| Basic Information | |
|---|---|
| Family ID | F056977 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 137 |
| Average Sequence Length | 42 residues |
| Representative Sequence | VLAFGALEWTFLAILVALVGAAGVFALFLVIQLFRNPSRR |
| Number of Associated Samples | 74 |
| Number of Associated Scaffolds | 137 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 80.17 % |
| % of genes near scaffold ends (potentially truncated) | 20.44 % |
| % of genes from short scaffolds (< 2000 bps) | 72.99 % |
| Associated GOLD sequencing projects | 71 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.59 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.321 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (29.927 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.226 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.015 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.12% β-sheet: 0.00% Coil/Unstructured: 55.88% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 137 Family Scaffolds |
|---|---|---|
| PF01553 | Acyltransferase | 40.88 |
| PF12146 | Hydrolase_4 | 16.79 |
| PF12697 | Abhydrolase_6 | 15.33 |
| PF03330 | DPBB_1 | 4.38 |
| PF13189 | Cytidylate_kin2 | 3.65 |
| PF02782 | FGGY_C | 2.92 |
| PF00365 | PFK | 2.19 |
| PF00696 | AA_kinase | 1.46 |
| PF12695 | Abhydrolase_5 | 1.46 |
| PF00072 | Response_reg | 1.46 |
| PF08241 | Methyltransf_11 | 0.73 |
| PF06737 | Transglycosylas | 0.73 |
| PF00370 | FGGY_N | 0.73 |
| PF05977 | MFS_3 | 0.73 |
| PF00005 | ABC_tran | 0.73 |
| PF16701 | Ad_Cy_reg | 0.73 |
| PF03372 | Exo_endo_phos | 0.73 |
| PF12704 | MacB_PCD | 0.73 |
| COG ID | Name | Functional Category | % Frequency in 137 Family Scaffolds |
|---|---|---|---|
| COG0205 | 6-phosphofructokinase | Carbohydrate transport and metabolism [G] | 2.19 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.73 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.32 % |
| Unclassified | root | N/A | 11.68 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000887|AL16A1W_10034570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5887 | Open in IMG/M |
| 3300000956|JGI10216J12902_107256256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 879 | Open in IMG/M |
| 3300000956|JGI10216J12902_107971402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1178 | Open in IMG/M |
| 3300000956|JGI10216J12902_119142161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 612 | Open in IMG/M |
| 3300001431|F14TB_101079829 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300004157|Ga0062590_101781579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 630 | Open in IMG/M |
| 3300005167|Ga0066672_10586707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 722 | Open in IMG/M |
| 3300005174|Ga0066680_10260094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1104 | Open in IMG/M |
| 3300005174|Ga0066680_10531678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 739 | Open in IMG/M |
| 3300005180|Ga0066685_10251086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1220 | Open in IMG/M |
| 3300005180|Ga0066685_10281863 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1149 | Open in IMG/M |
| 3300005180|Ga0066685_10632833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 736 | Open in IMG/M |
| 3300005181|Ga0066678_10521041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 790 | Open in IMG/M |
| 3300005445|Ga0070708_100032339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4537 | Open in IMG/M |
| 3300005445|Ga0070708_100385169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1322 | Open in IMG/M |
| 3300005447|Ga0066689_10596311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 697 | Open in IMG/M |
