| Basic Information | |
|---|---|
| Family ID | F056932 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 137 |
| Average Sequence Length | 43 residues |
| Representative Sequence | AESKCCPFFDFHIDLEREGKLVCLRLTGEEGIKAFIRAEFKVEK |
| Number of Associated Samples | 111 |
| Number of Associated Scaffolds | 137 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 5.11 % |
| % of genes near scaffold ends (potentially truncated) | 93.43 % |
| % of genes from short scaffolds (< 2000 bps) | 89.78 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.701 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (27.007 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.007 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.555 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 12.50% β-sheet: 16.67% Coil/Unstructured: 70.83% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 137 Family Scaffolds |
|---|---|---|
| PF11146 | DUF2905 | 10.22 |
| PF00334 | NDK | 5.84 |
| PF13468 | Glyoxalase_3 | 2.92 |
| PF02517 | Rce1-like | 2.92 |
| PF01545 | Cation_efflux | 2.92 |
| PF01451 | LMWPc | 2.19 |
| PF02629 | CoA_binding | 2.19 |
| PF01773 | Nucleos_tra2_N | 1.46 |
| PF07676 | PD40 | 1.46 |
| PF01497 | Peripla_BP_2 | 1.46 |
| PF00248 | Aldo_ket_red | 1.46 |
| PF13458 | Peripla_BP_6 | 1.46 |
| PF02604 | PhdYeFM_antitox | 1.46 |
| PF01850 | PIN | 1.46 |
| PF04011 | LemA | 1.46 |
| PF02463 | SMC_N | 0.73 |
| PF02195 | ParBc | 0.73 |
| PF03992 | ABM | 0.73 |
| PF12706 | Lactamase_B_2 | 0.73 |
| PF13742 | tRNA_anti_2 | 0.73 |
| PF02749 | QRPTase_N | 0.73 |
| PF02803 | Thiolase_C | 0.73 |
| PF13668 | Ferritin_2 | 0.73 |
| PF07731 | Cu-oxidase_2 | 0.73 |
| PF04916 | Phospholip_B | 0.73 |
| PF12849 | PBP_like_2 | 0.73 |
| PF02518 | HATPase_c | 0.73 |
| PF07690 | MFS_1 | 0.73 |
| PF03473 | MOSC | 0.73 |
| PF13087 | AAA_12 | 0.73 |
| PF03853 | YjeF_N | 0.73 |
| PF02885 | Glycos_trans_3N | 0.73 |
| PF01522 | Polysacc_deac_1 | 0.73 |
| PF13476 | AAA_23 | 0.73 |
| PF00375 | SDF | 0.73 |
| PF01729 | QRPTase_C | 0.73 |
| PF09278 | MerR-DNA-bind | 0.73 |
| PF00034 | Cytochrom_C | 0.73 |
| PF01144 | CoA_trans | 0.73 |
| PF01557 | FAA_hydrolase | 0.73 |
| PF13569 | DUF4132 | 0.73 |
| COG ID | Name | Functional Category | % Frequency in 137 Family Scaffolds |
|---|---|---|---|
| COG0105 | Nucleoside diphosphate kinase | Nucleotide transport and metabolism [F] | 5.84 |
| COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 2.92 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 2.92 |
| COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 2.92 |
| COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 2.92 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 2.92 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 1.46 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 1.46 |
| COG4558 | ABC-type hemin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.46 |
| COG1972 | Nucleoside permease NupC | Nucleotide transport and metabolism [F] | 1.46 |
| COG1704 | Magnetosome formation protein MamQ, lipoprotein antigen LemA family | Cell wall/membrane/envelope biogenesis [M] | 1.46 |
| COG1488 | Nicotinic acid phosphoribosyltransferase | Coenzyme transport and metabolism [H] | 1.46 |
| COG4592 | ABC-type Fe2+-enterobactin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.46 |
| COG4594 | ABC-type Fe3+-citrate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.46 |
| COG0614 | ABC-type Fe3+-hydroxamate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.46 |
| COG4607 | ABC-type enterochelin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.46 |
| COG0157 | Nicotinate-nucleotide pyrophosphorylase | Coenzyme transport and metabolism [H] | 1.46 |
| COG4670 | Acyl CoA:acetate/3-ketoacid CoA transferase | Lipid transport and metabolism [I] | 0.73 |
| COG1788 | Acyl CoA:acetate/3-ketoacid CoA transferase, alpha subunit | Lipid transport and metabolism [I] | 0.73 |
| COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 0.73 |
| COG2057 | Acyl-CoA:acetate/3-ketoacid CoA transferase, beta subunit | Lipid transport and metabolism [I] | 0.73 |
