| Basic Information | |
|---|---|
| Family ID | F056851 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 137 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MRYLRIALLLLAVTFGTQACILPVPVGGGWHHHHGWR |
| Number of Associated Samples | 102 |
| Number of Associated Scaffolds | 137 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 84.91 % |
| % of genes near scaffold ends (potentially truncated) | 16.06 % |
| % of genes from short scaffolds (< 2000 bps) | 57.66 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (56.204 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (19.708 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.117 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (41.606 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 30.77% β-sheet: 0.00% Coil/Unstructured: 69.23% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 137 Family Scaffolds |
|---|---|---|
| PF04392 | ABC_sub_bind | 7.30 |
| PF00072 | Response_reg | 5.84 |
| PF03892 | NapB | 5.11 |
| PF02538 | Hydantoinase_B | 3.65 |
| PF02128 | Peptidase_M36 | 2.92 |
| PF00496 | SBP_bac_5 | 2.19 |
| PF02502 | LacAB_rpiB | 1.46 |
| PF00378 | ECH_1 | 1.46 |
| PF13511 | DUF4124 | 1.46 |
| PF13683 | rve_3 | 0.73 |
| PF13419 | HAD_2 | 0.73 |
| PF12172 | DUF35_N | 0.73 |
| PF12697 | Abhydrolase_6 | 0.73 |
| PF07690 | MFS_1 | 0.73 |
| PF09360 | zf-CDGSH | 0.73 |
| PF01068 | DNA_ligase_A_M | 0.73 |
| PF03773 | ArsP_1 | 0.73 |
| PF13193 | AMP-binding_C | 0.73 |
| PF12867 | DinB_2 | 0.73 |
| PF03949 | Malic_M | 0.73 |
| PF10771 | DUF2582 | 0.73 |
| PF07589 | PEP-CTERM | 0.73 |
| PF14595 | Thioredoxin_9 | 0.73 |
| PF06305 | LapA_dom | 0.73 |
| PF02522 | Antibiotic_NAT | 0.73 |
| PF05992 | SbmA_BacA | 0.73 |
| PF10851 | DUF2652 | 0.73 |
| PF04972 | BON | 0.73 |
| PF01339 | CheB_methylest | 0.73 |
| PF00535 | Glycos_transf_2 | 0.73 |
| PF03060 | NMO | 0.73 |
| PF05685 | Uma2 | 0.73 |
| PF05598 | DUF772 | 0.73 |
| PF13091 | PLDc_2 | 0.73 |
| COG ID | Name | Functional Category | % Frequency in 137 Family Scaffolds |
|---|---|---|---|
| COG0146 | N-methylhydantoinase B/oxoprolinase/acetone carboxylase, alpha subunit | Amino acid transport and metabolism [E] | 7.30 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 7.30 |
| COG3043 | Nitrate reductase cytochrome c-type subunit NapB | Energy production and conversion [C] | 5.11 |
| COG0698 | Ribose 5-phosphate isomerase RpiB | Carbohydrate transport and metabolism [G] | 1.46 |
| COG2201 | Chemotaxis response regulator CheB, contains REC and protein-glutamate methylesterase domains | Signal transduction mechanisms [T] | 1.46 |
| COG0281 | Malic enzyme | Energy production and conversion [C] | 0.73 |
| COG0516 | IMP dehydrogenase/GMP reductase | Nucleotide transport and metabolism [F] | 0.73 |
| COG0686 | Alanine dehydrogenase (includes sporulation protein SpoVN) | Amino acid transport and metabolism [E] | 0.73 |
| COG0701 | Uncharacterized membrane protein YraQ, UPF0718 family | Function unknown [S] | 0.73 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.73 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.73 |
| COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 0.73 |
| COG2746 | Aminoglycoside N3'-acetyltransferase | Defense mechanisms [V] | 0.73 |
| COG3771 | Lipopolysaccharide assembly protein YciS/LapA, DUF1049 family | Cell wall/membrane/envelope biogenesis [M] | 0.73 |
| COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 0.73 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 56.20 % |
| All Organisms | root | All Organisms | 43.80 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004114|Ga0062593_100311213 | Not Available | 1349 | Open in IMG/M |