| 3300005468|Ga0070707_100680090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 992 | Open in IMG/M |
| 3300005536|Ga0070697_100863211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 802 | Open in IMG/M |
| 3300005540|Ga0066697_10247912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1055 | Open in IMG/M |
| 3300005540|Ga0066697_10505396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 685 | Open in IMG/M |
| 3300005553|Ga0066695_10831159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 531 | Open in IMG/M |
| 3300005559|Ga0066700_10636799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 740 | Open in IMG/M |
| 3300005561|Ga0066699_11162923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 530 | Open in IMG/M |
| 3300005598|Ga0066706_10148571 | All Organisms → cellular organisms → Bacteria | 1760 | Open in IMG/M |
| 3300005764|Ga0066903_102146241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1076 | Open in IMG/M |
| 3300005764|Ga0066903_108452759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 525 | Open in IMG/M |
| 3300006904|Ga0075424_100495738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1304 | Open in IMG/M |
| 3300006914|Ga0075436_101204053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 572 | Open in IMG/M |
| 3300007004|Ga0079218_13872496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 509 | Open in IMG/M |
| 3300007076|Ga0075435_101192416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 666 | Open in IMG/M |
| 3300007076|Ga0075435_101296311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 638 | Open in IMG/M |
| 3300009012|Ga0066710_100043142 | All Organisms → cellular organisms → Bacteria | 5471 | Open in IMG/M |
| 3300009012|Ga0066710_101378067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1093 | Open in IMG/M |
| 3300009012|Ga0066710_101519615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1032 | Open in IMG/M |
| 3300009012|Ga0066710_101722655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 952 | Open in IMG/M |
| 3300009012|Ga0066710_101920360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 885 | Open in IMG/M |
| 3300009012|Ga0066710_102247069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 795 | Open in IMG/M |
| 3300009012|Ga0066710_102369280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 770 | Open in IMG/M |
| 3300009012|Ga0066710_103032222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 653 | Open in IMG/M |
| 3300009012|Ga0066710_103299950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 616 | Open in IMG/M |
| 3300009012|Ga0066710_104585106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 516 | Open in IMG/M |
| 3300009088|Ga0099830_10069036 | All Organisms → cellular organisms → Bacteria | 2557 | Open in IMG/M |
| 3300009088|Ga0099830_11561513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 550 | Open in IMG/M |
| 3300009090|Ga0099827_10353892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1250 | Open in IMG/M |
| 3300009090|Ga0099827_10833588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 798 | Open in IMG/M |
| 3300009090|Ga0099827_11639163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 560 | Open in IMG/M |
| 3300009090|Ga0099827_11680871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 553 | Open in IMG/M |
| 3300009137|Ga0066709_100010875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 8319 | Open in IMG/M |
| 3300009137|Ga0066709_100361884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1998 | Open in IMG/M |
| 3300009137|Ga0066709_100496133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1718 | Open in IMG/M |
| 3300009137|Ga0066709_100612147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1553 | Open in IMG/M |