| COG0789 | DNA-binding transcriptional regulator, MerR family | Transcription [K] | 0.73 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.73 |
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 0.73 |
| COG0062 | NAD(P)H-hydrate repair enzyme Nnr, NAD(P)H-hydrate epimerase domain | Nucleotide transport and metabolism [F] | 0.73 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.70 % |
| Unclassified | root | N/A | 7.30 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573000|GPBTN7E01DL09G | Not Available | 515 | Open in IMG/M |
| 3300001174|JGI12679J13547_1007195 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300001593|JGI12635J15846_10374355 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300002558|JGI25385J37094_10018692 | All Organisms → cellular organisms → Bacteria | 2478 | Open in IMG/M |
| 3300002909|JGI25388J43891_1080922 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300002914|JGI25617J43924_10085862 | All Organisms → cellular organisms → Bacteria | 1137 | Open in IMG/M |
| 3300002914|JGI25617J43924_10092322 | All Organisms → cellular organisms → Bacteria | 1089 | Open in IMG/M |
| 3300004080|Ga0062385_10268561 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300004082|Ga0062384_100401718 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 883 | Open in IMG/M |
| 3300004092|Ga0062389_103201789 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300005167|Ga0066672_10082754 | All Organisms → cellular organisms → Bacteria | 1924 | Open in IMG/M |
| 3300005187|Ga0066675_11037659 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300005332|Ga0066388_105526426 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300005468|Ga0070707_102040917 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300005536|Ga0070697_100032708 | All Organisms → cellular organisms → Bacteria | 4187 | Open in IMG/M |
| 3300005536|Ga0070697_100313341 | All Organisms → cellular organisms → Bacteria | 1350 | Open in IMG/M |
| 3300005555|Ga0066692_11031305 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300005557|Ga0066704_10222254 | All Organisms → cellular organisms → Bacteria | 1280 | Open in IMG/M |
| 3300005561|Ga0066699_10767775 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 682 | Open in IMG/M |
| 3300005598|Ga0066706_11310325 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300005602|Ga0070762_10345953 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 947 | Open in IMG/M |
| 3300005602|Ga0070762_10401014 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300005764|Ga0066903_104616986 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 734 | Open in IMG/M |
| 3300006028|Ga0070717_10561138 | Not Available | 1034 | Open in IMG/M |
| 3300006163|Ga0070715_10517636 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300006755|Ga0079222_10067888 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1740 | Open in IMG/M |
| 3300006796|Ga0066665_10504823 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
| 3300006893|Ga0073928_11162410 | Not Available | 521 | Open in IMG/M |
| 3300006904|Ga0075424_102201496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 580 | Open in IMG/M |
| 3300006914|Ga0075436_100780783 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300006954|Ga0079219_12135071 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300007255|Ga0099791_10504982 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
| 3300007258|Ga0099793_10057543 | All Organisms → cellular organisms → Bacteria | 1731 | Open in IMG/M |
| 3300007265|Ga0099794_10457234 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300009012|Ga0066710_103581787 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| 3300009012|Ga0066710_103939862 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300009038|Ga0099829_10489181 | Not Available | 1021 | Open in IMG/M |
| 3300009088|Ga0099830_10279363 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1328 | Open in IMG/M |
| 3300010043|Ga0126380_11927233 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300010048|Ga0126373_11558395 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 726 | Open in IMG/M |
