Open in IMG/M |
| 3300021376|Ga0194130_10200874 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 1177 | Open in IMG/M |
| 3300021376|Ga0194130_10254040 | All Organisms → Viruses | 1002 | Open in IMG/M |
| 3300021961|Ga0222714_10006665 | Not Available | 10744 | Open in IMG/M |
| 3300021961|Ga0222714_10026802 | All Organisms → Viruses → Predicted Viral | 4367 | Open in IMG/M |
| 3300021961|Ga0222714_10106407 | All Organisms → Viruses → Predicted Viral | 1763 | Open in IMG/M |
| 3300021961|Ga0222714_10301663 | Not Available | 878 | Open in IMG/M |
| 3300021961|Ga0222714_10500891 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Nodensvirus → Synechococcus virus SPM2 | 623 | Open in IMG/M |
| 3300021961|Ga0222714_10610071 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 544 | Open in IMG/M |
| 3300021962|Ga0222713_10583195 | All Organisms → Viruses | 655 | Open in IMG/M |
| 3300021963|Ga0222712_10000386 | All Organisms → Viruses | 60081 | Open in IMG/M |
| 3300021963|Ga0222712_10819826 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 511 | Open in IMG/M |
| 3300021964|Ga0222719_10062274 | Not Available | 2811 | Open in IMG/M |
| 3300022752|Ga0214917_10000005 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 250224 | Open in IMG/M |
| 3300024346|Ga0244775_10047593 | All Organisms → Viruses → Predicted Viral | 3747 | Open in IMG/M |
| 3300024348|Ga0244776_10836091 | Not Available | 552 | Open in IMG/M |
| 3300025283|Ga0208048_1130651 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 507 | Open in IMG/M |
| 3300027140|Ga0255080_1060095 | Not Available | 584 | Open in IMG/M |
| 3300027627|Ga0208942_1203641 | Not Available | 507 | Open in IMG/M |
| 3300027734|Ga0209087_1353121 | Not Available | 507 | Open in IMG/M |
| 3300027759|Ga0209296_1046501 | All Organisms → Viruses → Predicted Viral | 2290 | Open in IMG/M |
| 3300027763|Ga0209088_10216623 | Not Available | 811 | Open in IMG/M |
| 3300029930|Ga0119944_1001502 | All Organisms → Viruses → Predicted Viral | 4120 | Open in IMG/M |
| 3300029930|Ga0119944_1005718 | All Organisms → Viruses → Predicted Viral | 1994 | Open in IMG/M |
| 3300029930|Ga0119944_1007171 | All Organisms → Viruses → Predicted Viral | 1750 | Open in IMG/M |
| 3300029930|Ga0119944_1014058 | All Organisms → Viruses → Predicted Viral | 1156 | Open in IMG/M |
| 3300029930|Ga0119944_1029413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 713 | Open in IMG/M |
| 3300029930|Ga0119944_1040957 | Not Available | 573 | Open in IMG/M |
| 3300029933|Ga0119945_1004830 | All Organisms → Viruses → Predicted Viral | 1898 | Open in IMG/M |
| 3300031519|Ga0307488_10525196 | Not Available | 702 | Open in IMG/M |
| 3300031566|Ga0307378_10699178 | Not Available | 871 | Open in IMG/M |
| 3300031578|Ga0307376_10643236 | Not Available | 671 | Open in IMG/M |
| 3300031669|Ga0307375_10320333 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 988 | Open in IMG/M |
| 3300031746|Ga0315293_10409763 | All Organisms → Viruses → Predicted Viral | 1065 | Open in IMG/M |