| 3300009137|Ga0066709_101407130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1014 | Open in IMG/M |
| 3300009137|Ga0066709_101797849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 860 | Open in IMG/M |
| 3300009137|Ga0066709_104128477 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300009147|Ga0114129_10094944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4130 | Open in IMG/M |
| 3300011003|Ga0138514_100081056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 689 | Open in IMG/M |
| 3300012096|Ga0137389_10469233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1079 | Open in IMG/M |
| 3300012096|Ga0137389_11669361 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 533 | Open in IMG/M |
| 3300012204|Ga0137374_10005912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 14565 | Open in IMG/M |
| 3300012204|Ga0137374_10007820 | All Organisms → cellular organisms → Bacteria | 12697 | Open in IMG/M |
| 3300012204|Ga0137374_10157486 | All Organisms → cellular organisms → Bacteria | 2018 | Open in IMG/M |
| 3300012204|Ga0137374_10289672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1350 | Open in IMG/M |
| 3300012204|Ga0137374_10708004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 755 | Open in IMG/M |
| 3300012204|Ga0137374_10898598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 651 | Open in IMG/M |
| 3300012204|Ga0137374_11227998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 523 | Open in IMG/M |
| 3300012206|Ga0137380_10073657 | All Organisms → cellular organisms → Bacteria | 3124 | Open in IMG/M |
| 3300012206|Ga0137380_11375412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 591 | Open in IMG/M |
| 3300012209|Ga0137379_10163955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2134 | Open in IMG/M |
| 3300012209|Ga0137379_10752727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 879 | Open in IMG/M |
| 3300012210|Ga0137378_11292865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 645 | Open in IMG/M |
| 3300012349|Ga0137387_10007605 | All Organisms → cellular organisms → Bacteria | 6183 | Open in IMG/M |
| 3300012350|Ga0137372_10072401 | All Organisms → cellular organisms → Bacteria | 2962 | Open in IMG/M |
| 3300012350|Ga0137372_10845219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 654 | Open in IMG/M |
| 3300012354|Ga0137366_10038699 | All Organisms → cellular organisms → Bacteria | 3694 | Open in IMG/M |
| 3300012354|Ga0137366_10989177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 586 | Open in IMG/M |
| 3300012355|Ga0137369_10007979 | All Organisms → cellular organisms → Bacteria | 10590 | Open in IMG/M |
| 3300012355|Ga0137369_10009617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 9570 | Open in IMG/M |
| 3300012355|Ga0137369_10071143 | All Organisms → cellular organisms → Bacteria | 2945 | Open in IMG/M |
| 3300012356|Ga0137371_10540373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 898 | Open in IMG/M |
| 3300012356|Ga0137371_10574261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 867 | Open in IMG/M |
| 3300012358|Ga0137368_10560461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 729 | Open in IMG/M |
| 3300012358|Ga0137368_10610415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 692 | Open in IMG/M |
| 3300012532|Ga0137373_10062653 | All Organisms → cellular organisms → Bacteria | 3398 | Open in IMG/M |
| 3300012532|Ga0137373_11196064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 537 | Open in IMG/M |
| 3300012957|Ga0164303_10691616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 686 | Open in IMG/M |
| 3300013772|Ga0120158_10264674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 852 | Open in IMG/M |
