| Basic Information | |
|---|---|
| Family ID | F056861 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 137 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MVAVLIIAIIAVSYVVSTRIHPLRKCPTCNMSGRHFGGVYKGS |
| Number of Associated Samples | 127 |
| Number of Associated Scaffolds | 137 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.81 % |
| % of genes from short scaffolds (< 2000 bps) | 95.62 % |
| Associated GOLD sequencing projects | 122 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.321 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (18.978 % of family members) |
| Environment Ontology (ENVO) | Unclassified (17.518 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.474 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 26.76% β-sheet: 0.00% Coil/Unstructured: 73.24% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 137 Family Scaffolds |
|---|---|---|
| PF01925 | TauE | 70.80 |
| PF04672 | Methyltransf_19 | 2.19 |
| PF00583 | Acetyltransf_1 | 1.46 |
| PF13490 | zf-HC2 | 0.73 |
| PF00535 | Glycos_transf_2 | 0.73 |
| PF08240 | ADH_N | 0.73 |
| PF02788 | RuBisCO_large_N | 0.73 |
| PF13359 | DDE_Tnp_4 | 0.73 |
| PF13602 | ADH_zinc_N_2 | 0.73 |
| COG ID | Name | Functional Category | % Frequency in 137 Family Scaffolds |
|---|---|---|---|
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 70.80 |
| COG1850 | Ribulose 1,5-bisphosphate carboxylase, large subunit, or a RuBisCO-like protein | Carbohydrate transport and metabolism [G] | 0.73 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.32 % |
| Unclassified | root | N/A | 11.68 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2209111022|2221219039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 701 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100578379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1000 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10022075 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2244 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10433889 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 532 | Open in IMG/M |
| 3300004613|Ga0068937_1109194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 558 | Open in IMG/M |
| 3300005168|Ga0066809_10108692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 686 | Open in IMG/M |
| 3300005176|Ga0066679_10221149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1213 | Open in IMG/M |
| 3300005176|Ga0066679_11016334 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 515 | Open in IMG/M |
| 3300005186|Ga0066676_10765163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 656 | Open in IMG/M |
| 3300005337|Ga0070682_101103100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 664 | Open in IMG/M |
| 3300005563|Ga0068855_101869711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 609 | Open in IMG/M |
| 3300005574|Ga0066694_10381312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 665 | Open in IMG/M |
| 3300005844|Ga0068862_102761298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 502 | Open in IMG/M |
| 3300006028|Ga0070717_11307743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 659 | Open in IMG/M |
| 3300006059|Ga0075017_100787177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 734 | Open in IMG/M |
| 3300006086|Ga0075019_10690975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 645 | Open in IMG/M |
| 3300006102|Ga0075015_100603755 | Not Available | 643 | Open in IMG/M |
| 3300006172|Ga0075018_10499142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 634 | Open in IMG/M |
| 3300006176|Ga0070765_100771197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 909 | Open in IMG/M |
| 3300006176|Ga0070765_101629643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 607 | Open in IMG/M |
| 3300006804|Ga0079221_11044084 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 619 | Open in IMG/M |
| 3300006854|Ga0075425_101655072 | Not Available | 721 | Open in IMG/M |
| 3300009011|Ga0105251_10464416 | Not Available | 588 | Open in IMG/M |