| 3300031834|Ga0315290_11247346 | Not Available | 615 | Open in IMG/M |
| 3300031952|Ga0315294_11077262 | Not Available | 663 | Open in IMG/M |
| 3300031999|Ga0315274_10412120 | All Organisms → Viruses → Predicted Viral | 1562 | Open in IMG/M |
| 3300032156|Ga0315295_10873553 | Not Available | 899 | Open in IMG/M |
| 3300032173|Ga0315268_10296902 | All Organisms → Viruses → Predicted Viral | 1564 | Open in IMG/M |
| 3300033994|Ga0334996_0007237 | Not Available | 7520 | Open in IMG/M |
| 3300034071|Ga0335028_0528687 | Not Available | 647 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 25.74% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 8.82% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 8.82% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 7.35% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 5.88% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.88% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 5.15% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 4.41% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 3.68% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 2.94% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.94% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.21% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.21% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 2.21% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.47% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.47% |
| Marine | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine | 1.47% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 1.47% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.74% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.74% |
| Water Bodies | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Water Bodies | 0.74% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.74% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.74% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.74% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.74% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.74% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
| 3300001968 | Marine microbial communities from Lake Gatun, Panama - GS020 | Environmental | Open in IMG/M |
| 3300002131 | Marine microbial communities from the Baltic Sea, analyzing arctic terrigenous carbon compounds - M2t2BS1 (111f) | Environmental | Open in IMG/M |
| 3300002144 | Marine microbial communities from the Baltic Sea, analyzing arctic terrigenous carbon compounds - M2t2BS2 (113f) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300005940 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300006005 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_25-Nov-14 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