| 3300014056|Ga0120125_1155395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 558 | Open in IMG/M |
| 3300014823|Ga0120170_1030693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1369 | Open in IMG/M |
| 3300015358|Ga0134089_10552622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 510 | Open in IMG/M |
| 3300017997|Ga0184610_1089225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 966 | Open in IMG/M |
| 3300018027|Ga0184605_10367860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 648 | Open in IMG/M |
| 3300018027|Ga0184605_10400669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 613 | Open in IMG/M |
| 3300018028|Ga0184608_10464215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 544 | Open in IMG/M |
| 3300018431|Ga0066655_10846017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 623 | Open in IMG/M |
| 3300018433|Ga0066667_11361218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 622 | Open in IMG/M |
| 3300018433|Ga0066667_11784142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 556 | Open in IMG/M |
| 3300018468|Ga0066662_11751959 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 650 | Open in IMG/M |
| 3300018482|Ga0066669_10429568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1128 | Open in IMG/M |
| 3300018482|Ga0066669_12005098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 542 | Open in IMG/M |
| 3300021344|Ga0193719_10436739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 534 | Open in IMG/M |
| 3300025922|Ga0207646_10435969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1182 | Open in IMG/M |
| 3300026296|Ga0209235_1203274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 678 | Open in IMG/M |
| 3300026552|Ga0209577_10137107 | All Organisms → cellular organisms → Bacteria | 1940 | Open in IMG/M |
| 3300027862|Ga0209701_10208243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1163 | Open in IMG/M |
| 3300027875|Ga0209283_10229353 | All Organisms → cellular organisms → Bacteria | 1233 | Open in IMG/M |
| 3300027882|Ga0209590_10130125 | All Organisms → cellular organisms → Bacteria | 1540 | Open in IMG/M |
| 3300027882|Ga0209590_10300507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1030 | Open in IMG/M |
| 3300027882|Ga0209590_10940511 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 542 | Open in IMG/M |
| 3300028791|Ga0307290_10182201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 770 | Open in IMG/M |
| 3300028796|Ga0307287_10414579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 507 | Open in IMG/M |
| 3300028814|Ga0307302_10302201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 787 | Open in IMG/M |
| 3300028824|Ga0307310_10478034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 626 | Open in IMG/M |
| 3300028828|Ga0307312_10718496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 662 | Open in IMG/M |
| 3300028828|Ga0307312_11102938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 525 | Open in IMG/M |
| 3300028878|Ga0307278_10004349 | All Organisms → cellular organisms → Bacteria | 6834 | Open in IMG/M |
| 3300028881|Ga0307277_10402707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae | 612 | Open in IMG/M |
| 3300028884|Ga0307308_10614511 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 521 | Open in IMG/M |
| 3300030006|Ga0299907_10035474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3898 | Open in IMG/M |
| 3300030336|Ga0247826_11109443 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300031421|Ga0308194_10246223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 598 | Open in IMG/M |