| 3300004156|Ga0062589_100077337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2012 | Open in IMG/M |
| 3300005434|Ga0070709_11093649 | Not Available | 637 | Open in IMG/M |
| 3300005434|Ga0070709_11120044 | Not Available | 630 | Open in IMG/M |
| 3300005440|Ga0070705_100081858 | All Organisms → cellular organisms → Bacteria | 1985 | Open in IMG/M |
| 3300005445|Ga0070708_100483261 | Not Available | 1168 | Open in IMG/M |
| 3300005471|Ga0070698_101562498 | Not Available | 611 | Open in IMG/M |
| 3300005518|Ga0070699_100145413 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2094 | Open in IMG/M |
| 3300005518|Ga0070699_101135115 | Not Available | 717 | Open in IMG/M |
| 3300005536|Ga0070697_100130081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2111 | Open in IMG/M |
| 3300005542|Ga0070732_10985333 | Not Available | 515 | Open in IMG/M |
| 3300005921|Ga0070766_10986027 | Not Available | 579 | Open in IMG/M |
| 3300006047|Ga0075024_100497482 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300006049|Ga0075417_10462337 | Not Available | 634 | Open in IMG/M |
| 3300006057|Ga0075026_100278525 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
| 3300006173|Ga0070716_100255993 | Not Available | 1195 | Open in IMG/M |
| 3300006755|Ga0079222_10112477 | Not Available | 1462 | Open in IMG/M |
| 3300006755|Ga0079222_10231742 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
| 3300006806|Ga0079220_10900916 | Not Available | 686 | Open in IMG/M |
| 3300006806|Ga0079220_11020920 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 659 | Open in IMG/M |
| 3300006854|Ga0075425_100453261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 1477 | Open in IMG/M |
| 3300006903|Ga0075426_10003018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 12019 | Open in IMG/M |
| 3300006954|Ga0079219_11567666 | Not Available | 601 | Open in IMG/M |
| 3300007255|Ga0099791_10151360 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
| 3300009038|Ga0099829_10443308 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1076 | Open in IMG/M |
| 3300009089|Ga0099828_10879027 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 801 | Open in IMG/M |
| 3300009162|Ga0075423_10403016 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1436 | Open in IMG/M |
| 3300009162|Ga0075423_13106181 | Not Available | 509 | Open in IMG/M |
| 3300010358|Ga0126370_10398172 | Not Available | 1130 | Open in IMG/M |
| 3300010359|Ga0126376_10073691 | All Organisms → cellular organisms → Bacteria | 2509 | Open in IMG/M |
| 3300011269|Ga0137392_10809262 | Not Available | 774 | Open in IMG/M |
| 3300012202|Ga0137363_10085245 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2363 | Open in IMG/M |
| 3300012202|Ga0137363_11457698 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
| 3300012202|Ga0137363_11700699 | Not Available | 523 | Open in IMG/M |
| 3300012207|Ga0137381_10374122 | Not Available | 1242 | Open in IMG/M |
| 3300012208|Ga0137376_10061605 | All Organisms → cellular organisms → Bacteria | 3096 | Open in IMG/M |
| 3300012361|Ga0137360_10019919 | All Organisms → cellular organisms → Bacteria | 4461 | Open in IMG/M |
| 3300012362|Ga0137361_10141601 | All Organisms → cellular organisms → Bacteria | 2141 | Open in IMG/M |
| 3300012918|Ga0137396_10452914 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
| 3300012918|Ga0137396_10478746 | Not Available | 923 | Open in IMG/M |
| 3300012923|Ga0137359_10154137 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2049 | Open in IMG/M |
| 3300012929|Ga0137404_10055886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 3045 | Open in IMG/M |
