Metagenome / Metatranscriptome Family F056851

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F056851
Family Type	Metagenome / Metatranscriptome
Number of Sequences	137
Average Sequence Length	39 residues
Representative Sequence	MRYLRIALLLLAVTFGTQACILPVPVGGGWHHHHGWR
Number of Associated Samples	102
Number of Associated Scaffolds	137

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	84.91 %
% of genes near scaffold ends (potentially truncated)	16.06 %
% of genes from short scaffolds (< 2000 bps)	57.66 %
Associated GOLD sequencing projects	97
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.39

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (56.204 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (19.708 % of family members)
Environment Ontology (ENVO)	Unclassified (32.117 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (41.606 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	Yes	Secondary Structure distribution:	α-helix: 30.77% β-sheet: 0.00% Coil/Unstructured: 69.23%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.39
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.39
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 137 Family Scaffolds
PF04392	ABC_sub_bind	7.30
PF00072	Response_reg	5.84
PF03892	NapB	5.11
PF02538	Hydantoinase_B	3.65
PF02128	Peptidase_M36	2.92
PF00496	SBP_bac_5	2.19
PF02502	LacAB_rpiB	1.46
PF00378	ECH_1	1.46
PF13511	DUF4124	1.46
PF13683	rve_3	0.73
PF13419	HAD_2	0.73
PF12172	DUF35_N	0.73
PF12697	Abhydrolase_6	0.73
PF07690	MFS_1	0.73
PF09360	zf-CDGSH	0.73
PF01068	DNA_ligase_A_M	0.73
PF03773	ArsP_1	0.73
PF13193	AMP-binding_C	0.73
PF12867	DinB_2	0.73
PF03949	Malic_M	0.73
PF10771	DUF2582	0.73
PF07589	PEP-CTERM	0.73
PF14595	Thioredoxin_9	0.73
PF06305	LapA_dom	0.73
PF02522	Antibiotic_NAT	0.73
PF05992	SbmA_BacA	0.73
PF10851	DUF2652	0.73
PF04972	BON	0.73
PF01339	CheB_methylest	0.73
PF00535	Glycos_transf_2	0.73
PF03060	NMO	0.73
PF05685	Uma2	0.73
PF05598	DUF772	0.73
PF13091	PLDc_2	0.73

COG ID	Name	Functional Category	% Frequency in 137 Family Scaffolds
COG0146	N-methylhydantoinase B/oxoprolinase/acetone carboxylase, alpha subunit	Amino acid transport and metabolism [E]	7.30
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	7.30
COG3043	Nitrate reductase cytochrome c-type subunit NapB	Energy production and conversion [C]	5.11
COG0698	Ribose 5-phosphate isomerase RpiB	Carbohydrate transport and metabolism [G]	1.46
COG2201	Chemotaxis response regulator CheB, contains REC and protein-glutamate methylesterase domains	Signal transduction mechanisms [T]	1.46
COG0281	Malic enzyme	Energy production and conversion [C]	0.73
COG0516	IMP dehydrogenase/GMP reductase	Nucleotide transport and metabolism [F]	0.73
COG0686	Alanine dehydrogenase (includes sporulation protein SpoVN)	Amino acid transport and metabolism [E]	0.73
COG0701	Uncharacterized membrane protein YraQ, UPF0718 family	Function unknown [S]	0.73
COG1423	ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family	Replication, recombination and repair [L]	0.73
COG1793	ATP-dependent DNA ligase	Replication, recombination and repair [L]	0.73
COG2070	NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family	General function prediction only [R]	0.73
COG2746	Aminoglycoside N3'-acetyltransferase	Defense mechanisms [V]	0.73
COG3771	Lipopolysaccharide assembly protein YciS/LapA, DUF1049 family	Cell wall/membrane/envelope biogenesis [M]	0.73
COG4636	Endonuclease, Uma2 family (restriction endonuclease fold)	General function prediction only [R]	0.73

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.20 %
All Organisms	root	All Organisms	43.80 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.20 %
cellular organisms	root	All Organisms → cellular organisms	43.80 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.20 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	43.80 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.20 %
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	8.76 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	6.57 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	6.57 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	2.19 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.20 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	8.76 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	5.84 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3.65 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1.46 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.73 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.73 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.20 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	8.76 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	5.84 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2.19 %
Sphingomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales	0.73 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.73 %
unclassified Betaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria	0.73 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.73 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.20 %