| 3300034172|Ga0334913_012319 | All Organisms → cellular organisms → Bacteria | 2005 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 29.93% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 21.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 17.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.49% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.11% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.65% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.92% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 2.92% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.46% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.73% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.73% |
| Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 0.73% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.73% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.73% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.73% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000887 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-65cm-16A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
| 3300014056 | Permafrost microbial communities from Nunavut, Canada - A20_5cm_0M | Environmental | Open in IMG/M |
| 3300014823 | Permafrost microbial communities from Nunavut, Canada - A3_80cm_0M | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300034172 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 9HMS | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AL16A1W_100345702 | 3300000887 | Permafrost | MIAFGALQWSFLAALVVLVGAAGVFALFLVLQLFRNPSRR* |
| JGI10216J12902_1072562561 | 3300000956 | Soil | MLAYGVLEWTFLTVLVLLVGAAGLFAVFLVVQLFRDHGG |
| JGI10216J12902_1079714022 | 3300000956 | Soil | MLAFGILEWTFLVALVILVGAAGLFALFIVAQLFRNPRRS* |
| JGI10216J12902_1191421612 | 3300000956 | Soil | VLAFGPLEWTFTIVLIVLVLAAGLFALFILLQLIRP |
| F14TB_1010798292 | 3300001431 | Soil | MVGFGPLEWTFVGILVTLVGATGLFALFLVVQLFRNPSRRR* |
| Ga0062590_1017815792 | 3300004157 | Soil | MLGSFGALEWTFLIVLVVLVGAAGVFALYLLVQLFLGHSRRT* |
| Ga0066672_105294001 | 3300005167 | Soil | VAYGALEWTFIGILAAMVTMAGLFAVFVVVQLFRNPSRKG* |
| Ga0066672_105867071 | 3300005167 | Soil | GQAVIMLAFGPLEWTFTAVLIALVGAAGVFALFLIVQLFRAHSRRT* |
| Ga0066680_102600942 | 3300005174 | Soil | MLAFGPLEWTFTAVLIALVGAAGVFALFLIVQLFRAHSRRT* |
| Ga0066680_105316782 | 3300005174 | Soil | MLAFGALEWTFLAILVALVGAAGVFALYLVIQLFRNPTRNPSRR* |
| Ga0066679_101423032 | 3300005176 | Soil | VAYGALEWTFIGILAAMVTMAGLFAVFVVLQLFRNPSRKG* |
| Ga0066690_103552722 | 3300005177 | Soil | LVAYGALEWTFIGILAAMVTMAGLFAVFVVLQLFRNPSRKG* |
| Ga0066690_108817681 | 3300005177 | Soil | LLAYGALEWTFIGILAVMVTAAGLFAVFVVVQLFRNPSRKE* |
| Ga0066685_102510861 | 3300005180 | Soil | MLAFGVLEWSFLAALVALVGAAGIFGLYVLMQLFRNPRRKMRAR* |
| Ga0066685_102818632 | 3300005180 | Soil | MLTFGPLEWTFTAILIALVGVAGLFALYLVIQLFRTHSRRT* |
| Ga0066685_106328331 | 3300005180 | Soil | VLGFGALEWTFVGLLVGLVGLAGLFFLFLVVQLFRNPARHPGSGR* |
| Ga0066678_105210411 | 3300005181 | Soil | MLTFGPLEWTFTAILIALVGVAGLFALYLVIQLFRTHSRRT |
| Ga0070708_1000323392 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MLAFGPLEWTFTAILMALVAAAGLFALFLVMQLFRAHSRRT* |
| Ga0070708_1003020712 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MVAYGALEWTFIGLLAVMVTAAALFAVFVVVQLFRNPSRRG* |
| Ga0070708_1003851692 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MLAFGPLEWTFTIVLVLSVVAAALFFLFIVLQLFRAHSRR* |
| Ga0066689_105963112 | 3300005447 | Soil | MLAFGPLEWTFTAILIALVGVAGLFALYLVIQLFRTHSRRT* |
| Ga0070707_1006800902 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MLAFGVLEWTFLTLLVLLVGAAGVFALFLVLQLFRNPTSRPRTPR* |
| Ga0070697_1008632112 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MLAFGVLEWTFLTLLVLLVGAAGVFALFLVLQLFRNPTSRPRAPR* |
| Ga0066697_102479121 | 3300005540 | Soil | AFGVLEWTFLTLLVLLVGAAGVFGLFLVLQLFRNPTSRPRAPR* |