| 3300007735 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014Oct | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008510 | Microbial Communities in Water bodies, Singapore - Site RA | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300012970 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013087 | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300018682 | Metatranscriptome of marine microbial communities from Baltic Sea - GS680_0p1 | Environmental | Open in IMG/M |
| 3300018775 | Metatranscriptome of marine microbial communities from Baltic Sea - GS679_0p8 | Environmental | Open in IMG/M |
| 3300019096 | Metatranscriptome of marine microbial communities from Baltic Sea - GS676_0p1 | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300020083 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300m | Environmental | Open in IMG/M |
| 3300020084 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020179 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0m | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300020196 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015031 Kigoma Deep Cast 0m | Environmental | Open in IMG/M |
| 3300020197 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015037 Kigoma Deep Cast 65m | Environmental | Open in IMG/M |
| 3300020214 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015054 Kigoma Offshore 80m | Environmental | Open in IMG/M |
| 3300020220 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100m | Environmental | Open in IMG/M |
| 3300021093 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015023 Mahale A surface | Environmental | Open in IMG/M |
| 3300021323 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R9.63AS (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021376 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surface | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300025283 | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L (SPAdes) | Environmental | Open in IMG/M |
| 3300027140 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepC_8h | Environmental | Open in IMG/M |
| 3300027627 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
| 3300029933 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727_2 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12421J11937_100121258 | 3300000756 | Freshwater And Sediment | MNFLFGVGLGALITIGVSFIFAADRNILDEEDDEWYT* |
| GOS2236_10051674 | 3300001968 | Marine | MTFLLGMGLGSLLTIGFAFLIAADDNLDEGDENYYN* |
| M2t2BS1_14783203 | 3300002131 | Marine | MTFFLGIGLGALLTIGVSFIFAADRNILDEGDDEYYNKK* |
| M2t2BS2_108452533 | 3300002144 | Marine | MTFFLGIGLGALLTIGVSFIFAADRNILDEGDDG* |
| B570J40625_1004550731 | 3300002835 | Freshwater | LLSRGVLLMTFLLGMGLGSLLTIGAAFIFSADRNILDEGDENYYN* |
| Ga0049081_100016838 | 3300005581 | Freshwater Lentic | MTFLLGMGLGALLTIGAAFIFAADRNILDEGDENYYN* |
| Ga0049081_101662932 | 3300005581 | Freshwater Lentic | MTFFLGIGLGALLTIGVSFIFAADRNILDEGDDEYYNKE* |
| Ga0049085_100481803 | 3300005583 | Freshwater Lentic | MIFLLGMAFGSLLTIGTAFIFAADQNILDESDENYYN* |
| Ga0079957_100380129 | 3300005805 | Lake | MTFLLGMGLGSLLTIGAAFIFAADNNILDEGDENYYN* |
| Ga0079957_100410016 | 3300005805 | Lake | MTFLLGMGLGSLLTIGAAFIFAADRNILDEGDENY* |