unclassified Candidatus Rokubacteria	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria	8.76 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	5.84 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	2.19 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.73 %
unclassified Actinomycetia	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia	0.73 %
Sphingomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	0.73 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.73 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.20 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	8.76 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	5.84 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2.19 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	0.73 %
Sphingomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	0.73 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.73 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.73 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.20 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	8.76 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	5.84 %
unclassified Bradyrhizobium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium	0.73 %
Sphingomonas oleivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas oleivorans	0.73 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	0.73 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.73 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.73 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.20 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	8.76 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	5.84 %
Bradyrhizobium sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.	0.73 %
Sphingomonas oleivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas oleivorans	0.73 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	0.73 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.73 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.73 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300004114\|Ga0062593_100311213	Not Available	1349	Open in IMG/M
3300004156\|Ga0062589_100077337	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	2012	Open in IMG/M
3300005434\|Ga0070709_11093649	Not Available	637	Open in IMG/M
3300005434\|Ga0070709_11120044	Not Available	630	Open in IMG/M
3300005440\|Ga0070705_100081858	All Organisms → cellular organisms → Bacteria	1985	Open in IMG/M
3300005445\|Ga0070708_100483261	Not Available	1168	Open in IMG/M
3300005471\|Ga0070698_101562498	Not Available	611	Open in IMG/M
3300005518\|Ga0070699_100145413	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2094	Open in IMG/M
3300005518\|Ga0070699_101135115	Not Available	717	Open in IMG/M
3300005536\|Ga0070697_100130081	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2111	Open in IMG/M
3300005542\|Ga0070732_10985333	Not Available	515	Open in IMG/M
3300005921\|Ga0070766_10986027	Not Available	579	Open in IMG/M
3300006047\|Ga0075024_100497482	All Organisms → cellular organisms → Bacteria	638	Open in IMG/M
3300006049\|Ga0075417_10462337	Not Available	634	Open in IMG/M
3300006057\|Ga0075026_100278525	All Organisms → cellular organisms → Bacteria	906	Open in IMG/M
3300006173\|Ga0070716_100255993	Not Available	1195	Open in IMG/M
3300006755\|Ga0079222_10112477	Not Available	1462	Open in IMG/M
3300006755\|Ga0079222_10231742	All Organisms → cellular organisms → Bacteria	1143	Open in IMG/M
3300006806\|Ga0079220_10900916	Not Available	686	Open in IMG/M
3300006806\|Ga0079220_11020920	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	659	Open in IMG/M
3300006854\|Ga0075425_100453261	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.	1477	Open in IMG/M
3300006903\|Ga0075426_10003018	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	12019	Open in IMG/M
3300006954\|Ga0079219_11567666	Not Available	601	Open in IMG/M
3300007255\|Ga0099791_10151360	All Organisms → cellular organisms → Bacteria	1083	Open in IMG/M
3300009038\|Ga0099829_10443308	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1076	Open in IMG/M
3300009089\|Ga0099828_10879027	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	801	Open in IMG/M
3300009162\|Ga0075423_10403016	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1436	Open in IMG/M
3300009162\|Ga0075423_13106181	Not Available	509	Open in IMG/M
3300010358\|Ga0126370_10398172	Not Available	1130	Open in IMG/M
3300010359\|Ga0126376_10073691	All Organisms → cellular organisms → Bacteria	2509	Open in IMG/M
3300011269\|Ga0137392_10809262	Not Available	774	Open in IMG/M
3300012202\|Ga0137363_10085245	All Organisms → cellular organisms → Bacteria → Proteobacteria	2363	Open in IMG/M
3300012202\|Ga0137363_11457698	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	575	Open in IMG/M
3300012202\|Ga0137363_11700699	Not Available	523	Open in IMG/M
3300012207\|Ga0137381_10374122	Not Available	1242	Open in IMG/M
3300012208\|Ga0137376_10061605	All Organisms → cellular organisms → Bacteria	3096	Open in IMG/M