| 3300010336|Ga0134071_10475935 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300010360|Ga0126372_10565662 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
| 3300010366|Ga0126379_10063785 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3105 | Open in IMG/M |
| 3300010379|Ga0136449_103566539 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300011269|Ga0137392_11030459 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 676 | Open in IMG/M |
| 3300011270|Ga0137391_10684571 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
| 3300011271|Ga0137393_10145968 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1971 | Open in IMG/M |
| 3300011271|Ga0137393_11261779 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300012096|Ga0137389_11726303 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300012189|Ga0137388_11197572 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300012202|Ga0137363_10058461 | All Organisms → cellular organisms → Bacteria | 2791 | Open in IMG/M |
| 3300012209|Ga0137379_11569124 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 558 | Open in IMG/M |
| 3300012351|Ga0137386_10089843 | All Organisms → cellular organisms → Bacteria | 2161 | Open in IMG/M |
| 3300012359|Ga0137385_10729975 | Not Available | 826 | Open in IMG/M |
| 3300012359|Ga0137385_11443238 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300012361|Ga0137360_10186072 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1672 | Open in IMG/M |
| 3300012361|Ga0137360_10720960 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300012685|Ga0137397_10000152 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 45691 | Open in IMG/M |
| 3300012918|Ga0137396_10603703 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae | 812 | Open in IMG/M |
| 3300012923|Ga0137359_10378616 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1257 | Open in IMG/M |
| 3300012923|Ga0137359_10815520 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 808 | Open in IMG/M |
| 3300012927|Ga0137416_10258760 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1425 | Open in IMG/M |
| 3300012927|Ga0137416_10658603 | Not Available | 917 | Open in IMG/M |
| 3300012927|Ga0137416_11617252 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 590 | Open in IMG/M |
| 3300012971|Ga0126369_11346898 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 804 | Open in IMG/M |
| 3300012971|Ga0126369_11726521 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 715 | Open in IMG/M |
| 3300014154|Ga0134075_10446978 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
| 3300014165|Ga0181523_10279134 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300015054|Ga0137420_1429687 | Not Available | 4321 | Open in IMG/M |
| 3300015245|Ga0137409_10240202 | All Organisms → cellular organisms → Bacteria | 1613 | Open in IMG/M |
| 3300015373|Ga0132257_101521645 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 854 | Open in IMG/M |
| 3300016294|Ga0182041_11809038 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300017936|Ga0187821_10504063 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300018468|Ga0066662_11861991 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300019789|Ga0137408_1304210 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1257 | Open in IMG/M |
| 3300020582|Ga0210395_10576924 | Not Available | 845 | Open in IMG/M |
| 3300020583|Ga0210401_10598898 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
| 3300021088|Ga0210404_10237680 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| 3300021180|Ga0210396_10192738 | All Organisms → cellular organisms → Bacteria | 1823 | Open in IMG/M |
| 3300021180|Ga0210396_10722369 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300021405|Ga0210387_10598007 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
| 3300021405|Ga0210387_11009742 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 729 | Open in IMG/M |
| 3300021406|Ga0210386_10941839 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 738 | Open in IMG/M |
| 3300021406|Ga0210386_11457900 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300021475|Ga0210392_10696176 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300021479|Ga0210410_10086843 | All Organisms → cellular organisms → Bacteria | 2753 | Open in IMG/M |