| 3300012931|Ga0153915_10054918 | All Organisms → cellular organisms → Bacteria | 4096 | Open in IMG/M |
| 3300012944|Ga0137410_10818025 | Not Available | 783 | Open in IMG/M |
| 3300015241|Ga0137418_10057441 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3566 | Open in IMG/M |
| 3300015254|Ga0180089_1104205 | Not Available | 589 | Open in IMG/M |
| 3300017927|Ga0187824_10003721 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4158 | Open in IMG/M |
| 3300017930|Ga0187825_10082443 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1104 | Open in IMG/M |
| 3300017930|Ga0187825_10117912 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300017959|Ga0187779_10181552 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1310 | Open in IMG/M |
| 3300017993|Ga0187823_10075316 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 970 | Open in IMG/M |
| 3300017993|Ga0187823_10125775 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300017994|Ga0187822_10084638 | Not Available | 946 | Open in IMG/M |
| 3300018060|Ga0187765_10394212 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 853 | Open in IMG/M |
| 3300018075|Ga0184632_10039653 | Not Available | 2024 | Open in IMG/M |
| 3300018429|Ga0190272_11234971 | Not Available | 737 | Open in IMG/M |
| 3300018429|Ga0190272_12490946 | Not Available | 563 | Open in IMG/M |
| 3300019789|Ga0137408_1212653 | All Organisms → cellular organisms → Bacteria | 1474 | Open in IMG/M |
| 3300019877|Ga0193722_1045223 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1122 | Open in IMG/M |
| 3300019877|Ga0193722_1071517 | Not Available | 860 | Open in IMG/M |
| 3300019879|Ga0193723_1041707 | Not Available | 1362 | Open in IMG/M |
| 3300019886|Ga0193727_1027916 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1955 | Open in IMG/M |
| 3300019887|Ga0193729_1017696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3123 | Open in IMG/M |
| 3300019997|Ga0193711_1029894 | Not Available | 683 | Open in IMG/M |
| 3300020004|Ga0193755_1094153 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
| 3300020021|Ga0193726_1059538 | All Organisms → cellular organisms → Bacteria | 1801 | Open in IMG/M |
| 3300020021|Ga0193726_1076090 | Not Available | 1553 | Open in IMG/M |
| 3300020579|Ga0210407_10023989 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 4537 | Open in IMG/M |
| 3300020579|Ga0210407_10183105 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1624 | Open in IMG/M |
| 3300020581|Ga0210399_10039267 | All Organisms → cellular organisms → Bacteria | 3790 | Open in IMG/M |
| 3300021088|Ga0210404_10000986 | All Organisms → cellular organisms → Bacteria | 12820 | Open in IMG/M |
| 3300021088|Ga0210404_10732740 | Not Available | 564 | Open in IMG/M |
| 3300021432|Ga0210384_10004639 | All Organisms → cellular organisms → Bacteria | 15268 | Open in IMG/M |
| 3300021432|Ga0210384_10060309 | Not Available | 3429 | Open in IMG/M |
| 3300025904|Ga0207647_10469393 | Not Available | 704 | Open in IMG/M |
| 3300025907|Ga0207645_10031211 | All Organisms → cellular organisms → Bacteria | 3430 | Open in IMG/M |
| 3300025910|Ga0207684_10013713 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6999 | Open in IMG/M |
| 3300025910|Ga0207684_10591040 | Not Available | 948 | Open in IMG/M |
| 3300025910|Ga0207684_11241951 | Not Available | 615 | Open in IMG/M |
| 3300025922|Ga0207646_11076620 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300026285|Ga0209438_1065055 | Not Available | 1197 | Open in IMG/M |
| 3300026285|Ga0209438_1084436 | Not Available | 1008 | Open in IMG/M |