| Ga0079957_100470911 | 3300005805 | Lake | MTFLLGIGLGSLLTIGTAFIFAADKNILDEGDENYYN* |
| Ga0079957_10228611 | 3300005805 | Lake | MTFLLGMALGSLLTIGTAFIFAADRNILDEGDENYYN* |
| Ga0079957_10648736 | 3300005805 | Lake | MTFLLGMGLGSLLTIGAAFIFAADRNILDEGDENYYN* |
| Ga0073913_100636762 | 3300005940 | Sand | MTFLLGMALGSLITIGASFIAAADRNILDEGDENYYN* |
| Ga0070743_100887344 | 3300005941 | Estuarine | MVFIAGMGLGALLTIGAALIFAGDTNNLDEGDENYYN* |
| Ga0073910_10055012 | 3300006005 | Sand | MTFLLGIALGSLVTIGVAFITAADRNILDEDDENYYN* |
| Ga0099851_13327992 | 3300007538 | Aqueous | VTFLLGMGLGALLTIGAAFIFAADENILDEGDENHYN* |
| Ga0099848_12197172 | 3300007541 | Aqueous | MTFLLGMGLGSLLTIGAAFIFAADRNNLDEGDENYYN* |
| Ga0102861_10151607 | 3300007544 | Estuarine | MTFLLGMALGSLITIGASFIAAADRNMLDEGDENYYN* |
| Ga0104988_1053238 | 3300007735 | Freshwater | MTFLLGMGFGFLLTVGTAFIFAADGNLDEGDENYYN* |
| Ga0108970_113891426 | 3300008055 | Estuary | MTFILGMALGSLVTIGVAFITAADRNMLDEGDENYYN* |
| Ga0110928_10485002 | 3300008510 | Water Bodies | MTFLLGMALGSLLTIGAAFIFAADENILDEGDENYYN* |
| Ga0102963_12266953 | 3300009001 | Pond Water | MVFFAGVSLGVLLTIGAALILAGDVNNLDEGDENHYN* |
| Ga0114980_100296158 | 3300009152 | Freshwater Lake | MTFLLGMALGSLITIGASFIAAADRNILDEGDKNYYN* |
| Ga0114968_106808191 | 3300009155 | Freshwater Lake | MTFLLGMALGSLITIGASFIAAADRNILDEGNKNYYN* |
| Ga0114978_108801551 | 3300009159 | Freshwater Lake | TFRNHSRLLSCGVHMTFLLGMALGSLITIGASFIAAADRNILDEGDKNYYN* |
| Ga0114974_100203326 | 3300009183 | Freshwater Lake | MTFLLGMALGSLLTIGSAFIAAADRNILDEGDKNYYN* |
| Ga0129333_1000619412 | 3300010354 | Freshwater To Marine Saline Gradient | MVFLAGVGLGVLLTFGVAFIFAADQNILDEGDENYYN* |
| Ga0129333_1001215416 | 3300010354 | Freshwater To Marine Saline Gradient | MTFLLGMALGSLLTIGTAFIFAADRNNLDEGDENYYN* |
| Ga0129333_1002408810 | 3300010354 | Freshwater To Marine Saline Gradient | MTFLLGMGLGSLLIIGAAFIFVADQNILDEGDENN* |
| Ga0129333_100285181 | 3300010354 | Freshwater To Marine Saline Gradient | MTFLLGMGLGALLTMGAAFIFAADKNILDEGDENYYN* |
| Ga0129333_100706566 | 3300010354 | Freshwater To Marine Saline Gradient | MTFLLGMGLGSLLTIGAAFIFAADQNNLDEGDENYYN* |
| Ga0129333_101459606 | 3300010354 | Freshwater To Marine Saline Gradient | MTFLLGMGLGALLTIGAAFIFAADQNILDEGDENYYNDEVINKD* |
| Ga0129333_103401566 | 3300010354 | Freshwater To Marine Saline Gradient | MTFLLGMGLGSLLTIAAAFIFAADENILDEGDENYYN* |
| Ga0129333_107555114 | 3300010354 | Freshwater To Marine Saline Gradient | MTFLLGMGLGALLTIGAAFIFAGDENILDEGDENYYN* |
| Ga0129333_107555124 | 3300010354 | Freshwater To Marine Saline Gradient | MTFLLGMGLGALLTVGAAFIFAGDENILDEGDENY* |
| Ga0129333_113806554 | 3300010354 | Freshwater To Marine Saline Gradient | MTFLLGMGLGALLTIGAAFIFAGDQNNLDEGDENYYN* |
| Ga0129333_114085213 | 3300010354 | Freshwater To Marine Saline Gradient | MTFLLGMGLGALLTMGAAFIFAADRNILDEGDENYYN* |
| Ga0129336_103774601 | 3300010370 | Freshwater To Marine Saline Gradient | MTFLLGMGLGALLTMGAAFIFAADRNILDEGDENYYN |
| Ga0133913_130786793 | 3300010885 | Freshwater Lake | MTFILGMALGSLVTIGVAFITAADRNMLDDEDENYYN* |