| 3300021479|Ga0210410_10469139 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
| 3300021479|Ga0210410_10781070 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300021560|Ga0126371_10514986 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1345 | Open in IMG/M |
| 3300021560|Ga0126371_11335928 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300022840|Ga0224549_1014573 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
| 3300024186|Ga0247688_1006107 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1691 | Open in IMG/M |
| 3300024325|Ga0247678_1054673 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 648 | Open in IMG/M |
| 3300026325|Ga0209152_10350622 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300026331|Ga0209267_1154612 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
| 3300026528|Ga0209378_1020147 | All Organisms → cellular organisms → Bacteria | 3734 | Open in IMG/M |
| 3300026538|Ga0209056_10585570 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300026538|Ga0209056_10701811 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300026547|Ga0209156_10048439 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2273 | Open in IMG/M |
| 3300026548|Ga0209161_10506507 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300027110|Ga0208488_1063095 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300027645|Ga0209117_1003157 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5737 | Open in IMG/M |
| 3300027671|Ga0209588_1130548 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300027671|Ga0209588_1136201 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300027824|Ga0209040_10388862 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300027846|Ga0209180_10063978 | All Organisms → cellular organisms → Bacteria | 2050 | Open in IMG/M |
| 3300027846|Ga0209180_10119584 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1511 | Open in IMG/M |
| 3300027846|Ga0209180_10733954 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300027862|Ga0209701_10167140 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1332 | Open in IMG/M |
| 3300027884|Ga0209275_10797169 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300027889|Ga0209380_10751439 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300027895|Ga0209624_10157871 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1500 | Open in IMG/M |
| 3300027903|Ga0209488_10532105 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 859 | Open in IMG/M |
| 3300028016|Ga0265354_1031184 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300028047|Ga0209526_10561744 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 736 | Open in IMG/M |
| 3300028536|Ga0137415_11017385 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300028536|Ga0137415_11311050 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
| 3300028673|Ga0257175_1107271 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300028792|Ga0307504_10458671 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300028906|Ga0308309_10482468 | Not Available | 1070 | Open in IMG/M |
| 3300030013|Ga0302178_10338240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → Candidatus Frankia nodulisporulans | 684 | Open in IMG/M |
| 3300030687|Ga0302309_10234174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → Candidatus Frankia nodulisporulans | 931 | Open in IMG/M |
| 3300030687|Ga0302309_10377381 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 691 | Open in IMG/M |
| 3300031090|Ga0265760_10095740 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
| 3300031718|Ga0307474_11111192 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300031720|Ga0307469_11626808 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300031753|Ga0307477_10365208 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300031753|Ga0307477_11063322 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300031754|Ga0307475_10076290 | Not Available | 2574 | Open in IMG/M |
| 3300031754|Ga0307475_10123674 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2039 | Open in IMG/M |