3300012361\|Ga0137360_10019919	All Organisms → cellular organisms → Bacteria	4461	Open in IMG/M
3300012362\|Ga0137361_10141601	All Organisms → cellular organisms → Bacteria	2141	Open in IMG/M
3300012918\|Ga0137396_10452914	All Organisms → cellular organisms → Bacteria	951	Open in IMG/M
3300012918\|Ga0137396_10478746	Not Available	923	Open in IMG/M
3300012923\|Ga0137359_10154137	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	2049	Open in IMG/M
3300012929\|Ga0137404_10055886	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	3045	Open in IMG/M
3300012931\|Ga0153915_10054918	All Organisms → cellular organisms → Bacteria	4096	Open in IMG/M
3300012944\|Ga0137410_10818025	Not Available	783	Open in IMG/M
3300015241\|Ga0137418_10057441	All Organisms → cellular organisms → Bacteria → Acidobacteria	3566	Open in IMG/M
3300015254\|Ga0180089_1104205	Not Available	589	Open in IMG/M
3300017927\|Ga0187824_10003721	All Organisms → cellular organisms → Bacteria → Proteobacteria	4158	Open in IMG/M
3300017930\|Ga0187825_10082443	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1104	Open in IMG/M
3300017930\|Ga0187825_10117912	All Organisms → cellular organisms → Bacteria	925	Open in IMG/M
3300017959\|Ga0187779_10181552	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1310	Open in IMG/M
3300017993\|Ga0187823_10075316	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	970	Open in IMG/M
3300017993\|Ga0187823_10125775	All Organisms → cellular organisms → Bacteria	789	Open in IMG/M
3300017994\|Ga0187822_10084638	Not Available	946	Open in IMG/M
3300018060\|Ga0187765_10394212	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	853	Open in IMG/M
3300018075\|Ga0184632_10039653	Not Available	2024	Open in IMG/M
3300018429\|Ga0190272_11234971	Not Available	737	Open in IMG/M
3300018429\|Ga0190272_12490946	Not Available	563	Open in IMG/M
3300019789\|Ga0137408_1212653	All Organisms → cellular organisms → Bacteria	1474	Open in IMG/M
3300019877\|Ga0193722_1045223	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1122	Open in IMG/M
3300019877\|Ga0193722_1071517	Not Available	860	Open in IMG/M
3300019879\|Ga0193723_1041707	Not Available	1362	Open in IMG/M
3300019886\|Ga0193727_1027916	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1955	Open in IMG/M
3300019887\|Ga0193729_1017696	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3123	Open in IMG/M
3300019997\|Ga0193711_1029894	Not Available	683	Open in IMG/M
3300020004\|Ga0193755_1094153	All Organisms → cellular organisms → Bacteria	952	Open in IMG/M
3300020021\|Ga0193726_1059538	All Organisms → cellular organisms → Bacteria	1801	Open in IMG/M
3300020021\|Ga0193726_1076090	Not Available	1553	Open in IMG/M
3300020579\|Ga0210407_10023989	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	4537	Open in IMG/M
3300020579\|Ga0210407_10183105	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1624	Open in IMG/M
3300020581\|Ga0210399_10039267	All Organisms → cellular organisms → Bacteria	3790	Open in IMG/M
3300021088\|Ga0210404_10000986	All Organisms → cellular organisms → Bacteria	12820	Open in IMG/M
3300021088\|Ga0210404_10732740	Not Available	564	Open in IMG/M
3300021432\|Ga0210384_10004639	All Organisms → cellular organisms → Bacteria	15268	Open in IMG/M
3300021432\|Ga0210384_10060309	Not Available	3429	Open in IMG/M
3300025904\|Ga0207647_10469393	Not Available	704	Open in IMG/M
3300025907\|Ga0207645_10031211	All Organisms → cellular organisms → Bacteria	3430	Open in IMG/M
3300025910\|Ga0207684_10013713	All Organisms → cellular organisms → Bacteria → Proteobacteria	6999	Open in IMG/M
3300025910\|Ga0207684_10591040	Not Available	948	Open in IMG/M
3300025910\|Ga0207684_11241951	Not Available	615	Open in IMG/M
3300025922\|Ga0207646_11076620	All Organisms → cellular organisms → Bacteria	708	Open in IMG/M
3300026285\|Ga0209438_1065055	Not Available	1197	Open in IMG/M
3300026285\|Ga0209438_1084436	Not Available	1008	Open in IMG/M
3300026359\|Ga0257163_1012616	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1281	Open in IMG/M
3300026498\|Ga0257156_1135345	Not Available	513	Open in IMG/M
3300026557\|Ga0179587_10147284	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1465	Open in IMG/M
3300027583\|Ga0209527_1003620	All Organisms → cellular organisms → Bacteria	3122	Open in IMG/M
3300027605\|Ga0209329_1121234	Not Available	575	Open in IMG/M
3300027655\|Ga0209388_1023285	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas oleivorans	1747	Open in IMG/M
3300027787\|Ga0209074_10113024	Not Available	933	Open in IMG/M
3300027915\|Ga0209069_10471461	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	701	Open in IMG/M
3300028047\|Ga0209526_10050034	All Organisms → cellular organisms → Bacteria	2943	Open in IMG/M
3300028047\|Ga0209526_10476656	Not Available	817	Open in IMG/M
3300028792\|Ga0307504_10193705	Not Available	716	Open in IMG/M
3300028828\|Ga0307312_10482294	Not Available	818	Open in IMG/M
3300030990\|Ga0308178_1123492	Not Available	572	Open in IMG/M