| Ga0151620_100019710 | 3300011268 | Freshwater | MTFLLGMGIGSLLTIGAAFIFSADQNVLDEGDKLD* |
| Ga0151620_10126498 | 3300011268 | Freshwater | MTFLLGMGLGSLLTIGAAFIFAADRNNLDEGDKNN* |
| Ga0129338_10909751 | 3300012970 | Aqueous | MTFLLGMALGSLLTIGASFIFAADRNILDEGDENYYN* |
| Ga0163212_10904442 | 3300013087 | Freshwater | MTFLLGMALGSLLTIGAAFIVSADENILDEGDKNNYN* |
| Ga0163212_10939983 | 3300013087 | Freshwater | LMTFLLGMGLGSLLTIGFAFLVAADSHLDEGDENNL* |
| Ga0163212_12080292 | 3300013087 | Freshwater | LLSRGVLLMTFLLGMGLGSLLTIGFAFLVAADSHLDEGDENNL* |
| Ga0163212_12087803 | 3300013087 | Freshwater | MTFLLGMGLGSLLTIGFAFLVAADSHLDEGDENYYNDEVIHEDK* |
| Ga0163212_12210172 | 3300013087 | Freshwater | MTFLLGMGLGSLLTIGFAFLVAADSHLDEGDKNYYNDEVIHKDK* |
| (restricted) Ga0172367_104532602 | 3300013126 | Freshwater | MTFLLGMGLGSLLTIGLAFLVAADEHLDEGDENYYNDEVIHEDK* |
| (restricted) Ga0172372_105544354 | 3300013132 | Freshwater | MTFLLGMGLGSLLTIGVAFLFAADEHLDEGDENYYN* |
| Ga0177922_100248255 | 3300013372 | Freshwater | MTFLLGMALGSLLTIGTAFIFAADRNILDEGDKNYYN* |
| Ga0169931_103921863 | 3300017788 | Freshwater | MTFLLGMGLGSLLTIGAAFIFAADREILDEGDENYYNDEVIHEDK |
| Ga0188851_10257304 | 3300018682 | Freshwater Lake | MMFIAGLGLGALITIGVSFIFAADRNILDEEDDEWYT |
| Ga0188848_10021656 | 3300018775 | Freshwater Lake | MMFIAGLGLGALITIGVSFIFAADRNVLDEEDDEWYT |
| Ga0188848_10071005 | 3300018775 | Freshwater Lake | MTFFLGIGLGALLTIGVSFIFAADRNILDEGDDEYYNKE |
| Ga0188835_10051555 | 3300019096 | Freshwater Lake | MTFFLGIGLGALLTIGVSFIFAADRNILDEGDDEYYNKK |
| Ga0194113_100671801 | 3300020074 | Freshwater Lake | SRRLLSCRILLMTFLLGMGLGSLITIGFAFLVAADSHLDEGDENYYN |
| Ga0194113_101144976 | 3300020074 | Freshwater Lake | MTFLLGLGLGSLLTIGFAFLVAADSHLDEGNENYYNDEVIHEDK |
| Ga0194113_102004353 | 3300020074 | Freshwater Lake | MTFLLGMALGSLLTIGAAFIVSADENILDEGDKNNYN |
| Ga0194113_102301373 | 3300020074 | Freshwater Lake | MTFLLGMGLGSLLTIGFAFLVAADSHLDEGDEKNL |
| Ga0194113_103660763 | 3300020074 | Freshwater Lake | MTFLLGMGLGSLLTIGFAFLVAADSHLDEGDENNF |
| Ga0194113_104079962 | 3300020074 | Freshwater Lake | MTFLLGMGLGSLLTIGFAFLVAADSHLDEGDENNYD |
| Ga0194113_104330635 | 3300020074 | Freshwater Lake | MTFLLGMALGSLLTIGTAFIFAADQNILDEGDKNYYNK |
| Ga0194113_109345021 | 3300020074 | Freshwater Lake | SRRLLSCRILLMTFLLGMGLGSLITIGFAFLVAADSHLDEGDENYYNDEVIHEDK |
| Ga0194111_100393037 | 3300020083 | Freshwater Lake | MTFLLGLGLGSLLTIGFAFLVAADSHLDEGNKNYYNDEVIHEDK |
| Ga0194111_104574724 | 3300020083 | Freshwater Lake | MTFLLGMGLGSLITIGFAFLVAADSHLDEGDENNL |
| Ga0194111_107259172 | 3300020083 | Freshwater Lake | MTFILGMGLGSLLTIGFAFLVAADSHLDEGDENYYNDEVIHEDK |
| Ga0194110_103071581 | 3300020084 | Freshwater Lake | GSLLTIGFAFLVAADSHLDEGDENYYNDEVIHEDK |
| Ga0194110_103589302 | 3300020084 | Freshwater Lake | MTFLLGMGLGSLLTIGFAFLVAADEHLDEGDENYYNK |
| Ga0211732_11655794 | 3300020141 | Freshwater | MNFLFGVGLGALITIGVSFIFAADRNKLDEEDDEWYT |
| Ga0211736_100704494 | 3300020151 | Freshwater | MTFLLGMALGSLLTIGATFIFAADRNILDDGDQNNYN |
| Ga0211736_106340054 | 3300020151 | Freshwater | VSMNFLFGVGLGALITIGVSFIFAADRNKLDEGDDGYYDDEVNYDK |