| 3300031754|Ga0307475_10710764 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 801 | Open in IMG/M |
| 3300031777|Ga0318543_10218797 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 847 | Open in IMG/M |
| 3300031837|Ga0302315_10114732 | All Organisms → cellular organisms → Bacteria | 1724 | Open in IMG/M |
| 3300031897|Ga0318520_10708451 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
| 3300032180|Ga0307471_100396805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1506 | Open in IMG/M |
| 3300032205|Ga0307472_101193774 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300033134|Ga0335073_11182662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens | 769 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 27.01% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.22% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.57% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.84% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.11% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.38% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.65% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.65% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.92% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.46% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.46% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.46% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.46% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.46% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.73% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.73% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.73% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.73% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.73% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.73% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.73% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.73% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.73% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573000 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms) | Environmental | Open in IMG/M |
| 3300001174 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002909 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022840 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 1-5 | Environmental | Open in IMG/M |
| 3300024186 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK29 | Environmental | Open in IMG/M |
| 3300024325 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK19 | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027110 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF001 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Host-Associated | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030013 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300030687 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_1 | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031837 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| N55_01301850 | 2189573000 | Grass Soil | VLSFFDFHIDLEREGKLLCLRLTGKDGIKPFILAEFHVPPK |
| JGI12679J13547_10071951 | 3300001174 | Forest Soil | DFHIDLEREGTLVCLRLTGGRGIKHFIQSEFQIPAK* |
| JGI12635J15846_103743552 | 3300001593 | Forest Soil | MLADLEREGALLCLRLTGAEGIKAFIRAELQMEAK* |
| JGI25385J37094_100186921 | 3300002558 | Grasslands Soil | CCPFFDFHIDLENEGKLVCLRLTGEEGIKAFIRAEFKVEK* |
| JGI25388J43891_10809221 | 3300002909 | Grasslands Soil | KCCPFFDFHIDVERAGKLLCLRLTGEEGIKAFIRAEFGVEKMR* |
| JGI25617J43924_100858621 | 3300002914 | Grasslands Soil | KCCPFFDFHIDLEREGKLVCLRLTGEEGIKAFIRAELNVEK* |
| JGI25617J43924_100923223 | 3300002914 | Grasslands Soil | AESKCCPFFDFHIDLERGGKLACLRLAGEEGIKAFIRAEFKIENMK* |
| Ga0062385_102685611 | 3300004080 | Bog Forest Soil | WVVAENKCCPFFYFHIDLEKRGRLVCLGLTGPEGVKAFIREEFGVKNGK* |
| Ga0062384_1004017183 | 3300004082 | Bog Forest Soil | GAESKCCSFLDFHIDVEAEGHLLCLRLTGEAGVKAFIRGEFGVKSGG* |
| Ga0062389_1032017892 | 3300004092 | Bog Forest Soil | WVVAENKCCPFFYFHIDLEKRGRLVCLGLTGPEGVKAFIREEFGVKDGK* |
| Ga0066672_100827544 | 3300005167 | Soil | GAESKCCPFFDFHIDVERQGKLLCLRLTGEEVIKAFIRAEFGVEKIR* |