(restricted) 3300031197\|Ga0255310_10031193	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1379	Open in IMG/M
(restricted) 3300031248\|Ga0255312_1024478	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1440	Open in IMG/M
(restricted) 3300031248\|Ga0255312_1098083	All Organisms → cellular organisms → Bacteria	715	Open in IMG/M
3300031720\|Ga0307469_10674092	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	934	Open in IMG/M
3300031720\|Ga0307469_10964669	Not Available	794	Open in IMG/M
3300031820\|Ga0307473_10049084	All Organisms → cellular organisms → Bacteria	1985	Open in IMG/M
3300033432\|Ga0326729_1015847	Not Available	1269	Open in IMG/M
3300033433\|Ga0326726_10017859	All Organisms → cellular organisms → Bacteria	6177	Open in IMG/M
3300033433\|Ga0326726_10647980	Not Available	1017	Open in IMG/M
3300033513\|Ga0316628_100154605	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2690	Open in IMG/M
3300034090\|Ga0326723_0130438	All Organisms → cellular organisms → Bacteria	1098	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	91.97%
Host-Associated	Host-Associated	8.03%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	81.02%
Aquatic	Environmental → Aquatic	10.95%
Plants	Host-Associated → Plants	8.03%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	76.64%
Rhizosphere	Host-Associated → Plants → Rhizosphere	7.30%
Freshwater	Environmental → Aquatic → Freshwater	5.84%
Sediment	Environmental → Aquatic → Sediment	5.11%
Peat	Environmental → Terrestrial → Peat	4.38%
Rhizoplane	Host-Associated → Plants → Rhizoplane	0.73%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	56.20%
Loam	Environmental → Terrestrial → Soil → Loam	16.06%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	6.57%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	5.84%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	5.11%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	4.38%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	2.19%
Sand	Environmental → Terrestrial → Soil → Sand	2.19%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	0.73%
Soil	Host-Associated → Plants → Rhizosphere → Soil	0.73%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	36.50%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	11.68%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	10.22%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	6.57%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	6.57%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	5.11%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	4.38%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	4.38%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	4.38%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	2.92%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	2.19%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	2.19%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	1.46%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	0.73%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	0.73%

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	19.71%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	13.87%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	11.68%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	8.03%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	5.11%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	4.38%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	4.38%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	4.38%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	3.65%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	3.65%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	2.19%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	2.19%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	2.19%
Sandy Soil	Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil	2.19%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	1.46%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	1.46%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	1.46%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	0.73%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.73%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	0.73%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	0.73%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	0.73%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.73%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	0.73%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.73%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.73%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.73%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.73%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300004114	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5	Environmental	Open in IMG/M
3300004156	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1	Environmental	Open in IMG/M
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental	Open in IMG/M
3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Environmental	Open in IMG/M