| Ga0211734_105704914 | 3300020159 | Freshwater | LYSGVSMNFLFGVGLGALITIGVSFIFAADRNKLDEGDDGYYDDEVNYDK |
| Ga0211726_110678083 | 3300020161 | Freshwater | MTFLLGMGLGSLLTIGAAFIFASDRNNLDEGDENYYN |
| Ga0211729_106866504 | 3300020172 | Freshwater | MTFLLGMGLGSLLTIGAAFIFASDRNNLDEGDEDYYN |
| Ga0194134_100863832 | 3300020179 | Freshwater Lake | MTFLLGMGLGSLLTIGAAFIFAADLHFDEGDENYYNK |
| Ga0194134_101002355 | 3300020179 | Freshwater Lake | MTFLLGMGLGSLLTIGFAFLVAADSHLDEGDENYYNDEVIHED |
| Ga0194134_102509511 | 3300020179 | Freshwater Lake | MTFLLGMGLGSLITIGFAFLVAADSHLDEGDENYYN |
| Ga0194134_103023163 | 3300020179 | Freshwater Lake | MTFLLGMGLCSLLIIGFAFLVAADSHLDEGDENYYNDEVIHED |
| Ga0194115_100785125 | 3300020183 | Freshwater Lake | MIFLLGMGLGSLLTIGFAFLVAADSHLDEGDENYYNDKVIHEDK |
| Ga0194115_101549273 | 3300020183 | Freshwater Lake | MTFILGMGLGSLLTIGFAFLVAADSHLDEGDENNL |
| Ga0194115_101792061 | 3300020183 | Freshwater Lake | MTFLLGMGLGSLLTIGFAFLVAADEHLDEGDENYY |
| Ga0194115_101928473 | 3300020183 | Freshwater Lake | MTFLLGMGLGSLLTIGFAFLVAADSHLDEGDKNHYNDEVIHEDK |
| Ga0194115_102510074 | 3300020183 | Freshwater Lake | MTFLLGMGLGSLLTIGFAFLVAADSHLDEGDKNYYNDEVIHKDK |
| Ga0194115_102708471 | 3300020183 | Freshwater Lake | LSRGVLLMTFLLGMGLGSLLTIGFAFLVAADSHLDEGDENNL |
| Ga0194115_103991113 | 3300020183 | Freshwater Lake | RRLLSCRILLMTFLLGMGLGSLITIGFAFLVAADSHLDEGDENYYNDEVIHEDK |
| Ga0194124_101027435 | 3300020196 | Freshwater Lake | MTFLLGVGLGSLLTIGFAFLVAADSHLDEGDENYYNDEVIHEDK |
| Ga0194128_100695206 | 3300020197 | Freshwater Lake | MTFLLGLGLGSLLTIGFAFLVAADSHLDEGNENYYNDEVNHEDK |
| Ga0194132_100398641 | 3300020214 | Freshwater Lake | SRGVLLMTFLLGMGLGSLLTIGFAFLVAADSHLDEGDENYYN |
| Ga0194119_101612246 | 3300020220 | Freshwater Lake | LGLGLGSLLTIGFAFLVAADSHLDEGDENYYNDEVIHEDK |
| Ga0194123_104217801 | 3300021093 | Freshwater Lake | SRRLLSCRILLMTFLLGMGLGSLITIGFAFLVAADSHLDEGDENNL |
| Ga0210295_12044586 | 3300021323 | Estuarine | MTFLLGMGLGSLLTIGAAFIFAADRNNLDEGDENYYN |
| Ga0194130_100336181 | 3300021376 | Freshwater Lake | SRILLMTFLLGMGLGSLLTIGFAFLVAADSHLDEGDENYYN |
| Ga0194130_101591245 | 3300021376 | Freshwater Lake | MTFLLGMGLGSLLTIGFAFLVAADSHLDEGDENNL |
| Ga0194130_101652711 | 3300021376 | Freshwater Lake | LGMGLGSLLTIGFAFLVAADSHLDEGDENYYNDEVIHEDK |
| Ga0194130_101942955 | 3300021376 | Freshwater Lake | MTFLLGMGLGSLLTIGFAFLVAADSHLDEGDENYYNDEVIHEDK |
| Ga0194130_102008745 | 3300021376 | Freshwater Lake | MTFLLGLGLGSLLTIGFAFLVAADSHLDEGDENYYNDEVIHEDK |
| Ga0194130_102540404 | 3300021376 | Freshwater Lake | MTFLLGMGLGSLLTIGFAFLVAADSHLDEGDENYYNDKVIHEDK |
| Ga0222714_1000666526 | 3300021961 | Estuarine Water | MTFILGMGLGSLLTIGAAFIFAADRNILDEGDENHYN |
| Ga0222714_100268029 | 3300021961 | Estuarine Water | MTFLLGMALGSLLTIGTAFIFAADRNILDEGDENYYN |
| Ga0222714_101064073 | 3300021961 | Estuarine Water | MTFLLGMALGSLITIGASFIAAADRNILDEGDENYYN |
| Ga0222714_103016632 | 3300021961 | Estuarine Water | MTFLLGMGLGSLLTIGAAFIFAADRNNLDEGDKNN |
| Ga0222714_105008911 | 3300021961 | Estuarine Water | MTFLLGMGLGSLLTIGAAFIFAADRNNLDEGDKNYYN |