| Ga0066675_110376591 | 3300005187 | Soil | WVEAESKCCPFFDFHIDLEKQGRLVCLRLTGGPNIKAFIRSEFGLKELSPNAK* |
| Ga0066388_1055264262 | 3300005332 | Tropical Forest Soil | AKESKCCPFFDFHIDLEEEGNLLCLRLAGEEGIKSFILSVFAAPR* |
| Ga0070707_1020409172 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VAEGKCCPFFDFHIDLEREGGLLCLRLTGAEGIKAFVRSEFQMGTK* |
| Ga0070697_1000327084 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | KCCPFFDFHIDLEEGGRLLCLRLTGEEGIKEFIRSEFKVTAA* |
| Ga0070697_1003133411 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | KCCPFFDFHIDLEEGGRLLCLRLTGEEGIKEFIRSEFKVSAT* |
| Ga0066692_110313052 | 3300005555 | Soil | GAESKCCPFFDFHIDVERQGKLLCLRLTGEEGIKAFIRAEFGVEKIR* |
| Ga0066704_102222541 | 3300005557 | Soil | AESKCCPFFDFHIDLEREGKLVCLRLTGEEGIKAFIRAEFKVEK* |
| Ga0066699_107677753 | 3300005561 | Soil | AESKCCPFFDFHIDLENEGRLVCLRLTGEEGIKAFIRAEFKIEK* |
| Ga0066706_113103253 | 3300005598 | Soil | AELAEWVVAESKCCPFFDFHIDLEREGKLACLRLTGEEGIKAFIRAEFKIEK* |
| Ga0070762_103459531 | 3300005602 | Soil | FLDFHLDLENEGQLLCLRLTGAPGVKPFIRAEFQVPAK* |
| Ga0070762_104010141 | 3300005602 | Soil | VEAKCCPFFNFHLDLEREGNLVCLGLAGAEGIKTFIRTEFQVPGK* |
| Ga0066903_1046169863 | 3300005764 | Tropical Forest Soil | MLPLFDFHIDLEEEGSLLCLRLTGEEGIKAFIRTEFGVQ* |
| Ga0070717_105611383 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MLCDFGRNLFFDFHIDLEREGGLLCLRLTGEDGIKPFILAEFHVPPK* |
| Ga0070715_105176361 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | PFFDFHIDLEEEGKLVCLRLTGADGIKQFIRGEFGLK* |
| Ga0079222_100678884 | 3300006755 | Agricultural Soil | DFHIDLENEGKLICLRLTGEEGIKQFIRTEFHVQ* |
| Ga0066665_105048232 | 3300006796 | Soil | ADWVLAESKCCSFFDFHIDLENEGKLICLRVTGEEGIKQFIRTEFGVH* |
| Ga0073928_111624101 | 3300006893 | Iron-Sulfur Acid Spring | FHIDLEREGSLLCLRLTGEEGIKPFMRSEFQVPTK* |
| Ga0075424_1022014961 | 3300006904 | Populus Rhizosphere | EGKCCPFFDFHIDLEREGKLLCLRLTGEAGIKAFIRAAFQVPENQQ* |
| Ga0075436_1007807833 | 3300006914 | Populus Rhizosphere | KCCPFFDFHIDLEKEGKLICLRLTGEEGIKQFIRAEFHVQ* |
| Ga0079219_121350712 | 3300006954 | Agricultural Soil | PFFDFHIDLENEGRLVCLRLTGEEGIKQFIRAEFAVR* |
| Ga0099791_105049822 | 3300007255 | Vadose Zone Soil | CPFFDFHIDLEREGALLCLRLTGGEGIKPFIRSEFQVAGK* |
| Ga0099793_100575431 | 3300007258 | Vadose Zone Soil | AAEGKCCQFFDFHIDLERQGTLLCLRLTGEEGIKAFIRAEFQVPVK* |
| Ga0099794_104572341 | 3300007265 | Vadose Zone Soil | KCCPFFDFHIDLEEEGRLLCLRLTGEEGIKAFIRAEFGVEKMK* |
| Ga0066710_1035817872 | 3300009012 | Grasslands Soil | SFFDFHIDLENEGKLICLRVTGKEGIKQFIRTEFGVH |
| Ga0066710_1039398622 | 3300009012 | Grasslands Soil | PFFDFHIDLENEGKLICLRLTGQEGIKQFIRAEFAVQ |
| Ga0099829_104891812 | 3300009038 | Vadose Zone Soil | FFDFHIDLEHEGALLCLRLTGEEGIKAFIRSEFPVTGK* |
| Ga0099830_102793632 | 3300009088 | Vadose Zone Soil | VKAGFPTRPFFDFHIDVEREGKLLCLRLTGEEGIKAFIRAEFRIENAKY* |
| Ga0126380_119272331 | 3300010043 | Tropical Forest Soil | SRCCPFFDFHIDLENEGKLVCLRLTGKEGVKEVIRSEFGLK* |
| Ga0126373_115583952 | 3300010048 | Tropical Forest Soil | CPFFDFHIDLENEGRLVCLRLTGAAGVKQFLRSEFSLP* |
| Ga0134071_104759353 | 3300010336 | Grasslands Soil | AESKCCPFFDFHIDLEREGKLACLRLTGEEGIKAFIRAEFKIEK* |
| Ga0126372_105656623 | 3300010360 | Tropical Forest Soil | VNESKCCPFFDFHIDLENEGKLVCLRLTGEEGIKQFIRAEFNVQ* |
| Ga0126379_100637855 | 3300010366 | Tropical Forest Soil | VAEGKCCPFFDFHIDLEQSGSLLCLRLTGEEGIKAFIRSEFSEAWSSQRQ* |
| Ga0136449_1035665392 | 3300010379 | Peatlands Soil | AELADWSVVESKCCPFFDFHLDLERRGTLLCLRLTGEEGIKAFIRSEFRLTLKS* |
| Ga0137392_110304592 | 3300011269 | Vadose Zone Soil | AAEGKCCPFFDFHIDVEHEGKLLCLRLTGEEGIKPFIRSEFQVPAK* |
| Ga0137391_106845711 | 3300011270 | Vadose Zone Soil | AESKCCPFFDFHIDLEEEGRLLCLRLTGEEGIKAFIRAEFGVEKMK* |
| Ga0137393_101459683 | 3300011271 | Vadose Zone Soil | FDFHIDVEREGHLLCLRLTGEEGIKAFIRAEFKVDVVK* |
| Ga0137393_112617791 | 3300011271 | Vadose Zone Soil | CCPFFDFHIDVEREGRLLCLRLTGEEGIKAFIRAEFGVEK* |
| Ga0137389_117263032 | 3300012096 | Vadose Zone Soil | PFFDFHIDLEREGNLLCLRLTGEAGIKPFIRSEFQIPAK* |
| Ga0137388_111975721 | 3300012189 | Vadose Zone Soil | KCCEFFDFHIDLERRGSLLCLRLTGDEGIKPFIRAEFQVPAK* |
| Ga0137363_100584613 | 3300012202 | Vadose Zone Soil | MLCEFGRNPFFDFHIDLEREGRLLCLRLTGEDGIKLFILAEFHVPPK* |
| Ga0137379_115691242 | 3300012209 | Vadose Zone Soil | CPFFDFHIDLEREGSLLCLRLTGDDGIKAFIRTEFQVAEK* |
| Ga0137386_100898431 | 3300012351 | Vadose Zone Soil | WVAAESKCCPFFDFHIDLEREGRLVCLRLTGEEGIKAFIRAEFKVAK* |
| Ga0137385_107299751 | 3300012359 | Vadose Zone Soil | PFFDFHIDLEGAGSLLCLRLTGEDGIKPFIRAEFQVQVR* |
| Ga0137385_114432382 | 3300012359 | Vadose Zone Soil | FFDFHIDLEREGKLVCLRLTGEEGIKAFIRAECKIENAK* |
| Ga0137360_101860724 | 3300012361 | Vadose Zone Soil | VAEGKCCPFFDFHIDLERAGALLCLRLTGEEGIKAFIRTEFPAAEK* |
| Ga0137360_107209602 | 3300012361 | Vadose Zone Soil | PFFDFHIDLEREGGLLCLRLTGEEGIKPFIRSEFQIPTK* |
| Ga0137397_1000015247 | 3300012685 | Vadose Zone Soil | DWVAAESKCCPFFDFHIDLEREGKLVCLRLTGEEGIKAFIRAEFKIEK* |
| Ga0137396_106037033 | 3300012918 | Vadose Zone Soil | FHIDLEREGSLLCLRLTGEKGVKEFIRTEFEVSAK* |
| Ga0137359_103786162 | 3300012923 | Vadose Zone Soil | VAESKCCPFFDFHIDLEREGTLVCLRLTGSEGVKAFIRAEFGVR* |
| Ga0137359_108155202 | 3300012923 | Vadose Zone Soil | RFFDFHIDLEREGTLLCLRLTGEEGIKPFIRSEFQVPAK* |
| Ga0137416_102587604 | 3300012927 | Vadose Zone Soil | EGKCCPFFDFHIDLERGGELLCLRLTGEEGIKPFIRSEFQVPAN* |
| Ga0137416_106586033 | 3300012927 | Vadose Zone Soil | FHIDLEREGALLCLRLTGEEGIKAFIRSEFPVAGK* |
| Ga0137416_116172521 | 3300012927 | Vadose Zone Soil | ESKCCPFFDFHIDVEREGKLLCLRLTGEEGIKAFIRAEFKVDVVK* |
| Ga0126369_113468982 | 3300012971 | Tropical Forest Soil | ESKCCPFFDFHIDLENEGTLVCLRLTGREGVKQFIRSEFGLK* |
| Ga0126369_117265212 | 3300012971 | Tropical Forest Soil | FDFHIDLENEGKLVCLRLTGEEGIKQFIRAEFRVQ* |
| Ga0134075_104469781 | 3300014154 | Grasslands Soil | ESKCCPFLDFHIDLENEGKLVCLRLTGEEGIKAFIRAEFKVEK* |
| Ga0181523_102791341 | 3300014165 | Bog | ADWVVTEEKCCPFFYFHIDLEKEGTLVCLGLTGQPGIKDVIRAEFQVPGK* |
| Ga0137420_14296872 | 3300015054 | Vadose Zone Soil | VLPFFDFHIDVEREGKLLCLRLTGEEGIKAFIRAEFGVEK* |
| Ga0137409_102402021 | 3300015245 | Vadose Zone Soil | ADWVAAESKCCPFFGFHIDLEDEGKLLCLRLTGEEGVKPFMRAEFLVPPKS* |
| Ga0132257_1015216452 | 3300015373 | Arabidopsis Rhizosphere | FFDFHIDLEREGSLLCLRLTGEDGIKPFIRAEFQVPAK* |
| Ga0182041_118090381 | 3300016294 | Soil | KCCPFFDFHIDLEHEGKLLCLRLTGEEGIKAFIRAEFQLPGKQQ |
| Ga0187821_105040632 | 3300017936 | Freshwater Sediment | VVLESKCCPFFDFHIDLENRGKLVCLRLTGSEGIKAFIRSEFHI |
| Ga0066662_118619911 | 3300018468 | Grasslands Soil | CCPFFDFHIDVEREGKLLCLRLTGEEGIKAFIRAEFGVEKMR |
| Ga0137408_13042103 | 3300019789 | Vadose Zone Soil | AESKCCPFFDFHIDLEEEGRLVCLRLTGAEGIKTFIRSEFGLK |
| Ga0210395_105769241 | 3300020582 | Soil | EWATVEAKCCPFFNFHLDLEREGNLVCLGLAGAEGIKTFIRTEFQVPGK |
| Ga0210401_105988983 | 3300020583 | Soil | AESKCWLFFDFHVDLEGEGSLLCLRLTGEEGIKPFIRAEFQVPVK |
| Ga0210404_102376801 | 3300021088 | Soil | KCCPFFDFHIDLEGEGTLLCLRLTGEEGVKAFIRAEFQVPMK |
| Ga0210396_101927383 | 3300021180 | Soil | CCPFFDFHIDLERDGKRVCLRLTGEEGIKAFIRSEFQVPAK |
| Ga0210396_107223692 | 3300021180 | Soil | GKCCPFFDFRIDLEHEGKLLCLRLTGEEGIKAFIRAEFQVPGKQQ |
| Ga0210387_105980071 | 3300021405 | Soil | TVAAEGKCCPFFDFHIDLEREGKLLCLRLTGEEGIKPFIRSEFQASPK |
| Ga0210387_110097421 | 3300021405 | Soil | PFFDFHIDLENEGKLVCLRLTGAEGIKAFIRAEFGLH |
| Ga0210386_109418391 | 3300021406 | Soil | PFFDFHIDLEREGHLVCLGLSGEEGIKAFIRTEFQVPAK |
| Ga0210386_114579001 | 3300021406 | Soil | FHIDLEKQGTLVCLGLTGAEGIKQFIRSEFWVREQK |
| Ga0210392_106961761 | 3300021475 | Soil | CSFLDFHIDVEAEGNLLCLRLTGAQGVKDFIRSEFSVKNGR |
| Ga0210410_100868431 | 3300021479 | Soil | FDFHIDLEREGKLACLRLTSEEGIKAFIRAEFKIEK |
| Ga0210410_104691391 | 3300021479 | Soil | AESKCCPFFDFHIDLENQGRLACLRLTGSAGIKDFIRSEFHL |
| Ga0210410_107810701 | 3300021479 | Soil | SKCCPFFDFHIDLAREGSLLCLRLAGAEGIKPFIRSEFQVAAK |
| Ga0126371_105149863 | 3300021560 | Tropical Forest Soil | VNESKCCPFFDFHIDLENEGKLICLRLTGEEGIKQFIRAEFGLD |
| Ga0126371_113359281 | 3300021560 | Tropical Forest Soil | SKCCPFFDFHIDLENEGKLVCLRLTGEEGIKQFIRAEFQVRS |
| Ga0224549_10145731 | 3300022840 | Soil | YFHIDLEKEGRLVCLGLTGPEGVKAFIRGEFAVKGGK |
| Ga0247688_10061074 | 3300024186 | Soil | VVAESKCCPFFDFHIDLEKQGRLVCLRLTGGTNIKTFIWSEFGLKKTWPSEQR |
| Ga0247678_10546731 | 3300024325 | Soil | CPFFDFHIDLEKQGRLVCLRLTGGTNIKTFIWSEFGLKKTWPSEQR |
| Ga0209152_103506221 | 3300026325 | Soil | EWVVAESKCCPFFDFHIDLENQGKLACLRLTGEEGIKAFIRAEFKIEK |
| Ga0209267_11546123 | 3300026331 | Soil | ELAQWVVAESKCCPFFDFHIDLENGGKLVCLRLTGEEGIKALIRAEFNIR |
| Ga0209378_10201471 | 3300026528 | Soil | WVVAESKCCPFFDFHIDLENQGKLACLRLTGEEGIKAFIRAEFKIEK |
| Ga0209056_105855702 | 3300026538 | Soil | ESKCCPFFDFHIDLEKQGRLVCLRLTGGTNIKTFIRSEFGLKELSPNAK |
| Ga0209056_107018112 | 3300026538 | Soil | AAEGKCCQFFDFHIDLERQGTLLCLRLTGEEGIKTFIRAEFQVPVK |
| Ga0209156_100484391 | 3300026547 | Soil | KCCPFFDFHIDVERQGKLLCLRLAGEEGIKAFIRAEFGVEKMG |
| Ga0209161_105065071 | 3300026548 | Soil | VAESKCCPFFDFHIDLENQGKLVCLRLTGEEGIKAFIRAEFNIR |
| Ga0208488_10630952 | 3300027110 | Forest Soil | VVAEEKCCPFFNFHIDLEKQGTLVCLGLTGAEGIKQFIRSEFQIPEQK |
| Ga0209117_10031572 | 3300027645 | Forest Soil | MLADLEREGALLCLRLTGAEGIKAFIRAELQMEAK |
| Ga0209588_11305481 | 3300027671 | Vadose Zone Soil | GAESKCCPFFDFHIDLEEEGRLLCLRLTGEEGIKAFIRAEFGVEKMK |
| Ga0209588_11362013 | 3300027671 | Vadose Zone Soil | KCCPFFDFHIDLEEEGRLLCLRLTGEEGIKAFIRAEFGVEKMK |
| Ga0209040_103888621 | 3300027824 | Bog Forest Soil | FDFHIDLERRGGLLCLRLTGAEGVKPFIRSEFRVSAK |
| Ga0209180_100639781 | 3300027846 | Vadose Zone Soil | ESKCCPFFDFHIDVEREGKLLCLRLTGEEGIKAFIRAEFGVEKMR |
| Ga0209180_101195843 | 3300027846 | Vadose Zone Soil | SKCCPFFDFHIDVEREGKLLCLRLTGEEGIKAFIRAEFKLEKTK |
| Ga0209180_107339541 | 3300027846 | Vadose Zone Soil | HIDVEREGKLLCLRLTGEEEIKAFIRAEFGVEKMK |
| Ga0209701_101671402 | 3300027862 | Vadose Zone Soil | VKAGFPTRPFFDFHIDVEREGKLLCLRLTGEEGIKAFIRAEFRIENAKY |
| Ga0209275_107971691 | 3300027884 | Soil | ELAEWATVEAKCCPFFNFHLDLEREGNLVCLGLAGAEGIKTFIRTEFQVPGK |
| Ga0209380_107514392 | 3300027889 | Soil | FHIDLENEGKLLCLRLTGDEGIKAFIQSEFHVPAK |
| Ga0209624_101578711 | 3300027895 | Forest Soil | LAGWVTTEARCCPFFNFHIDLEREGNLVCLGLTGEDGIKAFIRIEFQVPAT |
| Ga0209488_105321051 | 3300027903 | Vadose Zone Soil | KCCPFFDFHIDLEKQGRLVCLRLTGGTNIKTFIRSEFGLKELSPNVK |
| Ga0265354_10311841 | 3300028016 | Rhizosphere | IVELAEWATVEAKCCPFFNFHLDLEKEGNLVCLGLAGAEGIKAFIRTEFQVPGK |
| Ga0209526_105617442 | 3300028047 | Forest Soil | GFHIDLENEGKLLCLRLTGEEGVKAFIRADFLVSSKS |
| Ga0137415_110173853 | 3300028536 | Vadose Zone Soil | AESKCCPFFDFHIDLENQGKLVCLRLTGEEGIKAFMRAEFKIR |
| Ga0137415_113110501 | 3300028536 | Vadose Zone Soil | EGKCCPFFDFHIDLERGGELLCLRLTGEEGIKPFIRSEFQVPAN |
| Ga0257175_11072712 | 3300028673 | Soil | SEGKCCPFFDFHIDLEREGNLLCLRLTGEEGIKPFIRSEFQIPTK |
| Ga0307504_104586713 | 3300028792 | Soil | SKCCPFFDFHIDVEREGRLLCLRLTGEEGIKAFIRAQFSVR |
| Ga0308309_104824682 | 3300028906 | Soil | AEEKCCPFFNFHIDLEREGRLVCLGLGGADGIKPFIRTEFQVPEASDTKH |
| Ga0302178_103382402 | 3300030013 | Palsa | LADWVAAEQKCCPFFDFHIDWEREGTLLCLRLAGMEGVKAFIRMEFRVPAKHAGD |
| Ga0302309_102341741 | 3300030687 | Palsa | IDWEREGTLLCLRLAGMEGVKAFIRMEFQVPAKHAGD |
| Ga0302309_103773811 | 3300030687 | Palsa | SRCCPFLDFHLDLENEGQLLCLRLTGAPGVKPFIRAEFQVPAK |
| Ga0265760_100957402 | 3300031090 | Soil | AEGKCCPFFDFHIDLEREGKLLCLRLAGEEGIKAFIRAEFQVPGKRQ |
| Ga0307474_111111921 | 3300031718 | Hardwood Forest Soil | CCEFFDFHIDLERRGSLLCLRLTGDEGIKPFIRAEFQVPAK |
| Ga0307469_116268081 | 3300031720 | Hardwood Forest Soil | DFHIDLEREGKWACLRLTGEEGIKAFIKAEFKIENAK |
| Ga0307477_103652083 | 3300031753 | Hardwood Forest Soil | VAESKCCPFFDFHIDLEHEGKLACLRLTGEEGIKAFIRAEFKIEK |
| Ga0307477_110633222 | 3300031753 | Hardwood Forest Soil | FFDFHIDLEGEGSLLCLRLTGEEGVKAFIRTEFQLPVK |
| Ga0307475_100762906 | 3300031754 | Hardwood Forest Soil | EGKCCPFFDFHIDLEREGNLLCLRLTGEEGLKPFIRSEFQVPAK |
| Ga0307475_101236741 | 3300031754 | Hardwood Forest Soil | WVVAEGKCCPFFDFHIDLEREGALLCLRLTGEEGIKLFIRAEFQLAAK |
| Ga0307475_107107641 | 3300031754 | Hardwood Forest Soil | FDFHIDLEEQGNLLCLRLTGEEGVKEFIRTEFELGKK |
| Ga0318543_102187972 | 3300031777 | Soil | ESKCCPFFDFHIDLENQRKLICLRLTGEQGIKQFIREEFMLP |
| Ga0302315_101147321 | 3300031837 | Palsa | VVAESKCCPFFYFHIDLEKEGRLVCLGLTGPEGVKAFIRGEFAVKGGK |
| Ga0318520_107084511 | 3300031897 | Soil | KCCPFFDFHIDLEQRGTLACLRLTGAQGIKPFIREEFRVPWR |
| Ga0307471_1003968051 | 3300032180 | Hardwood Forest Soil | AEAKCCPFFDFHIDLEREGALLCLRLTGEEGVKSFIRVEFPLAKK |
| Ga0307472_1011937742 | 3300032205 | Hardwood Forest Soil | PFFDFHIDQERERRLLRLQLTGEEGIKAFIRLEFAVPAR |
| Ga0335073_111826622 | 3300033134 | Soil | VHEAKCCPFFDFHIDLERRGSLICLRLTGAEGIKPIIRSEFGVPAE |
| ⦗Top⦘ |