3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Environmental	Open in IMG/M
3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Environmental	Open in IMG/M
3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Environmental	Open in IMG/M
3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Environmental	Open in IMG/M
3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Environmental	Open in IMG/M
3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Environmental	Open in IMG/M
3300005542	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1	Environmental	Open in IMG/M
3300005557	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153	Environmental	Open in IMG/M
3300005921	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6	Environmental	Open in IMG/M
3300006041	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014	Environmental	Open in IMG/M
3300006047	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013	Environmental	Open in IMG/M
3300006049	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1	Host-Associated	Open in IMG/M
3300006057	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012	Environmental	Open in IMG/M
3300006172	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014	Environmental	Open in IMG/M
3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Environmental	Open in IMG/M
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental	Open in IMG/M
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental	Open in IMG/M
3300006806	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100	Environmental	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006903	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5	Host-Associated	Open in IMG/M
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental	Open in IMG/M
3300007255	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1	Environmental	Open in IMG/M
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental	Open in IMG/M
3300009089	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG	Environmental	Open in IMG/M
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300011269	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG	Environmental	Open in IMG/M
3300012189	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG	Environmental	Open in IMG/M
3300012202	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG	Environmental	Open in IMG/M
3300012207	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG	Environmental	Open in IMG/M
3300012208	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG	Environmental	Open in IMG/M
3300012361	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG	Environmental	Open in IMG/M
3300012362	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG	Environmental	Open in IMG/M
3300012685	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG	Environmental	Open in IMG/M
3300012918	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG	Environmental	Open in IMG/M
3300012923	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG	Environmental	Open in IMG/M
3300012929	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012931	Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG	Environmental	Open in IMG/M
3300012944	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Host-Associated	Open in IMG/M
3300015085	Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4B, Ice margin, adjacent to proglacial lake)	Environmental	Open in IMG/M
3300015241	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300015254	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT860_16_10D	Environmental	Open in IMG/M
3300017927	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4	Environmental	Open in IMG/M
3300017930	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5	Environmental	Open in IMG/M
3300017959	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG	Environmental	Open in IMG/M
3300017993	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3	Environmental	Open in IMG/M
3300017994	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2	Environmental	Open in IMG/M
3300018060	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG	Environmental	Open in IMG/M
3300018075	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1	Environmental	Open in IMG/M
3300018422	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T	Environmental	Open in IMG/M
3300018429	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T	Environmental	Open in IMG/M
3300019789	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)	Environmental	Open in IMG/M
3300019866	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m1	Environmental	Open in IMG/M
3300019877	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1	Environmental	Open in IMG/M
3300019879	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2	Environmental	Open in IMG/M
3300019886	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2	Environmental	Open in IMG/M
3300019887	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2	Environmental	Open in IMG/M
3300019997	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3m2	Environmental	Open in IMG/M