| Ga0066697_105053962 | 3300005540 | Soil | MIAAFGVLEWTFLAILVLLTGSAGVFGLFLVAQLFRNPSRRRRTRAGTG* |
| Ga0066695_105317272 | 3300005553 | Soil | VVAYGALEWTFVGILAAMVTAAGFFAVFVVLQLFRNPSRKG* |
| Ga0066695_108311592 | 3300005553 | Soil | MLTFGPLEWTFTAVLIALVGVAGLFALYLVIQLFRTHSRRT* |
| Ga0066700_106367991 | 3300005559 | Soil | KPLVMLAFGVLEWTFLTLLVLLEGAAGVFALFLVLQLFRNPTSRPRTPR* |
| Ga0066699_102204361 | 3300005561 | Soil | MLAYHALEWTFIGILAAMVTAAGLFTLFVLIQLFRNPSRKG* |
| Ga0066699_111629231 | 3300005561 | Soil | VLAAFGALEWSFLVALVVLVGAAGVFALFILMQLFRAHSRR* |
| Ga0066706_101485715 | 3300005598 | Soil | VLAFGPLEWTFVVVLVALVGAAGVFALFLVAQLFRTHSRRA* |
| Ga0066903_1021462412 | 3300005764 | Tropical Forest Soil | MLGFGVLEWTFLTLLVLLVGAAGVFALFLVLQLFRNPTARPRTPR* |
| Ga0066903_1084527592 | 3300005764 | Tropical Forest Soil | MLAFGVLEWTFLTLLVLLVGGAGVFALFLVLQLFRNPTSRRGARR* |
| Ga0075424_1004957382 | 3300006904 | Populus Rhizosphere | MLAFGVLEWTFLTLLVLLVGAAGVFGLFLVLQLFRNPTSRPRAQR* |
| Ga0075436_1012040531 | 3300006914 | Populus Rhizosphere | VIAFGTLEWSFLIALVVLVGAAGVFFLFILMQLFRVHSRR* |
| Ga0079218_138724961 | 3300007004 | Agricultural Soil | VVAFGILEWSFLAALIFLVGAVTLFAVFLLAQLFRIHSRK* |
| Ga0075435_1011924161 | 3300007076 | Populus Rhizosphere | MLAFGPLEWTFTIVLVLLVGAAGLFFLFILLQLFRAHSRR* |
| Ga0075435_1012963111 | 3300007076 | Populus Rhizosphere | MLGFGVLEWTFLTLLVLLVGAAGVFALFLVLQLFRNPTSRPRAPR* |
| Ga0066710_1000431426 | 3300009012 | Grasslands Soil | MLAFGPLEWTFTAILIALVGVAGLFALYLVIQLFRTHSRRT |
| Ga0066710_1002579562 | 3300009012 | Grasslands Soil | MLAYHTLEWTFIALLAAMVTAAGLFAVYVLIQLFRNPSRKG |
| Ga0066710_1006086181 | 3300009012 | Grasslands Soil | VVAYGALEWTFVGILAAMVTAAGFFAVFVVLQLFRNPSRKG |
| Ga0066710_1013780672 | 3300009012 | Grasslands Soil | VLAFGPLEWTFVVVLVALVGAAGVFALFLVAQLFRTHSRRA |
| Ga0066710_1015196152 | 3300009012 | Grasslands Soil | MLAFGKLEWTFLSLLVLLVGAAGLFGLFLVLNLFRNPSRRRP |
| Ga0066710_1017226552 | 3300009012 | Grasslands Soil | MLAFGILEWTFVAVLVLLVGAAGLFALFMVVQLFRNPRRS |
| Ga0066710_1019203602 | 3300009012 | Grasslands Soil | MAAFGLLEWTFVGVLVALVGAAGMFALFLLLQLFRNPSRRH |
| Ga0066710_1022470692 | 3300009012 | Grasslands Soil | AFGVLEWSFLAALVVLVGAAGIFGLYVLVQLFRNPRRG |
| Ga0066710_1023692802 | 3300009012 | Grasslands Soil | MIAAFGVLEWTFLAILVLLTGSAGVFGLFLVAQLFRNPSRRRRTRAGTG |
| Ga0066710_1030322222 | 3300009012 | Grasslands Soil | MLAFGRLEWMFVSVLILLVGAAGVFAAYLVLQLFRIPPRRS |
| Ga0066710_1032999501 | 3300009012 | Grasslands Soil | GNPSMLGFGVLEWTFVAILVLLVGGAGVFALFLLVQLFRNPSRRG |
| Ga0066710_1045851061 | 3300009012 | Grasslands Soil | GVLEWSFLAALVALVGAAGIFGLYVLMQLFRNPRRKMRAR |
| Ga0099830_100690363 | 3300009088 | Vadose Zone Soil | VLAFGALEWTFLAILVALVGAAGVFALFLVIQLFRNPSRR* |
| Ga0099830_115615132 | 3300009088 | Vadose Zone Soil | MLAFGRLEWTFVSVLILLVGAAGVFAAYLVLQLFRNPPRRS* |
| Ga0099827_103538922 | 3300009090 | Vadose Zone Soil | VIAFGILEWTFLAVLVFLVGAAGLFALFLVVQLFRNPRRS* |
| Ga0099827_108335882 | 3300009090 | Vadose Zone Soil | MLAFGALEWAFVAILVGLVGAAGVFALYLVIQLFRNPTRNPSRR* |
| Ga0099827_116391631 | 3300009090 | Vadose Zone Soil | MLAFGPLEWTFTAILIALVGMAGLFALYLVIQLFRTHSRR |
| Ga0099827_116808712 | 3300009090 | Vadose Zone Soil | MLAFGVLEWGFTIALVALVGAAGVFGLYVVAQLFRNPRRG* |
| Ga0066709_1000108754 | 3300009137 | Grasslands Soil | MIAFGPLEWTFLAILVLLVGAAGLFAVFLLVQLFRTHSRRA* |
| Ga0066709_1001360775 | 3300009137 | Grasslands Soil | MLAYHTLEWTFIALLAAMVTAAGLFAVYVLIQLFRNPSRKG* |
| Ga0066709_1003618842 | 3300009137 | Grasslands Soil | MAAFGLLEWTFVGVLVALVGAAGLFALFLLLQLFRNPSRRH* |
| Ga0066709_1004961332 | 3300009137 | Grasslands Soil | MLGFGALEWTFLAILVALVGAAGVFALFLVVQLFRNPTRNPSRR* |
| Ga0066709_1006121472 | 3300009137 | Grasslands Soil | VLAYSALQWSFVVLLVVLVGAAGLFAVFLVAQLFRNPARR* |
| Ga0066709_1012481712 | 3300009137 | Grasslands Soil | VVAYGALEWTFVVILAAMVTAAGFFAVFVVLQLFRNPSRRG* |
| Ga0066709_1014071302 | 3300009137 | Grasslands Soil | VIAAFGILEWTFLVVLIVLVGAAGVFALFILMQLFRAHSRR* |
| Ga0066709_1017978491 | 3300009137 | Grasslands Soil | MIAAFGVLEWTFLAILVLLTGSAGLFALYLVAQLFRNPSR |
| Ga0066709_1041284772 | 3300009137 | Grasslands Soil | VIASFGLLEWTFLALLVLLVGAAGVFAIFLVVQLFQGHGRPRPSP* |
| Ga0114129_100949444 | 3300009147 | Populus Rhizosphere | MLAFGPLEWTFTVILLVLVGAAGLFALFLIAQLFRGHSRRT* |
| Ga0138514_1000810562 | 3300011003 | Soil | MLAFGILEWTFLAALVILVGAAGLFALFMVAQLFRNPRRS* |
| Ga0137389_104692332 | 3300012096 | Vadose Zone Soil | MVAFGVLEWTFLTLLVLLVGAAGVFALFLVLQLFRNPTSRPRAPR* |
| Ga0137389_116693612 | 3300012096 | Vadose Zone Soil | NPRGKGSAIVLAFGALEWTFLAILVALVGAAGVFALFLVIQLFRNPTRR* |
| Ga0137374_100059123 | 3300012204 | Vadose Zone Soil | MLAFGMLEWTFVAVLVLLVGAAGLFALFMLAQLFRNPRRS* |
| Ga0137374_1000782010 | 3300012204 | Vadose Zone Soil | MLAFGPLEWTFTAILIVLVGVAGLFALYLVIQLFRAHSRRT* |
| Ga0137374_101574863 | 3300012204 | Vadose Zone Soil | LIAYGTLEIAFIVVLVALVGGAGLFALFMLVQLFRNHSRW* |
| Ga0137374_102896722 | 3300012204 | Vadose Zone Soil | MLAFGILEWTFVAVLVLLVGAAGLFALFMVAQLFRNPRRS* |
| Ga0137374_107080042 | 3300012204 | Vadose Zone Soil | GVLEWTFLAVLVLLVGAAALFALFMVAQLFRNPRRS* |
| Ga0137374_108985981 | 3300012204 | Vadose Zone Soil | VLAFGPLEWTFTIVLIVLVGLAGLFALYLILQLFRGH |
| Ga0137374_112279982 | 3300012204 | Vadose Zone Soil | MLAFGPLEWTFTAILIVLVAVAGLFALYLVIQLFRAHSRRT* |
| Ga0137380_100736572 | 3300012206 | Vadose Zone Soil | MVGFGVLEWSFLGALVLLVGAVTAFLLFLLAQLFRIHSRR* |
| Ga0137380_108600692 | 3300012206 | Vadose Zone Soil | VVAYGALEWTFVGILAAMVTAAGFFAVFVVLQLFWNPSR |
| Ga0137380_113754122 | 3300012206 | Vadose Zone Soil | MVAFGPLEWTFVGILVALVGASGLFALFLLAQLFRNPSRRR* |
| Ga0137379_101639553 | 3300012209 | Vadose Zone Soil | MLGFGVLEWTFVAILVLLVGGAGVFALFLLVQLFRNPSRRG* |
| Ga0137379_107527272 | 3300012209 | Vadose Zone Soil | VPFAFGVLEWTFLVILVVLVGAAGVFGLFLVTQLFRTHSRR* |
| Ga0137378_112928652 | 3300012210 | Vadose Zone Soil | MLAFGVLEWSFLAALVVLVGGAGLFGLYVLAQLFRNPRRG* |
| Ga0137387_100076053 | 3300012349 | Vadose Zone Soil | MLAFGKLEWTFVALLVLLVGAAGVFGLFLVVQLFRNPSRRG* |
| Ga0137372_100724015 | 3300012350 | Vadose Zone Soil | VEGEGASKMVAYGALEWSFLAALVILVGGAGVFALFLVLQLFRNPSRRR* |
| Ga0137372_108452191 | 3300012350 | Vadose Zone Soil | MMAFGPLEWTFVGILVALVGAAGLFMLFLLVQLFRNPSRRH* |
| Ga0137366_100386994 | 3300012354 | Vadose Zone Soil | MVAFGPLEWTFVGVLVALVAAAGLFALFLLLQLFRNPSRRH* |
| Ga0137366_109891771 | 3300012354 | Vadose Zone Soil | VVVAFGTLEWTFVGILVALVGAAGMFALFLVVQLFRNPSRR |
| Ga0137369_100079794 | 3300012355 | Vadose Zone Soil | MVAFGVLEWSFVGALAVLVGAAGIFALFLLAQLFRNPTRRAER* |
| Ga0137369_100096176 | 3300012355 | Vadose Zone Soil | MLAFGMLEWTFVAVLVLLVGTAGLFALFMLAQLFRNPRRS* |
| Ga0137369_100711434 | 3300012355 | Vadose Zone Soil | MVGSFGILEWTFLILLVTLVGAAGLFALFLLAQLFRDHARRGSFP* |
| Ga0137371_105403731 | 3300012356 | Vadose Zone Soil | RTSVIAFGVLEWTFLAVLVLLVGTAGLFALFLVVQLFRNPRRS* |
| Ga0137371_105742612 | 3300012356 | Vadose Zone Soil | MMAFGPLEWTFVGILVALVGAAGLFMLFLVVQLFRNPSRRH* |
| Ga0137368_105604612 | 3300012358 | Vadose Zone Soil | VLAFGPLEWTFTIVLIVLIVLVGLAGLFALYLILQLFRGHSRR* |
| Ga0137368_106104151 | 3300012358 | Vadose Zone Soil | MLALGILEWTFVAVLVLLVGAAGLFALFMVAQLFRNPRRS* |
| Ga0137373_100626531 | 3300012532 | Vadose Zone Soil | MLAFGPLEWTFTAILIALVGVAGLFALYLVIQLFRAHSRRT* |
| Ga0137373_102260762 | 3300012532 | Vadose Zone Soil | VVAYGALEWTFVGILAAMVTAAGFFAVFVVLQLFRNPPRKG* |
| Ga0137373_111960642 | 3300012532 | Vadose Zone Soil | MLAFGILEWTFVAVLVLLVGAAGLFALFMLAQLFRNPRRS* |
| Ga0164303_106916161 | 3300012957 | Soil | MLAFGVLEWTFLTLLVLLVGAAGVFALFLVLQLFRNPTSRPRAHR* |
| Ga0120158_102646741 | 3300013772 | Permafrost | MIAFGALQWSFLAALVVLVGAAGVFALFLVLQLFRNPSRR |
| Ga0120125_11553951 | 3300014056 | Permafrost | MIAFGALQWSFLAALVVLVGAAGVVALFLVLQLFRNPSRR* |
| Ga0120170_10306931 | 3300014823 | Permafrost | WIFVALLVGLVGLAGVFGLFLVAQLFRDHGRRPRAHP* |
| Ga0134089_105526221 | 3300015358 | Grasslands Soil | TDVLAAFGLLEWTFVVVLVVLVGAAGVFALFILMQLFRAHSRR* |
| Ga0184610_10892252 | 3300017997 | Groundwater Sediment | MLAYGILEWTFVGVLALLVGATALFGLFVLAQLFRNPRRS |
| Ga0184605_103678602 | 3300018027 | Groundwater Sediment | MLAFGILEWTFLAVLVLLVGAAGLFALFMLAQLFRNPRRS |
| Ga0184605_104006692 | 3300018027 | Groundwater Sediment | MIAFGLLEWMFLVILVLLVGAAGLFGVFLLFQLFQTHSRRG |
| Ga0184608_104642152 | 3300018028 | Groundwater Sediment | MLAFGILEWTFVVALVALVGAAGLFALFIVAQLFRNPRRS |
| Ga0066655_108460172 | 3300018431 | Grasslands Soil | MLTFGPLEWTFTAVLIALVGVAGLFALYLVIQLFRTHSRRT |
| Ga0066667_102510772 | 3300018433 | Grasslands Soil | VAYGALEWTFIGILAAMVTMAGLFAVFVVLQLFRNPSRKG |
| Ga0066667_113612181 | 3300018433 | Grasslands Soil | VLAYGVLQWTFLGVLVLLVGAAGAFALFLVVQLFRDH |
| Ga0066667_117841421 | 3300018433 | Grasslands Soil | PFMLAFGVLEWSFLAALVALVGAAGIFGLYVLMQLFRNPRRKMRAR |
| Ga0066662_117519592 | 3300018468 | Grasslands Soil | MLAFGPLEWTFTAVLIALVGAAGVFALFLIVQLFRAHSRRT |
| Ga0066669_104295682 | 3300018482 | Grasslands Soil | MLAFGVLEWTFLTLLVLLVGAAGVFALFLVLQLFRNPTSRPRAPR |
| Ga0066669_120050981 | 3300018482 | Grasslands Soil | VLAYSALQWSFVVLLVVLVGAAGLFAVFLVAQLFRNPARR |
| Ga0193719_104367392 | 3300021344 | Soil | VLAFGPLEWTFTAVLVLLVGAAGLFALFIVLQFFRSHSRR |
| Ga0207646_104359692 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MLAFGVLEWTFLTLLVLLVGAAGVFAVFLVLQLFRNPTSRPRTPR |
| Ga0207646_106028702 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LVAYGALEWTFIGILAAMVTMAGLFAVFVVLQLFRNPSRKG |
| Ga0209235_12032742 | 3300026296 | Grasslands Soil | SRHMLTFGPLEWTFTAILIALVGVAGLFALYLVIQLFRTHSRRT |
| Ga0209577_101371072 | 3300026552 | Soil | MLAFGVLEWTFLTLLVLLVGAAGVFALFLVLQLFRNPTSRPRTPR |
| Ga0209701_102082432 | 3300027862 | Vadose Zone Soil | VLAFGALEWTFLAILVALVGAAGVFALFLVIQLFRNPSRR |
| Ga0209283_102293531 | 3300027875 | Vadose Zone Soil | LAFGKLEWTFLALLVLLVGAAGVFGLFLVVQLFRNPSRRG |
| Ga0209590_101301252 | 3300027882 | Vadose Zone Soil | MLAFGRLEWTFVSVLILLVGAAGVFAAYLVLQLFRNPPRRS |
| Ga0209590_103005072 | 3300027882 | Vadose Zone Soil | VIAFGILEWTFLAVLVFLVGAAGLFALFLVVQLFRNPRRS |
| Ga0209590_109405112 | 3300027882 | Vadose Zone Soil | MLAFGALEWAFVAILVGLVGAAGVFALYLVIQLFRNPTRNPSRR |
| Ga0307290_101822012 | 3300028791 | Soil | MLAFGILEWTFVVALVVLVGAAGLFALFIVAQLFRNPRRS |
| Ga0307287_104145792 | 3300028796 | Soil | MMAFGILEWTFVGVLVLLVGAAGLFALFMLAQLFRNPRRPWNAR |
| Ga0307302_103022012 | 3300028814 | Soil | MLAFGPLEWTFVVVLVVLVGAAGVFALFLLAQLFRTHSRRA |
| Ga0307310_104780342 | 3300028824 | Soil | FGPLEWTFVIVLILLVGAAGLFGLFLVAQLFRAHSRRA |
| Ga0307312_107184962 | 3300028828 | Soil | VLAFGVLEWTFTVVLVVLVGAAGLFGLYILLQLFRAHSRR |
| Ga0307312_111029381 | 3300028828 | Soil | MLAFGALEWTFLAILVALVGAAGVFALYLVIQLFRNPTRNPSRR |
| Ga0307278_100043495 | 3300028878 | Soil | MMAFGILEWTFVGVLVLLVGAAGVFALFMLAQLFRNPRRP |
| Ga0307277_104027072 | 3300028881 | Soil | MLAFGILEWTFLVALVILVGAAGLFALFIVAQLFRNPRRS |
| Ga0307308_106145111 | 3300028884 | Soil | MVAFGPLEWTFVGILVALVGAAGVFALFLLAQLFRNPS |
| Ga0299907_100354742 | 3300030006 | Soil | VLGYGILEWTFLVILVLLVGAAGVFGLFMVVQLFRNPVRR |
| Ga0247826_111094432 | 3300030336 | Soil | MVADFGALEWSFLIALVALVAAAGVFALFLVVQLFRNPIRRRG |
| Ga0308194_102462232 | 3300031421 | Soil | EIALMLAFGILEWSFLIALVVLVGLAGVFALFLVVQLFRNPSRRV |
| Ga0307471_1021977422 | 3300032180 | Hardwood Forest Soil | LVAYGALEWTFLGILAAMVTMAGLFAVFVVVQLFRNPSRKG |
| Ga0334913_012319_1663_1797 | 3300034172 | Sub-Biocrust Soil | MLAFGLLEWTFLVILVLLVGAAGVFALFLLLQLFQTHSRRTERR |
| ⦗Top⦘ |