| Ga0222714_106100713 | 3300021961 | Estuarine Water | MTFLLGIALGSLVTIGVAFITAADRNILDEDDENYYN |
| Ga0222713_105831952 | 3300021962 | Estuarine Water | MTFFLGIGLGALLTIGVSFIFAADRNILDEGDDGYYDDEVNYDK |
| Ga0222712_1000038665 | 3300021963 | Estuarine Water | MTFLLGMGLGSLLTIGAAFIFAADQNILDEGDTND |
| Ga0222712_108198261 | 3300021963 | Estuarine Water | MTFILGMALGSLITIGASFIIAADTNIVDEGDENYYN |
| Ga0222719_100622748 | 3300021964 | Estuarine Water | MVFFAGVSLGVLLTIGAALILAGDVNNLDEGDENHYN |
| Ga0214917_1000000547 | 3300022752 | Freshwater | MTFLFGMGLGSLLTIGAAFIFAADRNILDEGDENYYN |
| Ga0244775_100475935 | 3300024346 | Estuarine | MVFIAGMGLGALLTIGAALIFAGDTNNLDEGDENYYN |
| Ga0244776_108360912 | 3300024348 | Estuarine | MVFLAGMGLGALLTIGAAFIFAADKNILDEGDENYYN |
| Ga0208048_11306511 | 3300025283 | Freshwater | LLMTFLLGMGLGSLLTIGFAFLVAADSHLDEGDENNL |
| Ga0255080_10600953 | 3300027140 | Freshwater | RLLSCGVHMTFLLGMALGSLITIGTALIFAIDDEDENYYN |
| Ga0208942_12036413 | 3300027627 | Freshwater Lentic | MIFLLGMAFGSLLTIGTAFIFAADQNILDESDENYYN |
| Ga0209087_13531212 | 3300027734 | Freshwater Lake | MTFLLGMALGSLITIGASFIAAADRNILDEGDKNYYN |
| Ga0209296_10465015 | 3300027759 | Freshwater Lake | MTFLLGMALGSLLTIGSAFIAAADRNILDEGDKNYYN |
| Ga0209088_102166233 | 3300027763 | Freshwater Lake | MTFILGMALGSLVTIGVAFITAADRNMLDDEDENYYN |
| Ga0119944_10015023 | 3300029930 | Aquatic | MTFLLGMALGSLLTIGAAFIFAADENILDEGDENYYN |
| Ga0119944_10057182 | 3300029930 | Aquatic | MTFLLGMGLGSLLTIGTAFIFAADRNILDEGDENYYN |
| Ga0119944_10071715 | 3300029930 | Aquatic | MTFLLGMAFGSLLTIGTAFIFAADQNILDEGDENYYN |
| Ga0119944_10140582 | 3300029930 | Aquatic | MTFLLGMGLGSLLIIGAAFIFVADRNNLDEGDKNN |
| Ga0119944_10294133 | 3300029930 | Aquatic | MTFLLGMALGSLLTIGAAFIIAADDNLDEGDENYYN |
| Ga0119944_10409571 | 3300029930 | Aquatic | MTFLLGMGLGSLLTIGFAFLVTADENILDEGDENHYN |
| Ga0119945_10048301 | 3300029933 | Aquatic | MTFLLGMGLGSLLTIGFAFLVAADENILDEGDENHYN |
| Ga0307488_105251963 | 3300031519 | Sackhole Brine | MMFIAGLGLGALITIGVAFIVAADRNKLDEEDDEWYT |
| Ga0307378_106991781 | 3300031566 | Soil | YSKMTFFLGIGLGALLTIGVSFIFAADRNILDEGDDEYYNKE |
| Ga0307376_106432362 | 3300031578 | Soil | MIFIAGIGLGALITIGVSFIFAADRNKLDEGDNKYYDDEVNYDE |
| Ga0307375_103203334 | 3300031669 | Soil | MTFFLGIGLRALLTIGVSFIFAADRNILDEGDDEYYNKE |
| Ga0315293_104097632 | 3300031746 | Sediment | MTFLLGIALGSLLTIGAAFIAAADRNVLDEGDENYYN |
| Ga0315290_112473462 | 3300031834 | Sediment | MNFLFGVGLGALITIGVSFIFAADRNILDEEDDEWYT |
| Ga0315294_110772621 | 3300031952 | Sediment | MMFIAGLGLGALLTIGVSFIVAADRNILDEGDDGYYDDEVNW |
| Ga0315274_104121202 | 3300031999 | Sediment | MTFILGIALGSLLTIGASFIAAGSNILDEGDENYYN |
| Ga0315295_108735534 | 3300032156 | Sediment | MNFLFGVGLGALITIGVSFIFAADRNILDEGDDGYYDDEVNYDK |
| Ga0315268_102969023 | 3300032173 | Sediment | MTFILGIALGSLITIGASFIVAADRNVLDEGDENYYN |
| Ga0334996_0007237_2666_2779 | 3300033994 | Freshwater | MTFLLGMGLGSLLTIGAAFIFAADQNNLDEGDENYYN |
| Ga0335028_0528687_497_610 | 3300034071 | Freshwater | MTFLLGMGLGSLLTIGAAFIFSADRNILDEGDENYYN |
| ⦗Top⦘ |