3300020004	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2	Environmental	Open in IMG/M
3300020021	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1	Environmental	Open in IMG/M
3300020061	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c1	Environmental	Open in IMG/M
3300020579	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M	Environmental	Open in IMG/M
3300020581	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M	Environmental	Open in IMG/M
3300021088	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M	Environmental	Open in IMG/M
3300021432	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M	Environmental	Open in IMG/M
3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)	Host-Associated	Open in IMG/M
3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300026285	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes)	Environmental	Open in IMG/M
3300026304	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes)	Environmental	Open in IMG/M
3300026359	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-A	Environmental	Open in IMG/M
3300026498	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A	Environmental	Open in IMG/M
3300026557	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal	Environmental	Open in IMG/M
3300027583	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes)	Environmental	Open in IMG/M
3300027605	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes)	Environmental	Open in IMG/M
3300027645	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes)	Environmental	Open in IMG/M
3300027655	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes)	Environmental	Open in IMG/M
3300027787	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)	Environmental	Open in IMG/M
3300027846	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027915	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)	Environmental	Open in IMG/M
3300028047	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)	Environmental	Open in IMG/M
3300028792	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S	Environmental	Open in IMG/M
3300028828	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202	Environmental	Open in IMG/M
3300030990	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031197 (restricted)	Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1	Environmental	Open in IMG/M
3300031248 (restricted)	Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5	Environmental	Open in IMG/M
3300031716	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031820	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515	Environmental	Open in IMG/M
3300033432	Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF6AY SIP fraction	Environmental	Open in IMG/M
3300033433	Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN	Environmental	Open in IMG/M
3300033513	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C	Environmental	Open in IMG/M
3300034090	Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0062593_1003112131	3300004114	Soil	MRYLTIWLLLLAVTVGTQACIFVPVGGGGGGHRHHRYDGQR*
Ga0062589_1000773373	3300004156	Soil	MRCMRIVLLLLAVTIGTQACIFVPVPVGGGGHGGHRHHDDWRR*
Ga0062595_1022517842	3300004479	Soil	MVEEVPLRYVKIVLLLLAVTFGAQACILPVPVGGGWHHHHGWR*
Ga0070709_110936491	3300005434	Corn, Switchgrass And Miscanthus Rhizosphere	MRYLKIVLLLLGVTVGTQACIIPIPVGGGGGHRHHRDDWR*
Ga0070709_111200441	3300005434	Corn, Switchgrass And Miscanthus Rhizosphere	MHYLRIAVLLLAVTFVTQACIFVPVPVGGGGGHHHRHRDD
Ga0070705_1000818582	3300005440	Corn, Switchgrass And Miscanthus Rhizosphere	MHYLRIAVLLLAVSFVTQACIFVPVPVGGGGGYHNRHRDDWR*
Ga0070708_1004832612	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	MRYLRVALLLFAVTFVAQACIFVPVPVGGGGGHHRRHYDDWR*
Ga0070707_1001896971	3300005468	Corn, Switchgrass And Miscanthus Rhizosphere	GRLIGEEVRYALLRIALLLLAVTFGTQACILPVPVGGGWHHHHGWR*
Ga0070698_1015624982	3300005471	Corn, Switchgrass And Miscanthus Rhizosphere	MRYLKIALLLLAVTVGTQACIFVPVPVGGGGGHHHRHYDEWR*
Ga0070699_1001454134	3300005518	Corn, Switchgrass And Miscanthus Rhizosphere	MRYLRVALLLLAVTFGTQACIFVPVPVGGGGGHHHHGWR*
Ga0070699_1011351151	3300005518	Corn, Switchgrass And Miscanthus Rhizosphere	RYLKIVLLLLGVTVGTQACIIPIPVGGGGGHRHHRDDWR*
Ga0070697_1001300811	3300005536	Corn, Switchgrass And Miscanthus Rhizosphere	MRYLRVALLLLAVTFGTQACIFVPVPVGGGGGHHHRNHDDWR*
Ga0070732_109853332	3300005542	Surface Soil	MRYLKIVMLLLAVTVGTQACIIPVPIGGGDGGHHRRHHDW*
Ga0066704_100649642	3300005557	Soil	MRYLKIGLLLPAVTFGTQACILPVPVGGGWHHHHGWR*
Ga0070766_109860273	3300005921	Soil	MRYVKIVLLLLAVTVGTQACFVIVGPERGWHHGWR*
Ga0075023_1001127013	3300006041	Watersheds	MRYLKIGLLLLAVTFGTQACILLVPVGGGGHHHHGWR*
Ga0075024_1004974822	3300006047	Watersheds	LRIALLLLAVTVGTQACIVPVPVGPGWPHHHGWR*
Ga0075417_100463312	3300006049	Populus Rhizosphere	MRYVKIVLLLLAVTFGAQACILPVPVGGGWHHHHGWR*
Ga0075417_104623372	3300006049	Populus Rhizosphere	MRYLRIVLLLLAVTVGTHACIFVPVPVGGGGGHRHHRDDWR*
Ga0075026_1002785252	3300006057	Watersheds	RRCALMRYLKIVMLLLAVTVGTQACIIPVPIGGGDGGHNHHRHDW*
Ga0075018_107922102	3300006172	Watersheds	RCPMRYLKIGLLLLAVTFGTQACILLVPVGGGGHHHHGWR*