| 3300026359|Ga0257163_1012616 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1281 | Open in IMG/M |
| 3300026498|Ga0257156_1135345 | Not Available | 513 | Open in IMG/M |
| 3300026557|Ga0179587_10147284 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1465 | Open in IMG/M |
| 3300027583|Ga0209527_1003620 | All Organisms → cellular organisms → Bacteria | 3122 | Open in IMG/M |
| 3300027605|Ga0209329_1121234 | Not Available | 575 | Open in IMG/M |
| 3300027655|Ga0209388_1023285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas oleivorans | 1747 | Open in IMG/M |
| 3300027787|Ga0209074_10113024 | Not Available | 933 | Open in IMG/M |
| 3300027915|Ga0209069_10471461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 701 | Open in IMG/M |
| 3300028047|Ga0209526_10050034 | All Organisms → cellular organisms → Bacteria | 2943 | Open in IMG/M |
| 3300028047|Ga0209526_10476656 | Not Available | 817 | Open in IMG/M |
| 3300028792|Ga0307504_10193705 | Not Available | 716 | Open in IMG/M |
| 3300028828|Ga0307312_10482294 | Not Available | 818 | Open in IMG/M |
| 3300030990|Ga0308178_1123492 | Not Available | 572 | Open in IMG/M |
| (restricted) 3300031197|Ga0255310_10031193 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1379 | Open in IMG/M |
| (restricted) 3300031248|Ga0255312_1024478 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1440 | Open in IMG/M |
| (restricted) 3300031248|Ga0255312_1098083 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300031720|Ga0307469_10674092 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 934 | Open in IMG/M |
| 3300031720|Ga0307469_10964669 | Not Available | 794 | Open in IMG/M |
| 3300031820|Ga0307473_10049084 | All Organisms → cellular organisms → Bacteria | 1985 | Open in IMG/M |
| 3300033432|Ga0326729_1015847 | Not Available | 1269 | Open in IMG/M |
| 3300033433|Ga0326726_10017859 | All Organisms → cellular organisms → Bacteria | 6177 | Open in IMG/M |
| 3300033433|Ga0326726_10647980 | Not Available | 1017 | Open in IMG/M |
| 3300033513|Ga0316628_100154605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2690 | Open in IMG/M |
| 3300034090|Ga0326723_0130438 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 19.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 13.87% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 11.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.03% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.11% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.38% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.38% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 4.38% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.65% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.19% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.19% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.19% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 2.19% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.46% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.46% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.46% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.73% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.73% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.73% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.73% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.73% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.73% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.73% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.73% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.73% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.73% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300015085 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4B, Ice margin, adjacent to proglacial lake) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015254 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT860_16_10D | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019866 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m1 | Environmental | Open in IMG/M |