| 3300009090|Ga0099827_11844489 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 527 | Open in IMG/M |
| 3300009092|Ga0105250_10276804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 722 | Open in IMG/M |
| 3300009521|Ga0116222_1397895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 599 | Open in IMG/M |
| 3300009525|Ga0116220_10501955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 551 | Open in IMG/M |
| 3300009665|Ga0116135_1167023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 828 | Open in IMG/M |
| 3300009672|Ga0116215_1014691 | Not Available | 3739 | Open in IMG/M |
| 3300010159|Ga0099796_10552281 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 518 | Open in IMG/M |
| 3300010321|Ga0134067_10373362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 566 | Open in IMG/M |
| 3300010335|Ga0134063_10677584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 531 | Open in IMG/M |
| 3300010341|Ga0074045_10538917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 748 | Open in IMG/M |
| 3300010360|Ga0126372_12985346 | Not Available | 525 | Open in IMG/M |
| 3300010371|Ga0134125_11861515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 654 | Open in IMG/M |
| 3300010375|Ga0105239_13557188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 506 | Open in IMG/M |
| 3300010379|Ga0136449_103900016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 559 | Open in IMG/M |
| 3300010396|Ga0134126_11255352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 822 | Open in IMG/M |
| 3300010398|Ga0126383_13394428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 520 | Open in IMG/M |
| 3300010401|Ga0134121_11578556 | Not Available | 675 | Open in IMG/M |
| 3300011003|Ga0138514_100032575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 994 | Open in IMG/M |
| 3300011107|Ga0151490_1425475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1043 | Open in IMG/M |
| 3300012200|Ga0137382_10796834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 680 | Open in IMG/M |
| 3300012210|Ga0137378_10544437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1069 | Open in IMG/M |
| 3300012477|Ga0157336_1037048 | Not Available | 511 | Open in IMG/M |
| 3300012915|Ga0157302_10271438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 645 | Open in IMG/M |
| 3300012925|Ga0137419_10734435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 803 | Open in IMG/M |
| 3300012958|Ga0164299_10055563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1874 | Open in IMG/M |
| 3300012971|Ga0126369_12954990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 557 | Open in IMG/M |
| 3300012986|Ga0164304_11047251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 649 | Open in IMG/M |
| 3300016270|Ga0182036_10930085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 714 | Open in IMG/M |
| 3300016341|Ga0182035_10216071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1527 | Open in IMG/M |
| 3300016357|Ga0182032_10215434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 1471 | Open in IMG/M |
| 3300016387|Ga0182040_11358532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 601 | Open in IMG/M |
| 3300017657|Ga0134074_1371044 | Not Available | 530 | Open in IMG/M |
| 3300017823|Ga0187818_10373555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 631 | Open in IMG/M |
| 3300017955|Ga0187817_10744135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 625 | Open in IMG/M |
| 3300017959|Ga0187779_10932477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 599 | Open in IMG/M |
| 3300017972|Ga0187781_10471848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 899 | Open in IMG/M |
| 3300017994|Ga0187822_10054000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1136 | Open in IMG/M |
| 3300018034|Ga0187863_10401246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 764 | Open in IMG/M |
| 3300018044|Ga0187890_10876892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 506 | Open in IMG/M |
| 3300018047|Ga0187859_10566510 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 637 | Open in IMG/M |
| 3300018058|Ga0187766_10907251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 622 | Open in IMG/M |
| 3300018085|Ga0187772_10906574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 641 | Open in IMG/M |
| 3300019879|Ga0193723_1154842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 611 | Open in IMG/M |
| 3300020012|Ga0193732_1071585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 572 | Open in IMG/M |
| 3300020082|Ga0206353_11547106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 707 | Open in IMG/M |
| 3300020170|Ga0179594_10176869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 796 | Open in IMG/M |
| 3300020581|Ga0210399_10942558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 698 | Open in IMG/M |
| 3300020582|Ga0210395_10024774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 4408 | Open in IMG/M |
| 3300021171|Ga0210405_10536875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 915 | Open in IMG/M |
| 3300021180|Ga0210396_10435968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1150 | Open in IMG/M |
| 3300021402|Ga0210385_10487231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 934 | Open in IMG/M |
| 3300021402|Ga0210385_11024257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 634 | Open in IMG/M |
| 3300022734|Ga0224571_108762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 690 | Open in IMG/M |
| 3300024254|Ga0247661_1014208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1356 | Open in IMG/M |
| 3300024271|Ga0224564_1137097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 505 | Open in IMG/M |
| 3300025634|Ga0208589_1061403 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 930 | Open in IMG/M |
| 3300025925|Ga0207650_11062363 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 689 | Open in IMG/M |
| 3300025931|Ga0207644_10799551 | Not Available | 789 | Open in IMG/M |
| 3300026078|Ga0207702_12293356 | Not Available | 528 | Open in IMG/M |
| 3300026377|Ga0257171_1037087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 836 | Open in IMG/M |
| 3300026446|Ga0257178_1021357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 773 | Open in IMG/M |
| 3300026911|Ga0209620_1010086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 781 | Open in IMG/M |
| 3300027058|Ga0209111_1006557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1187 | Open in IMG/M |
| 3300027090|Ga0208604_1016146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 709 | Open in IMG/M |
| 3300027110|Ga0208488_1033643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 936 | Open in IMG/M |
| 3300027119|Ga0209522_1011760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 957 | Open in IMG/M |
| 3300027168|Ga0208239_1025255 | Not Available | 578 | Open in IMG/M |
| 3300027652|Ga0209007_1071439 | Not Available | 876 | Open in IMG/M |
| 3300027676|Ga0209333_1023672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 1736 | Open in IMG/M |
| 3300027725|Ga0209178_1387744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 529 | Open in IMG/M |
| 3300027775|Ga0209177_10088048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 962 | Open in IMG/M |
| 3300027775|Ga0209177_10309868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 605 | Open in IMG/M |
| 3300027854|Ga0209517_10731696 | Not Available | 505 | Open in IMG/M |
| 3300027867|Ga0209167_10071244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1738 | Open in IMG/M |
| 3300027908|Ga0209006_10664560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 856 | Open in IMG/M |
| 3300028863|Ga0302218_10162520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 709 | Open in IMG/M |
| 3300028906|Ga0308309_10846919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 794 | Open in IMG/M |
| 3300029636|Ga0222749_10223837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 949 | Open in IMG/M |
| 3300029943|Ga0311340_10511693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1070 | Open in IMG/M |
| 3300030007|Ga0311338_10529930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1228 | Open in IMG/M |
| 3300030509|Ga0302183_10318396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 600 | Open in IMG/M |
| 3300030524|Ga0311357_10622558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 990 | Open in IMG/M |
| 3300030580|Ga0311355_10570110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1073 | Open in IMG/M |
| 3300031027|Ga0302308_10184079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1351 | Open in IMG/M |
| 3300031199|Ga0307495_10265094 | Not Available | 500 | Open in IMG/M |
| 3300031549|Ga0318571_10176913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 751 | Open in IMG/M |
| 3300031682|Ga0318560_10308253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 853 | Open in IMG/M |
| 3300031682|Ga0318560_10713386 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 542 | Open in IMG/M |
| 3300031708|Ga0310686_113612696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 594 | Open in IMG/M |
| 3300031708|Ga0310686_117416149 | Not Available | 749 | Open in IMG/M |
| 3300031715|Ga0307476_10538827 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 865 | Open in IMG/M |
| 3300031715|Ga0307476_10760115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 717 | Open in IMG/M |
| 3300031719|Ga0306917_10070407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2423 | Open in IMG/M |
| 3300031754|Ga0307475_11361703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 548 | Open in IMG/M |
| 3300031763|Ga0318537_10189519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 766 | Open in IMG/M |
| 3300031771|Ga0318546_11332450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 504 | Open in IMG/M |
| 3300031778|Ga0318498_10372275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 636 | Open in IMG/M |
| 3300031781|Ga0318547_10484530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 763 | Open in IMG/M |
| 3300031794|Ga0318503_10270078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 552 | Open in IMG/M |
| 3300031819|Ga0318568_10527397 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 736 | Open in IMG/M |
| 3300031819|Ga0318568_10611792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 678 | Open in IMG/M |
| 3300031819|Ga0318568_11005261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 515 | Open in IMG/M |
| 3300031832|Ga0318499_10256547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 678 | Open in IMG/M |
| 3300031897|Ga0318520_10461979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 781 | Open in IMG/M |
| 3300031954|Ga0306926_12155602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 622 | Open in IMG/M |
| 3300032001|Ga0306922_10219725 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2040 | Open in IMG/M |
| 3300032044|Ga0318558_10055334 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1767 | Open in IMG/M |
| 3300032052|Ga0318506_10444551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 575 | Open in IMG/M |
| 3300032074|Ga0308173_10483409 | Not Available | 1106 | Open in IMG/M |
| 3300032089|Ga0318525_10302116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 822 | Open in IMG/M |
| 3300032261|Ga0306920_100227303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2784 | Open in IMG/M |
| 3300032770|Ga0335085_11681597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 654 | Open in IMG/M |
| 3300032829|Ga0335070_10914234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → Ktedonobacter racemifer | 812 | Open in IMG/M |
| 3300032955|Ga0335076_10781587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 836 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.98% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 8.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.84% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.11% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.38% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.38% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.92% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.92% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.92% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.19% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.19% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.19% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.19% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.19% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.19% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.19% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.46% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.46% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.46% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.46% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.73% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.73% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.73% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.73% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.73% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.73% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.73% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.73% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.73% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.73% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.73% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.73% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.73% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.73% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2209111022 | Grass soil microbial communities from Rothamsted Park, UK - Chitin enrichment | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004613 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 25 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
| 3300011107 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300020012 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s1 | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300022734 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU3 | Host-Associated | Open in IMG/M |
| 3300024254 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02 | Environmental | Open in IMG/M |
| 3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
| 3300025634 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
| 3300026446 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-B | Environmental | Open in IMG/M |
| 3300026911 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027058 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027090 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF016 (SPAdes) | Environmental | Open in IMG/M |
| 3300027110 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF001 (SPAdes) | Environmental | Open in IMG/M |
| 3300027119 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027168 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF037 (SPAdes) | Environmental | Open in IMG/M |
| 3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028863 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300031027 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2222065671 | 2209111022 | Grass Soil | MLAVLIIAILAVSYVVSTRIHPLRKCPTCNMSGRHFGAVYKGTYRRCRRC |
| JGIcombinedJ26739_1005783792 | 3300002245 | Forest Soil | MVALVVIVIVGLSYVVSTRIHPLRKCPTCNMSGRHFGSFYKGSFRPCR |
| JGIcombinedJ51221_100220751 | 3300003505 | Forest Soil | MLVLIVVIIAVGYLVSLRIHPLRKCPRCNMSGRHFGGVFTGSY |
| JGIcombinedJ51221_104338891 | 3300003505 | Forest Soil | MLAVLIIAIVAVSYVVSTRIHPLRKCPTCNMSGRHFGAVYKGTYRRCR |
| Ga0068937_11091942 | 3300004613 | Peatlands Soil | MVVVLVIAIVAVGYIVSTRIHPLRKCPTCNMTGRHFGGIYK |
| Ga0066809_101086921 | 3300005168 | Soil | MVAVLIIAIIAVSYVVSTRIHPLRKCPTCNMSGRHFGGVYKGSYRR |
| Ga0066679_102211492 | 3300005176 | Soil | MSALLVALAVFFGGYLISLRIHPLRRCPVCKMTGRHFGSVF |
| Ga0066679_110163342 | 3300005176 | Soil | MVAVLIIAILAVSYVVSTRIHPLRKCPTCNMSGRHFGAIY |
| Ga0066676_107651631 | 3300005186 | Soil | MVAVLIIAIIAVSYVVSTRIHPLRKCPTCNMSGRHFGGVY |
| Ga0070682_1011031001 | 3300005337 | Corn Rhizosphere | MVAVLIIAAIAVSYVVSTRIHPLRKCPTCNMSGRHFGGVYKGSYRRCRKCS |
| Ga0068855_1018697112 | 3300005563 | Corn Rhizosphere | MVAVLIIAILAVSYVVSTRIHPLRKCPTCNMSGRHF |
| Ga0066694_103813122 | 3300005574 | Soil | MVAVLIIAIIAVSYVVSTRIHPLRKCPTCNMSGRHFG |
| Ga0068862_1027612982 | 3300005844 | Switchgrass Rhizosphere | MVAVLIIAIIAVSYVVSTRIHPLRKCPTCNMSGRHFGG |
| Ga0070717_113077432 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MVLLLVIVIVGVTYIVSTRINPLRKCPSCNMTGRHFGG |
| Ga0075017_1007871772 | 3300006059 | Watersheds | MVLVIIIAIVAVGYAVSTRIHPLRKCPTCNMTGRHFGGVYKGSYRRCRT |
| Ga0075019_106909752 | 3300006086 | Watersheds | MVLVIIIAIVAVGYVVSTRIHPLRKCPTCNMTGRHFGGVYKGSYRRCRTCDGSGRRDR |
| Ga0075015_1006037551 | 3300006102 | Watersheds | MVVVVLIAIVAVGYIVSTRIHPLRKCPTCNMTGRHFGGVYKGSYRRCRTCD |
| Ga0075018_104991422 | 3300006172 | Watersheds | MIMVLIIAIIAVGYIVSTRIHPLRKCPTCNMSGRHF |
| Ga0070765_1007711972 | 3300006176 | Soil | MLVLVIVIIAVGYVVSVRIHPLRKCPRCNMSGRHFGAV |
| Ga0070765_1016296432 | 3300006176 | Soil | MLVLIVVIIAVGYLVSLRIHPLRKCPRCNMSGRHFG |
| Ga0079221_110440842 | 3300006804 | Agricultural Soil | MVLILIIAIIAVSYIVSTRIHPLRKCPTCNMTGRHFGSVYKGGYRRCRT |
| Ga0075425_1016550721 | 3300006854 | Populus Rhizosphere | MVAVFIIAIVAVSYIVSTRIHPLTKCPTCNMSGRHGG |
| Ga0105251_104644161 | 3300009011 | Switchgrass Rhizosphere | MVAVFIIAIVAVSYIVSTRIHPLTKCPTCNMSGRHGGGVYKGS |
| Ga0099827_118444891 | 3300009090 | Vadose Zone Soil | MVAVVIIAIVAVSYIVSTRINPLRKCPTCNMTGRHFGGVYKGGYRRCRRCG |
| Ga0105250_102768041 | 3300009092 | Switchgrass Rhizosphere | MVAVLIIAIIAVSYVVSIRIHPLRKCPTYNMSGRHFGGVYKGS |
| Ga0116222_13978951 | 3300009521 | Peatlands Soil | MVLVIIIAIVAVGYAVSTRIHPLRKCPTCNMTGRHFGGVYKGSYRRCRTCDGSGRRDRV |
| Ga0116220_105019552 | 3300009525 | Peatlands Soil | MVVVIVIAIVAVGYDVSTRIHPLRKCPTCNMTGRHFG |
| Ga0116135_11670232 | 3300009665 | Peatland | MVALVIVVIVGLGYVVSTRIHPLKKCPTCNMTGRHFG |
| Ga0116215_10146911 | 3300009672 | Peatlands Soil | MVVVLVIAIVAVGYIVSTRIHPLRKCPTCNMTGRHFGGVYKGSYRRCRTCDG |
| Ga0099796_105522812 | 3300010159 | Vadose Zone Soil | MVAVLVIAIIAVSYIVSTRIHPLRKCHTCNMTGRHLGSVYKGSF |
| Ga0134067_103733621 | 3300010321 | Grasslands Soil | MVAVLIIAAIAVSYVVSTRIHPLRKCPTCNMSGRHFGG |
| Ga0134063_106775841 | 3300010335 | Grasslands Soil | MVAVLIIAIIAVSYIVSTRIHPLRKCPTCNMSGRHFGSVYKG |
| Ga0074045_105389172 | 3300010341 | Bog Forest Soil | MVVVIVIAIVAVGYAVSTRIHPLRKCPTCNMTGRHFGGV |
| Ga0126372_129853461 | 3300010360 | Tropical Forest Soil | MIMVLIIAIIAVSYIVSTRIHPLRKCPTCNMSGRHFGGVYKDSYRRCR |
| Ga0134125_118615152 | 3300010371 | Terrestrial Soil | MVAVLIIAAIAVSYVVSTRIHPLRKCPTCNMSGRHFGGVYKGSYRRCRKCSGRG |
| Ga0105239_135571881 | 3300010375 | Corn Rhizosphere | MVAVLIIAAIAVSYVVSTRIHPLRKCPTCNMSGRH |
| Ga0136449_1039000161 | 3300010379 | Peatlands Soil | MVLVIIIAIVAVGYAVSTRIHPLRKCPTCNMTGRHFGGVYKGSYRRCRTCDGSG |
| Ga0134126_112553521 | 3300010396 | Terrestrial Soil | MVAVLIIAILAVSYVVSTRIHPLRKCPTCNMSGRHFGA |
| Ga0126383_133944281 | 3300010398 | Tropical Forest Soil | MVLVLIIAIIAVSYIVSTRIHPLRKCPTCNMSGRHFGGVYKGSYRRCR |
| Ga0134121_115785562 | 3300010401 | Terrestrial Soil | MVAILIIAVIAVSYVVSTRIHPLRKCPTCNMSGRHFGGIYKGWYRRCRK* |
| Ga0138514_1000325751 | 3300011003 | Soil | MVAVLIIAIVAVSYVVSTRIHPLRKCPTCNMSGTHFGGIYK |
| Ga0151490_14254752 | 3300011107 | Soil | MVAVLIIAIIAVSYVVSTRIHPLRKCPTCNMSGRHFGGVYKGSY |
| Ga0137382_107968341 | 3300012200 | Vadose Zone Soil | MVAVLIIAIIAVSYVVSTRIHPLRKCPTCNMSGRHFGGVYKGSYRRCR |
| Ga0137378_105444371 | 3300012210 | Vadose Zone Soil | MVAVLIIAIIAVSYVVSTRIHPLRKCPTCNMSGRHFGGVYKGSYR |
| Ga0157336_10370481 | 3300012477 | Arabidopsis Rhizosphere | MVAVLIIAAIAVSYVVSTRIHPLRKCPTCNMSGRHFGGVYKGS |
| Ga0157302_102714381 | 3300012915 | Soil | MVAVLIIAIIAVSYVVSTRIHPLRKCPTCNMSGRHFGGVYKGS |
| Ga0137419_107344351 | 3300012925 | Vadose Zone Soil | MVAVLIIAIIAVSYVVSTRIHPLRKCPTCNMSGRRFGAIYK |
| Ga0164299_100555633 | 3300012958 | Soil | MVAVLIIAVIAVSYVVSTRIHPLRKCPTCNMSGRHFGGVYKGSYRRCRK* |
| Ga0126369_129549902 | 3300012971 | Tropical Forest Soil | MIMVLVIAIIAVSYIVSTRIHPLRKCPTCNMSGRHF |
| Ga0164304_110472512 | 3300012986 | Soil | MVAVLIIAVIAVSYVVSTRIHPLRKCPTCNMSGRHFGGVYKGSYRRCRK |
| Ga0182036_109300851 | 3300016270 | Soil | MIMVLVIAIIAVSYVVSTRIHPLRKCPTCNMSGRHFGGVYKGS |
| Ga0182035_102160711 | 3300016341 | Soil | MVAVVLIAIIAVSYVISTRIHPLRKCPTCNMSGRHFGGVYKGSYRRCRR |
| Ga0182032_102154341 | 3300016357 | Soil | MLILIIVILAVGYLVSLRIHPLRKCPRCNMSGRHFGSVFTG |
| Ga0182040_113585322 | 3300016387 | Soil | MVLVLIIAIIAVSYVVSTRIHPLRKCPTCNMTGRHFGSIYKGGYRRCRTCGG |
| Ga0134074_13710441 | 3300017657 | Grasslands Soil | MVAVLIIAIIAVSYVVSTRIHPLRKCPTCNMSGRHFGGVYKGSYRRCRRCS |
| Ga0187818_103735552 | 3300017823 | Freshwater Sediment | MLILIIVIIAVGYLVSLRIHPLRKCPRCNMSGRHF |
| Ga0187817_107441351 | 3300017955 | Freshwater Sediment | MLILIIVIIAVGYLVSLRIHPLRKCPRCNMSGRHFGAV |
| Ga0187779_109324771 | 3300017959 | Tropical Peatland | MVAVLVIAIIAVGYIVSTRIHPLKKCPTCNMSGRHFG |
| Ga0187781_104718482 | 3300017972 | Tropical Peatland | MLAVLVIAIIAVGYIVSTRIHPLRKCPTCNMTGRHFG |
| Ga0187822_100540002 | 3300017994 | Freshwater Sediment | MVAVLIIAIIAVSYVVSTRIHPLRKCPTCNMSGRHFGGVYKGSYRRCRRC |
| Ga0187863_104012462 | 3300018034 | Peatland | MVAVFIIAIVAVSYIVSTRIHPLTKCPTCNMSGRHSAGVYKRSFRRCRRCAGTGRR |
| Ga0187890_108768921 | 3300018044 | Peatland | MVALLVVVIVGLSYVVSTRIHPLRKCPTCNMSGRHFGSVYKGS |
| Ga0187859_105665101 | 3300018047 | Peatland | MAALVLVVIIGVGYLVSTRIHPLRKCPTCNMTGRHFGSV |
| Ga0187766_109072512 | 3300018058 | Tropical Peatland | MIMVLVIAIIAVSYIVSTRIHPLRKCPTCNMSGRHFGGVYKGS |
| Ga0187772_109065741 | 3300018085 | Tropical Peatland | MGWLILIAVIVLVGYAISTRLHPLKRCRTCKGTGRLFGNIYKGSYRRCAKCEGR |
| Ga0193723_11548421 | 3300019879 | Soil | MVAVLIIAIIAVSYVVSTRIHPLRKCPTCNMSGRRFGGVYKGSYR |
| Ga0193732_10715851 | 3300020012 | Soil | MVAVLIIAIIAVSYVVSTRIHPLRKCPTCNMSGRHFASVYKGSYRRCRRCAG |
| Ga0206353_115471062 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | MVAVLIIAIIAVSYVVSTRIHPLRKCPTCNMSGRHFGGVYK |
| Ga0179594_101768692 | 3300020170 | Vadose Zone Soil | MVAVLIIAILAVSYVVSTRIHPLRKCPTCNMSGRRFGAIY |
| Ga0210399_109425582 | 3300020581 | Soil | MIMVLIIAIIAVGYIVSTRIHPLRKCPTCNMSGRHFGGIYKGSYRRCRR |
| Ga0210395_100247744 | 3300020582 | Soil | MVVVVLIAIVAVGYIVSTRIHPLRKCSTCNMTGRHFGGIYKGSYRRLPDV |
| Ga0210405_105368751 | 3300021171 | Soil | MVAVVLIAIIVVGYIVSTRIHPLKKCPTCNMSGRHFGGV |
| Ga0210396_104359681 | 3300021180 | Soil | MVVVILIAIVAVGYAVSTRIHPLRKCPTCNMTGRH |
| Ga0210385_104872312 | 3300021402 | Soil | MVVVILIAIVAVGYAVSTRIHPLRKCPTCNMTGRHFGGIYKGSYRRCRTCDGS |
| Ga0210385_110242572 | 3300021402 | Soil | VRRNSMVALVIIVLAVASYAVSTRIHPLRKCPTCNSSGRHFASIYR |
| Ga0224571_1087622 | 3300022734 | Rhizosphere | MIVVVLIAIVAVGYIVSTRIHPLRKCSTCNMTGRHFGGVYKGSYRRCRTC |
| Ga0247661_10142081 | 3300024254 | Soil | MVAVLIIAAIAVSYVVSTRIHPLRKCPTCNMSGRHFGGVYKGSYRRC |
| Ga0224564_11370972 | 3300024271 | Soil | MVVVILIAIVAVGYAISTRIHPLRKCPTCNMTGRHFG |
| Ga0208589_10614032 | 3300025634 | Arctic Peat Soil | MVAVVLIVIVGVGYVVSTRIHPLRKCPTCNMTGRHFGGVYKGSYRRCRT |
| Ga0207650_110623632 | 3300025925 | Switchgrass Rhizosphere | MVAVLIIAAIAVSYVVSTRIHPLRKCPTCNMSGRHFGGVYKGSYR |
| Ga0207644_107995512 | 3300025931 | Switchgrass Rhizosphere | MVAVFIIAIVAVSYIVSTRIHPLTKCPTCNMSGRHG |
| Ga0207702_122933562 | 3300026078 | Corn Rhizosphere | MVAVLIIAIVAVSYIVSTRIHPLTKCPTCNMSGRH |
| Ga0257171_10370872 | 3300026377 | Soil | MVAVLVIAIIAVSYVVSTRIHPLRKCPTCNMSGRLF |
| Ga0257178_10213572 | 3300026446 | Soil | MVAVLVIAIIAVSYVVSTRIHPLRKCPTCNMSGRHFGGIYKGSYRRC |
| Ga0209620_10100862 | 3300026911 | Forest Soil | MVAVLIIAAIAVSYVVSTRIHPLRKCPTCNMSGRHFGGIYKGSYRRCRKCS |
| Ga0209111_10065572 | 3300027058 | Forest Soil | MVAVLIIAVIAVSYVVSTRIHPLRKCPTCNMSGRHFG |
| Ga0208604_10161462 | 3300027090 | Forest Soil | MLILVIVIIAVGYLVSLRIHPLRKCPRCNMSGRHFGAVFP |
| Ga0208488_10336432 | 3300027110 | Forest Soil | MVALVVIVIVGLSYVVSTRIHPLRKCPTCNMSGRHFGSFYKGSFRP |
| Ga0209522_10117602 | 3300027119 | Forest Soil | MVAVLIIAVIAVSYVVSTRIHPLRKCPTCNMSGRHFGGIYKGSYRRCRKC |
| Ga0208239_10252552 | 3300027168 | Forest Soil | MVYVLIAIVAGGYLVSLRIHPLRKCPTCKMTGRHFGGVFTNS |
| Ga0209007_10714391 | 3300027652 | Forest Soil | MVLLVIVIVAVGYLVSLRIHPLRKCPTCKMTGRHFGGVFTNSFRP |
| Ga0209333_10236721 | 3300027676 | Forest Soil | MVLLLIVIVAVVYLVSLRIHPLRKCRTCKMTGRHFGGMFTYSMRPCRRCRGSGRRDRLG |
| Ga0209178_13877442 | 3300027725 | Agricultural Soil | MLAVLIIAIVAVSYVVSTRIHPLRKCPTCNMSGRHFGAVYK |
| Ga0209177_100880482 | 3300027775 | Agricultural Soil | MVAVLIIAVIAVSYVVSTRIHPLRKCPTCNMSGRHF |
| Ga0209177_103098681 | 3300027775 | Agricultural Soil | MVAVLIIAAIAVSYVVSTRIHPLRKCPTCNMSGRHFGGVYKGSYRRCRKCSGRGQ |
| Ga0209517_107316962 | 3300027854 | Peatlands Soil | MVAVIIIAIVAVSYIVSTRIHPLRKCPTCNMSGRHFGGVYKGSYRRC |
| Ga0209167_100712443 | 3300027867 | Surface Soil | MLVLIIVIIAVGYLVSLRIHPLRKCPRCNMSGRHYGAF |
| Ga0209006_106645602 | 3300027908 | Forest Soil | MLLVVIAIFAGGYLVSLRIHPLRKCPTCKMTGRHFGDVYKG |
| Ga0302218_101625202 | 3300028863 | Palsa | MVALVVVVIVGLSYVVSTRIHPLRKCPTCNMTGRHFGSVFKGSYRPCRTCSGSG |
| Ga0308309_108469191 | 3300028906 | Soil | MVAVVVIAIVAVSYIVSTRVHPLRKCPTCNMSGRHF |
| Ga0222749_102238371 | 3300029636 | Soil | MLAVLIIAIVAVSYVVSTRIHPLRKCPTCNMSGRHFGAVYKGTYRRCRR |
| Ga0311340_105116931 | 3300029943 | Palsa | MVALVIVVIVGLSYVVSTRIHPLRKCPTCNMTGRHFGGVFKGSY |
| Ga0311338_105299302 | 3300030007 | Palsa | MVALLVVVIVGLSYVVSTRIHPLTKCPTCKMTGRHFGSVYKGSHRPCRT |
| Ga0302183_103183962 | 3300030509 | Palsa | MVALVVVVIVGLGYVVSTRIHPLRKCPTCNMTGRHF |
| Ga0311357_106225581 | 3300030524 | Palsa | MVALVIVVIVGLSYVVSTRIHPLRKCPTCNMTGRHFGGFYKGSFRPCRTCGG |
| Ga0311355_105701102 | 3300030580 | Palsa | MVALVIVVIVGLSYVVSTRIHPLRKCPTCNMTGRHFGG |
| Ga0302308_101840791 | 3300031027 | Palsa | MVVVLIVVLVGLSYVVSTRIHPLRKCPTCNMSGRH |
| Ga0307495_102650941 | 3300031199 | Soil | MVAVLIIAIIAGSYVVSTRIHPLRKCPTCNMSGRHFGGVYKGSYRRCRRCSGRG |
| Ga0318571_101769132 | 3300031549 | Soil | MIMVLVIAIIAVSYIVSTRIHPLRKCPTCNMSGRHFGGVYKGSY |
| Ga0318560_103082531 | 3300031682 | Soil | MVLVLIIAIIAVSYVVSTRIHPLRKCPTCNMTGRHFGGIYK |
| Ga0318560_107133862 | 3300031682 | Soil | MLILVIAVIVVGYLVSLRIHPLRKCHSCNMSGRHFGSVFS |
| Ga0310686_1136126962 | 3300031708 | Soil | MLVLVIVIIAVGYLVSLRIHPLRKCPRCNMSGRHFGAVFPG |
| Ga0310686_1174161492 | 3300031708 | Soil | MVAVILVVIVTYIVSTRIHPLRKCPTCNMTGRHFGGVYKGSFRRCRRCDGTGR |
| Ga0307476_105388272 | 3300031715 | Hardwood Forest Soil | MLILIIVIIAVGYLVSLRIHPLRKCPRCNMSGRHFGAVFP |
| Ga0307476_107601151 | 3300031715 | Hardwood Forest Soil | MLVLIIVIIAVGYLVSLRIHPLRKCPRCNMSGRHFG |
| Ga0306917_100704071 | 3300031719 | Soil | MLILIIVILAVGYLVSLRIHPLRKCPRCNMSGRHF |
| Ga0307475_113617031 | 3300031754 | Hardwood Forest Soil | MLVLIIVIIAVGYLVSLRIHPLRKCPRCNMSGRHFGSFFT |
| Ga0318537_101895191 | 3300031763 | Soil | MIMVLIIAIIAVSYVVSTRIHPLRKCPTCNMTGRHFGSVYKGGYRRC |
| Ga0318546_113324501 | 3300031771 | Soil | MLIFIIVIIAVGYLVSLRIHPLRKCPRCNMSGRHFG |
| Ga0318498_103722751 | 3300031778 | Soil | MIMVLIIAIIAVSYVVSTRIHPLRKCPTCNMTGRHFGSV |
| Ga0318547_104845302 | 3300031781 | Soil | MLILIIVILAVGYLVSLRIHPLRKCPRCNMSGRHFG |
| Ga0318503_102700781 | 3300031794 | Soil | MVLVLIIAIIAVSYVVSTRIHPLRKCPTCNMTGRH |
| Ga0318568_105273971 | 3300031819 | Soil | MIMVLIIAIIAVSYVVSTRIHPLRKCPTCNMTGRHFGSVYKGGYR |
| Ga0318568_106117921 | 3300031819 | Soil | MVLVLIIAIIAVSYVVSTRIHPLRKCPTCNMTGRHFGGIYKGS |
| Ga0318568_110052612 | 3300031819 | Soil | MLILVIAVIVVGYLVSLRIHPLRKCHSCNMSGRHFG |
| Ga0318499_102565472 | 3300031832 | Soil | MIMVLIIAIIAVSYVVSTRIHPLRKCPTCNMTGRHFGSVYKGGYRRCRTCDGTGR |
| Ga0318520_104619791 | 3300031897 | Soil | MVAVVLIAIIAVSYVISTRIHPLRKCPTCNMSGRHFGGVYKGS |
| Ga0306926_121556022 | 3300031954 | Soil | MIVVLAIAIVVVSYMVSTRIHPLRKCPSCNMTGRHFGSFYK |
| Ga0306922_102197253 | 3300032001 | Soil | MLIFIIVIIAVGYLVSLRIHPLRKCPRCNMSGRHFGSVFT |
| Ga0318558_100553343 | 3300032044 | Soil | MLILIIVIIAVGYLVSLRIHPLRKCPRCNMSGRHFGSV |
| Ga0318506_104445512 | 3300032052 | Soil | MLILIIVILAVGYLVSLRIHPLRKCPRCNMSGRHFGSVFT |
| Ga0308173_104834092 | 3300032074 | Soil | MVAVFIIAIVAVSYIVSTRIHPLTKCPTCNMSGRHGGGVYKGSFRRCRKCAGSGRRDRV |
| Ga0318525_103021162 | 3300032089 | Soil | MVAVVLIAIIAVSYVISTRIHPLRKCPTCNMSGRHFGGVYKGSY |
| Ga0306920_1002273035 | 3300032261 | Soil | MLILIIVIIAVGYLVSLRIHPLRKCTRCNMSGRHFG |
| Ga0335085_116815971 | 3300032770 | Soil | MIMVLIIAIIAVSYIVSTRIHPLRKCPTCNMSGRHFGGIYKGSYRRCRR |
| Ga0335070_109142341 | 3300032829 | Soil | MVAVLIIAIIAVSYIVSTRIHPLTKCPTCNMSGRHAGGVYKGSFRRCRKCAGSGRRDRVG |
| Ga0335076_107815872 | 3300032955 | Soil | MLVLIIVIIAVGYLVSLRLHPLRKCPTCNMSGRHYG |
| ⦗Top⦘ |