Ga0070716_1002559933	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	MHYLRIAVLLLAVSFVTQACIFVPVPVGGGGGYHHRHRD
Ga0070712_1007948713	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	VSWSRRCPMRYVKIVLLLLAVTFGTQACILPVPVGGGWHHHHGWR*
Ga0079222_101124773	3300006755	Agricultural Soil	MRYLKIVLLLLGVTVGTQACIIPIPVGGGGGHRHHHDEWR*
Ga0079222_102317421	3300006755	Agricultural Soil	MRYLRIALLLLAVAIVTQSCIFVPVPVDGGGHHHRHRDDWR*
Ga0079220_109009161	3300006806	Agricultural Soil	IMRYLRIALLLLAVTVGTQACIVPIPVGPGWHHHRDWR*
Ga0079220_110209202	3300006806	Agricultural Soil	MRYLRILLLLLAVTIGTQACIFVPVPVGGGGGHRHHRDWH*
Ga0075425_1004532611	3300006854	Populus Rhizosphere	MRYLRIALLLLAVTIVTQSCIFVPVPVDGGGHHHRHRDDWR*
Ga0075425_1008879022	3300006854	Populus Rhizosphere	MRYVKIVLLLLAVTFGTQACILPVPVGGGWHHHHGWR*
Ga0075426_1000301811	3300006903	Populus Rhizosphere	MRYLRIALLLLAVTIVTQSCIFVPVPVDGGGDHHRHRDDWR*
Ga0079219_115676661	3300006954	Agricultural Soil	MRYLKIAMLLLAVAVGAQACIIPVPVGGGGGHHHH
Ga0099791_100076922	3300007255	Vadose Zone Soil	MRYLRIALLLLAVTFGTQACILPVPVGGGWHYHHHDWR*
Ga0099791_101513602	3300007255	Vadose Zone Soil	MRFLKIVLLLLGVTVGTQACIIPVPVGGGGGGHRHHHDDWR*
Ga0099791_103368222	3300007255	Vadose Zone Soil	MRYLKIGLLLLAVTFGTQACILPVGGGWHHHHGWR*
Ga0099829_104433082	3300009038	Vadose Zone Soil	MRYLKIGLLLLAVTFGTQACILPVPVGGGWHHHHGWR*
Ga0099828_108790271	3300009089	Vadose Zone Soil	MRYLRIVLLLLTVTVGTQACFFVVGPDRGGHHHHGWR
Ga0099827_103872422	3300009090	Vadose Zone Soil	MRYLKIGLLLLAVTFGTQACILPVPVGDGWHHHHGWR*
Ga0075423_104030164	3300009162	Populus Rhizosphere	MSTMRYLKIVLLLLGVTVGTQACIIPIPVGGGGGHRHHRDDWR*
Ga0075423_131061812	3300009162	Populus Rhizosphere	ASTMRYLKIVLLLLGVTVGTQACIIPIPVGGGGGHRHHHDEWR*
Ga0126370_103981721	3300010358	Tropical Forest Soil	MRYLRIVLLLLAVTIGTQACFVVVGPDRGWHHHHGW
Ga0126376_100736912	3300010359	Tropical Forest Soil	MRYLRIVLLLLAVTIGTQACFVVVGPDRGWHHHHGWR*
Ga0137392_108092622	3300011269	Vadose Zone Soil	MRYLTIVVLLLAVTFGTQACIFVPVPVGGGGGHHHRLHDDWR*
Ga0137388_102360864	3300012189	Vadose Zone Soil	MRYLRIALLLLAVTFGTQACILPVPVGDGWHHHHGWR*
Ga0137363_100852451	3300012202	Vadose Zone Soil	MRYLRIALLLLAVTFVTQACIFVPVPVDGGGHHHRHRDDWR*
Ga0137363_114576982	3300012202	Vadose Zone Soil	YLRIALLLLAVTFVTQACIFVPVPVDGGGHHHRHRDDWR*
Ga0137363_117006992	3300012202	Vadose Zone Soil	TSEEVTTMRYLKIVLLLLGVTVATQACIIPVPVGGGGGHRRHHDDWR*
Ga0137381_103741223	3300012207	Vadose Zone Soil	MRYLRIVLLLLAVTVSTHACIFVPVPVGGGGGHRHHHRDDWR*
Ga0137376_100616053	3300012208	Vadose Zone Soil	MRYLKILMLLLAVTVGTQACIIPVPIGGGDGGRHHHRHDW*
Ga0137360_100199191	3300012361	Vadose Zone Soil	MSYLKIVLLLLGVTVATQACIIPVPVGGGGGHRRHHDDWR*
Ga0137361_101416013	3300012362	Vadose Zone Soil	MRYLRVAVLLLAVTFVAQACIFVPVPVGGGGGHHRRHYDDWR*
Ga0137397_100901684	3300012685	Vadose Zone Soil	MRYLRIALLLLAVTFGAQACIFPVPVGPGWHHHHGWRR*
Ga0137396_104529143	3300012918	Vadose Zone Soil	TSEEVTTMRFLKIVLLLLGVTVATQACIIPVPVGGGGGHRHHHDEWR*
Ga0137396_104787463	3300012918	Vadose Zone Soil	MRYLKIGLLLLAVTFGTQACILPVPVGGGWHYHHHDWR*
Ga0137359_101541371	3300012923	Vadose Zone Soil	MRYLKIVLLLLGVTVGTQACIIPVPVGGGGGHRHHHDDWR*
Ga0137404_100558865	3300012929	Vadose Zone Soil	MRYLRIVLLLLVVSVGTQACIVPIPVGPGGGHRHHHDHWR*
Ga0153915_100549187	3300012931	Freshwater Wetlands	MRYLRILLLLLAVTIGTQACIFIPVGGGGGHRHHHGWH*
Ga0153915_113082322	3300012931	Freshwater Wetlands	MRYLRIALLLLAVTLGTQACIVPVPVGPGWHHHHGWR*
Ga0137410_108180252	3300012944	Vadose Zone Soil	MRFLKIVLLLLGVTVGTQTCIIPVPIGGGGDGHRHHHDDWR*
Ga0157378_107898851	3300013297	Miscanthus Rhizosphere	MMRYLKIGLLLLTVIFGAQACILPVPVGAGWHNHHRHGW*
Ga0182008_100524025	3300014497	Rhizosphere	YLKIGLLLLTVIFGAQACILPVAVGGGWYHHHRHGW*
Ga0167632_10426822	3300015085	Glacier Forefield Soil	MRYLRIALLLLAVMFTAQACILPVPVFPGGGHHHRGGRR*
Ga0137418_100574415	3300015241	Vadose Zone Soil	MHYLRIVLLLLAVTVGTQACIVPIPVGPGGGHRHHHDHWR*
Ga0180089_11042052	3300015254	Soil	MRYLRIVLLLLAVTVATQACFVVVDPERGGRGGHHHRGGRR*
Ga0187824_100037212	3300017927	Freshwater Sediment	MRYLRILLLLLAVTIGAQACIFVAVGGGGGHRHHHDWR
Ga0187825_100824431	3300017930	Freshwater Sediment	MMLYLRIALLLLAVTVGTQACIVPIPVGPGWHHHHDWR
Ga0187825_101179122	3300017930	Freshwater Sediment	MRYLRILLLLLAVTIGTQACIFVPVPVGGGGGHRHHRDWH
Ga0187779_101815522	3300017959	Tropical Peatland	MRYLKIVLLLLAVTVGTQACFVVVGPERGWHHGWR
Ga0187823_100753163	3300017993	Freshwater Sediment	MRYLRILLLLLAVTIGAQACIFVPVGGGGGHRHHRDWH
Ga0187823_101257751	3300017993	Freshwater Sediment	MRYLRIALLLLAVTVGTQACIVPIPVGPGWHHHHDWR
Ga0187822_100846383	3300017994	Freshwater Sediment	MRYLRILLLLLAVTIGAQSCIFVPVGGGGGHRHHHDWH
Ga0187765_103942122	3300018060	Tropical Peatland	MRYLKIVLLLLAVTVGTQACFVIVGPERGWHHGWR
Ga0184632_100396535	3300018075	Groundwater Sediment	MRYLRIVLLLLAVTVGIQACIVPIPVGPGGGHRHDRDGWR
Ga0190265_100719924	3300018422	Soil	MRYLRIALLLLAVTVGAQACILPVPVGPGWHHHHGWRR
Ga0190272_112349712	3300018429	Soil	MRYLRIALLLLAVTLTAQACIVPVPVGPGRHHHGGWR
Ga0190272_124909462	3300018429	Soil	MRYLRIVLLLLAVTVATQACFVVVDPERGGRGGHH
Ga0137408_12126532	3300019789	Vadose Zone Soil	MRHVRILLLLLGVTIGTQACIFVPVPVGGGGHGGHRHHDGWRR
Ga0193756_10082421	3300019866	Soil	MRYLKIALLLLAVTFGTQACILPVPVGGGWHHHHGWR