| 3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300019997 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3m2 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020061 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c1 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026359 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-A | Environmental | Open in IMG/M |
| 3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300030990 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031197 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 | Environmental | Open in IMG/M |
| 3300031248 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300033432 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF6AY SIP fraction | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062593_1003112131 | 3300004114 | Soil | MRYLTIWLLLLAVTVGTQACIFVPVGGGGGGHRHHRYDGQR* |
| Ga0062589_1000773373 | 3300004156 | Soil | MRCMRIVLLLLAVTIGTQACIFVPVPVGGGGHGGHRHHDDWRR* |
| Ga0062595_1022517842 | 3300004479 | Soil | MVEEVPLRYVKIVLLLLAVTFGAQACILPVPVGGGWHHHHGWR* |
| Ga0070709_110936491 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MRYLKIVLLLLGVTVGTQACIIPIPVGGGGGHRHHRDDWR* |
| Ga0070709_111200441 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MHYLRIAVLLLAVTFVTQACIFVPVPVGGGGGHHHRHRDD |
| Ga0070705_1000818582 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MHYLRIAVLLLAVSFVTQACIFVPVPVGGGGGYHNRHRDDWR* |
| Ga0070708_1004832612 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MRYLRVALLLFAVTFVAQACIFVPVPVGGGGGHHRRHYDDWR* |
| Ga0070707_1001896971 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | GRLIGEEVRYALLRIALLLLAVTFGTQACILPVPVGGGWHHHHGWR* |
| Ga0070698_1015624982 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MRYLKIALLLLAVTVGTQACIFVPVPVGGGGGHHHRHYDEWR* |
| Ga0070699_1001454134 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MRYLRVALLLLAVTFGTQACIFVPVPVGGGGGHHHHGWR* |
| Ga0070699_1011351151 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | RYLKIVLLLLGVTVGTQACIIPIPVGGGGGHRHHRDDWR* |
| Ga0070697_1001300811 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MRYLRVALLLLAVTFGTQACIFVPVPVGGGGGHHHRNHDDWR* |
| Ga0070732_109853332 | 3300005542 | Surface Soil | MRYLKIVMLLLAVTVGTQACIIPVPIGGGDGGHHRRHHDW* |
| Ga0066704_100649642 | 3300005557 | Soil | MRYLKIGLLLPAVTFGTQACILPVPVGGGWHHHHGWR* |
| Ga0070766_109860273 | 3300005921 | Soil | MRYVKIVLLLLAVTVGTQACFVIVGPERGWHHGWR* |
| Ga0075023_1001127013 | 3300006041 | Watersheds | MRYLKIGLLLLAVTFGTQACILLVPVGGGGHHHHGWR* |
| Ga0075024_1004974822 | 3300006047 | Watersheds | LRIALLLLAVTVGTQACIVPVPVGPGWPHHHGWR* |
| Ga0075417_100463312 | 3300006049 | Populus Rhizosphere | MRYVKIVLLLLAVTFGAQACILPVPVGGGWHHHHGWR* |
| Ga0075417_104623372 | 3300006049 | Populus Rhizosphere | MRYLRIVLLLLAVTVGTHACIFVPVPVGGGGGHRHHRDDWR* |
| Ga0075026_1002785252 | 3300006057 | Watersheds | RRCALMRYLKIVMLLLAVTVGTQACIIPVPIGGGDGGHNHHRHDW* |
| Ga0075018_107922102 | 3300006172 | Watersheds | RCPMRYLKIGLLLLAVTFGTQACILLVPVGGGGHHHHGWR* |
| Ga0070716_1002559933 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MHYLRIAVLLLAVSFVTQACIFVPVPVGGGGGYHHRHRD |
| Ga0070712_1007948713 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VSWSRRCPMRYVKIVLLLLAVTFGTQACILPVPVGGGWHHHHGWR* |
| Ga0079222_101124773 | 3300006755 | Agricultural Soil | MRYLKIVLLLLGVTVGTQACIIPIPVGGGGGHRHHHDEWR* |
| Ga0079222_102317421 | 3300006755 | Agricultural Soil | MRYLRIALLLLAVAIVTQSCIFVPVPVDGGGHHHRHRDDWR* |
| Ga0079220_109009161 | 3300006806 | Agricultural Soil | IMRYLRIALLLLAVTVGTQACIVPIPVGPGWHHHRDWR* |
| Ga0079220_110209202 | 3300006806 | Agricultural Soil | MRYLRILLLLLAVTIGTQACIFVPVPVGGGGGHRHHRDWH* |
| Ga0075425_1004532611 | 3300006854 | Populus Rhizosphere | MRYLRIALLLLAVTIVTQSCIFVPVPVDGGGHHHRHRDDWR* |
| Ga0075425_1008879022 | 3300006854 | Populus Rhizosphere | MRYVKIVLLLLAVTFGTQACILPVPVGGGWHHHHGWR* |
| Ga0075426_1000301811 | 3300006903 | Populus Rhizosphere | MRYLRIALLLLAVTIVTQSCIFVPVPVDGGGDHHRHRDDWR* |
| Ga0079219_115676661 | 3300006954 | Agricultural Soil | MRYLKIAMLLLAVAVGAQACIIPVPVGGGGGHHHH |
| Ga0099791_100076922 | 3300007255 | Vadose Zone Soil | MRYLRIALLLLAVTFGTQACILPVPVGGGWHYHHHDWR* |
| Ga0099791_101513602 | 3300007255 | Vadose Zone Soil | MRFLKIVLLLLGVTVGTQACIIPVPVGGGGGGHRHHHDDWR* |
| Ga0099791_103368222 | 3300007255 | Vadose Zone Soil | MRYLKIGLLLLAVTFGTQACILPVGGGWHHHHGWR* |
| Ga0099829_104433082 | 3300009038 | Vadose Zone Soil | MRYLKIGLLLLAVTFGTQACILPVPVGGGWHHHHGWR* |
| Ga0099828_108790271 | 3300009089 | Vadose Zone Soil | MRYLRIVLLLLTVTVGTQACFFVVGPDRGGHHHHGWR |
| Ga0099827_103872422 | 3300009090 | Vadose Zone Soil | MRYLKIGLLLLAVTFGTQACILPVPVGDGWHHHHGWR* |
| Ga0075423_104030164 | 3300009162 | Populus Rhizosphere | MSTMRYLKIVLLLLGVTVGTQACIIPIPVGGGGGHRHHRDDWR* |
| Ga0075423_131061812 | 3300009162 | Populus Rhizosphere | ASTMRYLKIVLLLLGVTVGTQACIIPIPVGGGGGHRHHHDEWR* |
| Ga0126370_103981721 | 3300010358 | Tropical Forest Soil | MRYLRIVLLLLAVTIGTQACFVVVGPDRGWHHHHGW |
| Ga0126376_100736912 | 3300010359 | Tropical Forest Soil | MRYLRIVLLLLAVTIGTQACFVVVGPDRGWHHHHGWR* |
| Ga0137392_108092622 | 3300011269 | Vadose Zone Soil | MRYLTIVVLLLAVTFGTQACIFVPVPVGGGGGHHHRLHDDWR* |
| Ga0137388_102360864 | 3300012189 | Vadose Zone Soil | MRYLRIALLLLAVTFGTQACILPVPVGDGWHHHHGWR* |
| Ga0137363_100852451 | 3300012202 | Vadose Zone Soil | MRYLRIALLLLAVTFVTQACIFVPVPVDGGGHHHRHRDDWR* |
| Ga0137363_114576982 | 3300012202 | Vadose Zone Soil | YLRIALLLLAVTFVTQACIFVPVPVDGGGHHHRHRDDWR* |
| Ga0137363_117006992 | 3300012202 | Vadose Zone Soil | TSEEVTTMRYLKIVLLLLGVTVATQACIIPVPVGGGGGHRRHHDDWR* |
| Ga0137381_103741223 | 3300012207 | Vadose Zone Soil | MRYLRIVLLLLAVTVSTHACIFVPVPVGGGGGHRHHHRDDWR* |
| Ga0137376_100616053 | 3300012208 | Vadose Zone Soil | MRYLKILMLLLAVTVGTQACIIPVPIGGGDGGRHHHRHDW* |
| Ga0137360_100199191 | 3300012361 | Vadose Zone Soil | MSYLKIVLLLLGVTVATQACIIPVPVGGGGGHRRHHDDWR* |
| Ga0137361_101416013 | 3300012362 | Vadose Zone Soil | MRYLRVAVLLLAVTFVAQACIFVPVPVGGGGGHHRRHYDDWR* |
| Ga0137397_100901684 | 3300012685 | Vadose Zone Soil | MRYLRIALLLLAVTFGAQACIFPVPVGPGWHHHHGWRR* |
| Ga0137396_104529143 | 3300012918 | Vadose Zone Soil | TSEEVTTMRFLKIVLLLLGVTVATQACIIPVPVGGGGGHRHHHDEWR* |
| Ga0137396_104787463 | 3300012918 | Vadose Zone Soil | MRYLKIGLLLLAVTFGTQACILPVPVGGGWHYHHHDWR* |
| Ga0137359_101541371 | 3300012923 | Vadose Zone Soil | MRYLKIVLLLLGVTVGTQACIIPVPVGGGGGHRHHHDDWR* |
| Ga0137404_100558865 | 3300012929 | Vadose Zone Soil | MRYLRIVLLLLVVSVGTQACIVPIPVGPGGGHRHHHDHWR* |
| Ga0153915_100549187 | 3300012931 | Freshwater Wetlands | MRYLRILLLLLAVTIGTQACIFIPVGGGGGHRHHHGWH* |
| Ga0153915_113082322 | 3300012931 | Freshwater Wetlands | MRYLRIALLLLAVTLGTQACIVPVPVGPGWHHHHGWR* |
| Ga0137410_108180252 | 3300012944 | Vadose Zone Soil | MRFLKIVLLLLGVTVGTQTCIIPVPIGGGGDGHRHHHDDWR* |
| Ga0157378_107898851 | 3300013297 | Miscanthus Rhizosphere | MMRYLKIGLLLLTVIFGAQACILPVPVGAGWHNHHRHGW* |
| Ga0182008_100524025 | 3300014497 | Rhizosphere | YLKIGLLLLTVIFGAQACILPVAVGGGWYHHHRHGW* |
| Ga0167632_10426822 | 3300015085 | Glacier Forefield Soil | MRYLRIALLLLAVMFTAQACILPVPVFPGGGHHHRGGRR* |
| Ga0137418_100574415 | 3300015241 | Vadose Zone Soil | MHYLRIVLLLLAVTVGTQACIVPIPVGPGGGHRHHHDHWR* |
| Ga0180089_11042052 | 3300015254 | Soil | MRYLRIVLLLLAVTVATQACFVVVDPERGGRGGHHHRGGRR* |
| Ga0187824_100037212 | 3300017927 | Freshwater Sediment | MRYLRILLLLLAVTIGAQACIFVAVGGGGGHRHHHDWR |
| Ga0187825_100824431 | 3300017930 | Freshwater Sediment | MMLYLRIALLLLAVTVGTQACIVPIPVGPGWHHHHDWR |
| Ga0187825_101179122 | 3300017930 | Freshwater Sediment | MRYLRILLLLLAVTIGTQACIFVPVPVGGGGGHRHHRDWH |
| Ga0187779_101815522 | 3300017959 | Tropical Peatland | MRYLKIVLLLLAVTVGTQACFVVVGPERGWHHGWR |
| Ga0187823_100753163 | 3300017993 | Freshwater Sediment | MRYLRILLLLLAVTIGAQACIFVPVGGGGGHRHHRDWH |
| Ga0187823_101257751 | 3300017993 | Freshwater Sediment | MRYLRIALLLLAVTVGTQACIVPIPVGPGWHHHHDWR |
| Ga0187822_100846383 | 3300017994 | Freshwater Sediment | MRYLRILLLLLAVTIGAQSCIFVPVGGGGGHRHHHDWH |
| Ga0187765_103942122 | 3300018060 | Tropical Peatland | MRYLKIVLLLLAVTVGTQACFVIVGPERGWHHGWR |
| Ga0184632_100396535 | 3300018075 | Groundwater Sediment | MRYLRIVLLLLAVTVGIQACIVPIPVGPGGGHRHDRDGWR |
| Ga0190265_100719924 | 3300018422 | Soil | MRYLRIALLLLAVTVGAQACILPVPVGPGWHHHHGWRR |
| Ga0190272_112349712 | 3300018429 | Soil | MRYLRIALLLLAVTLTAQACIVPVPVGPGRHHHGGWR |
| Ga0190272_124909462 | 3300018429 | Soil | MRYLRIVLLLLAVTVATQACFVVVDPERGGRGGHH |
| Ga0137408_12126532 | 3300019789 | Vadose Zone Soil | MRHVRILLLLLGVTIGTQACIFVPVPVGGGGHGGHRHHDGWRR |
| Ga0193756_10082421 | 3300019866 | Soil | MRYLKIALLLLAVTFGTQACILPVPVGGGWHHHHGWR |
| Ga0193722_10452232 | 3300019877 | Soil | MRFLKIVLLLLGVTVATQACIIPVPVGGGGGHRHHHDEWR |
| Ga0193722_10715171 | 3300019877 | Soil | RVALLLLAVAFVTQACIFVPVPVGGGGHHHRHRDDWR |
| Ga0193723_10417072 | 3300019879 | Soil | MRHLTIWLLLLAVTVGTQACIFVPVGGGGGYRHHRHDDQR |
| Ga0193727_10279162 | 3300019886 | Soil | MRYLRIALLLLAVTFGAQACIFPVPVGPGWHHHHGWRR |
| Ga0193729_10176964 | 3300019887 | Soil | MRYLKVAMLLLAVTLGTQACIFVPVGGGGHHHHGWR |
| Ga0193711_10298942 | 3300019997 | Soil | MRYLTIWLLLLAVTVGTQACIFVPVGGGGGYRHHRHDDQR |
| Ga0193755_10941532 | 3300020004 | Soil | MRYLKIVMLLLAVMVGTQACIIPVPIGGGGGRHHHRHDW |
| Ga0193726_10595384 | 3300020021 | Soil | MRYLKIALVLLAVTFGTQACILPVPVGGGWHHHHGWR |
| Ga0193726_10760901 | 3300020021 | Soil | MRYLRIAVLLLAVTFLAQACIFVPVPVGGGGGHHRRHYDDWR |
| Ga0193726_11066874 | 3300020021 | Soil | MRYLRIALLLLAVTFGTQACIFVPVGGGGHHHHGWR |
| Ga0193716_12075772 | 3300020061 | Soil | MRYLRIALLLLTVALTAQACILPVPVYPGGGHHHRGGRR |
| Ga0210407_100239895 | 3300020579 | Soil | MRYIKIVLLLLAVTVGTQACFVVVGPERGWHHGWR |
| Ga0210407_101831052 | 3300020579 | Soil | MRYLRIAVLLLAVTFATQACIFVPVGGGGGYHHRHRDDWR |
| Ga0210407_104276221 | 3300020579 | Soil | MRYLRIMLLLMAVTFGTQACILFVPVGGGHHHGWR |
| Ga0210399_100392676 | 3300020581 | Soil | MRYLRIMLLLMAVTFGTQACILFVPVDGGGGHHHHGGWR |
| Ga0210399_101099944 | 3300020581 | Soil | MRYLRIVLLLMAVTFGTQACILFVPVGGGHHHGWR |
| Ga0210404_1000098611 | 3300021088 | Soil | MRYLRIAVLLLAVTFVTQACIFVPVGGGGGYHHRHRDDWR |
| Ga0210404_107327402 | 3300021088 | Soil | MRYLRIMLLLMAVTFGTQACILFVPVGGGGGHHHHGGWR |
| Ga0210384_1000463913 | 3300021432 | Soil | MRYVKIVLLLLAVTVGTQACFVIVGPERGWHHGWR |
| Ga0210384_100603092 | 3300021432 | Soil | MRYLRIALLLLAVTVGTQACILFVPVGGGGHHHHGWR |
| Ga0207647_104693932 | 3300025904 | Corn Rhizosphere | MRYLTIWLLLLAVTVGTQACIFVPVGGGGGGHRHHRYDGQRSECLH |
| Ga0207645_100312112 | 3300025907 | Miscanthus Rhizosphere | MRYLTIWLLLLAVTVGTQACIFVPVGGGGGGHRHHRYDGQR |
| Ga0207684_100050725 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MRYLRIALLLLAVTFGTQACILPVPVGGGWHHHHGWR |
| Ga0207684_100137134 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MRYLKIGLLLPAVTFGTQACILPVPVGGGWHHHHGWR |
| Ga0207684_105910402 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MRYLRVALLLFAVTFVAQACIFVPVPVGGGGGHHRRHYDDWR |
| Ga0207684_112419512 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | FKEMSTMRYLKIVLLLLGVTVGTQACIIPIPVGGGGGHRHHRDDWR |
| Ga0207646_110766201 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MRYLRIALLLLAVTVGTQACIFVPVPVGGGGGHHHR |
| Ga0209438_10650552 | 3300026285 | Grasslands Soil | MRHVRILLLLLAVTIGTQACIFVPVPVGGGGHGGHRHH |
| Ga0209438_10844362 | 3300026285 | Grasslands Soil | MRYLRIALLLLAVTFVTQACIFVPVPVDGGGHHHRHRDDWR |
| Ga0209240_12845422 | 3300026304 | Grasslands Soil | MRYLKIGLLLLAVTFGTQACILPVGGGWHHHHGWR |
| Ga0257163_10126163 | 3300026359 | Soil | MRYLNIVLLLLGVTVGTQACIIPVPVGGGGGHRHHHDEWR |
| Ga0257156_11353451 | 3300026498 | Soil | MRYLKIVLLLLGVTVGTQACIIPVPVGGGGGHRHHHDDWR |
| Ga0179587_101472843 | 3300026557 | Vadose Zone Soil | MRYLRVALLLLAVTFGTQACIFVPVPVGDGDGHHHRNHDDWR |
| Ga0209527_10036206 | 3300027583 | Forest Soil | MRYLRVALLLLAVTFGTQACIFVPVGGGGHHHHGWR |
| Ga0209329_11212341 | 3300027605 | Forest Soil | MRYLRVALLLLAVTFGTQACIFVPVPVGGGGGHHHRNHDDWR |
| Ga0209117_10615862 | 3300027645 | Forest Soil | MRYLKIALLLLAVTFGTQACILPVPVGGGWHHHQGWR |
| Ga0209388_10049114 | 3300027655 | Vadose Zone Soil | MRYLRIALLLLAVTFGTQACILPVPVGGGWHYHHHDWR |
| Ga0209388_10232853 | 3300027655 | Vadose Zone Soil | MRFLKIVLLLLGVTVGTQACIIPVPVGGGGGGHRHHHDDWR |
| Ga0209074_101130243 | 3300027787 | Agricultural Soil | LKIVLLLLGVTVGTQACIIPIPVGGGGGHRHHHDEWR |
| Ga0209180_103132612 | 3300027846 | Vadose Zone Soil | MRYLKIGLLLLAVTFGTQACILPVPVGGGWHHHHGWR |
| Ga0209069_104714612 | 3300027915 | Watersheds | IMRYLRIALLLLAVTVGTQACIVPVPVGPGWPHHHGWR |
| Ga0209526_100500343 | 3300028047 | Forest Soil | MRYVRIALLLLAVTFGTQACIFVPVGGGGHHHHGWR |
| Ga0209526_104766563 | 3300028047 | Forest Soil | MRYLKIVMLLLAVTVGTQACIIPVPIGGGDGGHHRHHRDW |
| Ga0307504_101937051 | 3300028792 | Soil | MRYLKIVMLLLAVTVGTQACIIPVPIGGGDGGHHHHRRNW |
| Ga0307312_104822941 | 3300028828 | Soil | DMRYLRIWLLLLAVTVGTQACIFVPVGGGGGHRHHRHDDQR |
| Ga0308178_11234922 | 3300030990 | Soil | MRYLKIVLLLLGVTVATQACIIPVPVGGGGGHRHHHGEWR |
| (restricted) Ga0255310_100311934 | 3300031197 | Sandy Soil | MRYLRIVLLLLAVTVGTQACILPIPVGPGWHHHHGWR |
| (restricted) Ga0255312_10244782 | 3300031248 | Sandy Soil | MRYLRIVLLLLAVTLGTQACIVPVPVGPGWHHRHGWR |
| (restricted) Ga0255312_10980831 | 3300031248 | Sandy Soil | MRYLRIVLLLLAVTVGTQACILPIPVGPGWHHHHG |
| Ga0310813_100664094 | 3300031716 | Soil | MRYLRIALLLLAVTLGTQACIVPVPVGPGRHHHHGWR |
| Ga0307469_106740922 | 3300031720 | Hardwood Forest Soil | MHYLRFAVLLLAVTFVTQACIFVPVPVGGGGGYHHRHRDDWR |
| Ga0307469_109646692 | 3300031720 | Hardwood Forest Soil | MSTMRYLKIVLLLLGVTVGTQACIIPIPVGGGGGHRHHRDDWR |
| Ga0307473_100490843 | 3300031820 | Hardwood Forest Soil | MHYLRIAVLLLAVTFVTQACIFVPVGGGGGYHHRHRDDWR |
| Ga0326729_10114912 | 3300033432 | Peat Soil | MRYLRIALLLLAVTLGTQACIVPVPVGPGWHHHHGWR |
| Ga0326729_10158473 | 3300033432 | Peat Soil | MRYVRVVLLLLAVTIGAQACIFVPVGGGGGHRHHRDWH |
| Ga0326726_100178594 | 3300033433 | Peat Soil | MRYLRILLLLLAVTIGTQACIFIPVGGGGGHRHHHDWH |
| Ga0326726_106479803 | 3300033433 | Peat Soil | MRYLRVVLLLLAVTIGAQACIFVPVGGGGGHRHHHDWH |
| Ga0316628_1001546054 | 3300033513 | Soil | MRYLRILLLLLAVTIGTQACIFIPVGGGGGHRHHHGWH |
| Ga0326723_0011881_2386_2499 | 3300034090 | Peat Soil | MRYLRIALLLLAVTLGTQACIVPVPVGPGWHHHHGGR |
| Ga0326723_0130438_14_130 | 3300034090 | Peat Soil | MRYLRVVLLLLAVTIGAQACIFVPVGGGGGHRHHRDWH |
| ⦗Top⦘ |