Ga0193722_10452232	3300019877	Soil	MRFLKIVLLLLGVTVATQACIIPVPVGGGGGHRHHHDEWR
Ga0193722_10715171	3300019877	Soil	RVALLLLAVAFVTQACIFVPVPVGGGGHHHRHRDDWR
Ga0193723_10417072	3300019879	Soil	MRHLTIWLLLLAVTVGTQACIFVPVGGGGGYRHHRHDDQR
Ga0193727_10279162	3300019886	Soil	MRYLRIALLLLAVTFGAQACIFPVPVGPGWHHHHGWRR
Ga0193729_10176964	3300019887	Soil	MRYLKVAMLLLAVTLGTQACIFVPVGGGGHHHHGWR
Ga0193711_10298942	3300019997	Soil	MRYLTIWLLLLAVTVGTQACIFVPVGGGGGYRHHRHDDQR
Ga0193755_10941532	3300020004	Soil	MRYLKIVMLLLAVMVGTQACIIPVPIGGGGGRHHHRHDW
Ga0193726_10595384	3300020021	Soil	MRYLKIALVLLAVTFGTQACILPVPVGGGWHHHHGWR
Ga0193726_10760901	3300020021	Soil	MRYLRIAVLLLAVTFLAQACIFVPVPVGGGGGHHRRHYDDWR
Ga0193726_11066874	3300020021	Soil	MRYLRIALLLLAVTFGTQACIFVPVGGGGHHHHGWR
Ga0193716_12075772	3300020061	Soil	MRYLRIALLLLTVALTAQACILPVPVYPGGGHHHRGGRR
Ga0210407_100239895	3300020579	Soil	MRYIKIVLLLLAVTVGTQACFVVVGPERGWHHGWR
Ga0210407_101831052	3300020579	Soil	MRYLRIAVLLLAVTFATQACIFVPVGGGGGYHHRHRDDWR
Ga0210407_104276221	3300020579	Soil	MRYLRIMLLLMAVTFGTQACILFVPVGGGHHHGWR
Ga0210399_100392676	3300020581	Soil	MRYLRIMLLLMAVTFGTQACILFVPVDGGGGHHHHGGWR
Ga0210399_101099944	3300020581	Soil	MRYLRIVLLLMAVTFGTQACILFVPVGGGHHHGWR
Ga0210404_1000098611	3300021088	Soil	MRYLRIAVLLLAVTFVTQACIFVPVGGGGGYHHRHRDDWR
Ga0210404_107327402	3300021088	Soil	MRYLRIMLLLMAVTFGTQACILFVPVGGGGGHHHHGGWR
Ga0210384_1000463913	3300021432	Soil	MRYVKIVLLLLAVTVGTQACFVIVGPERGWHHGWR
Ga0210384_100603092	3300021432	Soil	MRYLRIALLLLAVTVGTQACILFVPVGGGGHHHHGWR
Ga0207647_104693932	3300025904	Corn Rhizosphere	MRYLTIWLLLLAVTVGTQACIFVPVGGGGGGHRHHRYDGQRSECLH
Ga0207645_100312112	3300025907	Miscanthus Rhizosphere	MRYLTIWLLLLAVTVGTQACIFVPVGGGGGGHRHHRYDGQR
Ga0207684_100050725	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	MRYLRIALLLLAVTFGTQACILPVPVGGGWHHHHGWR
Ga0207684_100137134	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	MRYLKIGLLLPAVTFGTQACILPVPVGGGWHHHHGWR
Ga0207684_105910402	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	MRYLRVALLLFAVTFVAQACIFVPVPVGGGGGHHRRHYDDWR
Ga0207684_112419512	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	FKEMSTMRYLKIVLLLLGVTVGTQACIIPIPVGGGGGHRHHRDDWR
Ga0207646_110766201	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	MRYLRIALLLLAVTVGTQACIFVPVPVGGGGGHHHR
Ga0209438_10650552	3300026285	Grasslands Soil	MRHVRILLLLLAVTIGTQACIFVPVPVGGGGHGGHRHH
Ga0209438_10844362	3300026285	Grasslands Soil	MRYLRIALLLLAVTFVTQACIFVPVPVDGGGHHHRHRDDWR
Ga0209240_12845422	3300026304	Grasslands Soil	MRYLKIGLLLLAVTFGTQACILPVGGGWHHHHGWR
Ga0257163_10126163	3300026359	Soil	MRYLNIVLLLLGVTVGTQACIIPVPVGGGGGHRHHHDEWR
Ga0257156_11353451	3300026498	Soil	MRYLKIVLLLLGVTVGTQACIIPVPVGGGGGHRHHHDDWR
Ga0179587_101472843	3300026557	Vadose Zone Soil	MRYLRVALLLLAVTFGTQACIFVPVPVGDGDGHHHRNHDDWR
Ga0209527_10036206	3300027583	Forest Soil	MRYLRVALLLLAVTFGTQACIFVPVGGGGHHHHGWR
Ga0209329_11212341	3300027605	Forest Soil	MRYLRVALLLLAVTFGTQACIFVPVPVGGGGGHHHRNHDDWR
Ga0209117_10615862	3300027645	Forest Soil	MRYLKIALLLLAVTFGTQACILPVPVGGGWHHHQGWR
Ga0209388_10049114	3300027655	Vadose Zone Soil	MRYLRIALLLLAVTFGTQACILPVPVGGGWHYHHHDWR
Ga0209388_10232853	3300027655	Vadose Zone Soil	MRFLKIVLLLLGVTVGTQACIIPVPVGGGGGGHRHHHDDWR
Ga0209074_101130243	3300027787	Agricultural Soil	LKIVLLLLGVTVGTQACIIPIPVGGGGGHRHHHDEWR
Ga0209180_103132612	3300027846	Vadose Zone Soil	MRYLKIGLLLLAVTFGTQACILPVPVGGGWHHHHGWR
Ga0209069_104714612	3300027915	Watersheds	IMRYLRIALLLLAVTVGTQACIVPVPVGPGWPHHHGWR
Ga0209526_100500343	3300028047	Forest Soil	MRYVRIALLLLAVTFGTQACIFVPVGGGGHHHHGWR
Ga0209526_104766563	3300028047	Forest Soil	MRYLKIVMLLLAVTVGTQACIIPVPIGGGDGGHHRHHRDW
Ga0307504_101937051	3300028792	Soil	MRYLKIVMLLLAVTVGTQACIIPVPIGGGDGGHHHHRRNW
Ga0307312_104822941	3300028828	Soil	DMRYLRIWLLLLAVTVGTQACIFVPVGGGGGHRHHRHDDQR
Ga0308178_11234922	3300030990	Soil	MRYLKIVLLLLGVTVATQACIIPVPVGGGGGHRHHHGEWR
(restricted) Ga0255310_100311934	3300031197	Sandy Soil	MRYLRIVLLLLAVTVGTQACILPIPVGPGWHHHHGWR
(restricted) Ga0255312_10244782	3300031248	Sandy Soil	MRYLRIVLLLLAVTLGTQACIVPVPVGPGWHHRHGWR
(restricted) Ga0255312_10980831	3300031248	Sandy Soil	MRYLRIVLLLLAVTVGTQACILPIPVGPGWHHHHG
Ga0310813_100664094	3300031716	Soil	MRYLRIALLLLAVTLGTQACIVPVPVGPGRHHHHGWR
Ga0307469_106740922	3300031720	Hardwood Forest Soil	MHYLRFAVLLLAVTFVTQACIFVPVPVGGGGGYHHRHRDDWR
Ga0307469_109646692	3300031720	Hardwood Forest Soil	MSTMRYLKIVLLLLGVTVGTQACIIPIPVGGGGGHRHHRDDWR
Ga0307473_100490843	3300031820	Hardwood Forest Soil	MHYLRIAVLLLAVTFVTQACIFVPVGGGGGYHHRHRDDWR
Ga0326729_10114912	3300033432	Peat Soil	MRYLRIALLLLAVTLGTQACIVPVPVGPGWHHHHGWR
Ga0326729_10158473	3300033432	Peat Soil	MRYVRVVLLLLAVTIGAQACIFVPVGGGGGHRHHRDWH
Ga0326726_100178594	3300033433	Peat Soil	MRYLRILLLLLAVTIGTQACIFIPVGGGGGHRHHHDWH
Ga0326726_106479803	3300033433	Peat Soil	MRYLRVVLLLLAVTIGAQACIFVPVGGGGGHRHHHDWH
Ga0316628_1001546054	3300033513	Soil	MRYLRILLLLLAVTIGTQACIFIPVGGGGGHRHHHGWH
Ga0326723_0011881_2386_2499	3300034090	Peat Soil	MRYLRIALLLLAVTLGTQACIVPVPVGPGWHHHHGGR
Ga0326723_0130438_14_130	3300034090	Peat Soil	MRYLRVVLLLLAVTIGAQACIFVPVGGGGGHRHHRDWH

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters