| Basic Information | |
|---|---|
| Family ID | F056848 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 137 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MPTIYIGSPAQIRDDLQARRDRFGLSYLVTSDRDLPTLSAVIAAL |
| Number of Associated Samples | 117 |
| Number of Associated Scaffolds | 137 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 5.84 % |
| % of genes near scaffold ends (potentially truncated) | 86.86 % |
| % of genes from short scaffolds (< 2000 bps) | 86.86 % |
| Associated GOLD sequencing projects | 108 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.58 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (81.022 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (40.146 % of family members) |
| Environment Ontology (ENVO) | Unclassified (46.715 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (40.876 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.36% β-sheet: 0.00% Coil/Unstructured: 61.64% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 137 Family Scaffolds |
|---|---|---|
| PF00291 | PALP | 7.30 |
| PF01027 | Bax1-I | 7.30 |
| PF04264 | YceI | 5.84 |
| PF13649 | Methyltransf_25 | 5.11 |
| PF01565 | FAD_binding_4 | 2.92 |
| PF00583 | Acetyltransf_1 | 2.19 |
| PF08240 | ADH_N | 2.19 |
| PF12681 | Glyoxalase_2 | 1.46 |
| PF14525 | AraC_binding_2 | 1.46 |
| PF00296 | Bac_luciferase | 1.46 |
| PF00248 | Aldo_ket_red | 1.46 |
| PF06325 | PrmA | 1.46 |
| PF00072 | Response_reg | 1.46 |
| PF03061 | 4HBT | 0.73 |
| PF01039 | Carboxyl_trans | 0.73 |
| PF12833 | HTH_18 | 0.73 |
| PF02913 | FAD-oxidase_C | 0.73 |
| PF00171 | Aldedh | 0.73 |
| PF12697 | Abhydrolase_6 | 0.73 |
| PF02687 | FtsX | 0.73 |
| PF12850 | Metallophos_2 | 0.73 |
| PF04326 | AlbA_2 | 0.73 |
| PF13738 | Pyr_redox_3 | 0.73 |
| PF00528 | BPD_transp_1 | 0.73 |
| PF06445 | GyrI-like | 0.73 |
| PF01243 | Putative_PNPOx | 0.73 |
| PF13602 | ADH_zinc_N_2 | 0.73 |
| PF05721 | PhyH | 0.73 |
| PF00903 | Glyoxalase | 0.73 |
| PF02837 | Glyco_hydro_2_N | 0.73 |
| PF07602 | DUF1565 | 0.73 |
| PF12847 | Methyltransf_18 | 0.73 |
| COG ID | Name | Functional Category | % Frequency in 137 Family Scaffolds |
|---|---|---|---|
| COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 5.84 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 1.46 |
| COG2264 | Ribosomal protein L11 methylase PrmA | Translation, ribosomal structure and biogenesis [J] | 1.46 |
| COG2890 | Methylase of polypeptide chain release factors | Translation, ribosomal structure and biogenesis [J] | 1.46 |
| COG3897 | Protein N-terminal and lysine N-methylase, NNT1/EFM7 family | Posttranslational modification, protein turnover, chaperones [O] | 1.46 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.73 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.73 |
| COG0777 | Acetyl-CoA carboxylase beta subunit | Lipid transport and metabolism [I] | 0.73 |
| COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 0.73 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.73 |
| COG2865 | Predicted transcriptional regulator, contains HTH domain | Transcription [K] | 0.73 |
| COG3250 | Beta-galactosidase/beta-glucuronidase | Carbohydrate transport and metabolism [G] | 0.73 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.73 |
| COG4799 | Acetyl-CoA carboxylase, carboxyltransferase component | Lipid transport and metabolism [I] | 0.73 |
| COG5285 | Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.73 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 81.02 % |
| Unclassified | root | N/A | 18.98 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004479|Ga0062595_100626378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 845 | Open in IMG/M |
| 3300005332|Ga0066388_107368153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 552 | Open in IMG/M |
| 3300005332|Ga0066388_108061273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. AA4 | 526 | Open in IMG/M |
| 3300005456|Ga0070678_101021303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 761 | Open in IMG/M |
| 3300005467|Ga0070706_100079031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3044 | Open in IMG/M |
| 3300005468|Ga0070707_102246154 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300005529|Ga0070741_10487086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1117 | Open in IMG/M |
| 3300005614|Ga0068856_101286886 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300005614|Ga0068856_101355418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 726 | Open in IMG/M |
| 3300005617|Ga0068859_102316262 | Not Available | 592 | Open in IMG/M |
| 3300005713|Ga0066905_100668835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 887 | Open in IMG/M |
| 3300005764|Ga0066903_102018450 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
| 3300005764|Ga0066903_104658340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 730 | Open in IMG/M |
| 3300006046|Ga0066652_100329474 | Not Available | 1367 | Open in IMG/M |
| 3300006173|Ga0070716_100095419 | All Organisms → cellular organisms → Bacteria | 1810 | Open in IMG/M |
| 3300006175|Ga0070712_101871549 | Not Available | 525 | Open in IMG/M |
| 3300006237|Ga0097621_102337700 | Not Available | 511 | Open in IMG/M |
| 3300006791|Ga0066653_10180184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1058 | Open in IMG/M |
| 3300006845|Ga0075421_100582711 | All Organisms → cellular organisms → Bacteria | 1317 | Open in IMG/M |
| 3300006854|Ga0075425_102615290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 557 | Open in IMG/M |
| 3300006904|Ga0075424_101030532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 877 | Open in IMG/M |
| 3300009038|Ga0099829_10783487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 792 | Open in IMG/M |
| 3300009090|Ga0099827_10237572 | All Organisms → cellular organisms → Bacteria | 1527 | Open in IMG/M |
| 3300009792|Ga0126374_10739016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 744 | Open in IMG/M |
| 3300010358|Ga0126370_11037150 | Not Available | 751 | Open in IMG/M |
| 3300010358|Ga0126370_11630673 | Not Available | 618 | Open in IMG/M |
| 3300010358|Ga0126370_12370373 | Not Available | 526 | Open in IMG/M |
| 3300010359|Ga0126376_12064421 | Not Available | 613 | Open in IMG/M |
| 3300010360|Ga0126372_10028574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3448 | Open in IMG/M |
| 3300010361|Ga0126378_11993677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 661 | Open in IMG/M |
| 3300010362|Ga0126377_12040075 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 650 | Open in IMG/M |
| 3300010366|Ga0126379_10130604 | All Organisms → cellular organisms → Bacteria | 2302 | Open in IMG/M |
| 3300010371|Ga0134125_10528688 | Not Available | 1305 | Open in IMG/M |
| 3300010373|Ga0134128_11475157 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300010376|Ga0126381_100578482 | All Organisms → cellular organisms → Bacteria | 1595 | Open in IMG/M |
| 3300010376|Ga0126381_101978830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 840 | Open in IMG/M |
| 3300010396|Ga0134126_12497008 | Not Available | 562 | Open in IMG/M |
| 3300010398|Ga0126383_11040160 | Not Available | 908 | Open in IMG/M |
| 3300012200|Ga0137382_10734988 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300012206|Ga0137380_11069915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 688 | Open in IMG/M |
| 3300012351|Ga0137386_10370079 | Not Available | 1031 | Open in IMG/M |
| 3300012357|Ga0137384_10139554 | All Organisms → cellular organisms → Bacteria | 2029 | Open in IMG/M |
| 3300012363|Ga0137390_11047472 | Not Available | 766 | Open in IMG/M |
| 3300012917|Ga0137395_10571625 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300012971|Ga0126369_10921546 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
| 3300012988|Ga0164306_10775830 | Not Available | 769 | Open in IMG/M |
| 3300013306|Ga0163162_11102184 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
| 3300015264|Ga0137403_10213624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1855 | Open in IMG/M |
| 3300016294|Ga0182041_10706588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 894 | Open in IMG/M |
| 3300016319|Ga0182033_10389244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes | 1175 | Open in IMG/M |
| 3300016341|Ga0182035_10913443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 775 | Open in IMG/M |
| 3300016357|Ga0182032_11953844 | Not Available | 514 | Open in IMG/M |
| 3300016404|Ga0182037_10545870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes | 978 | Open in IMG/M |
| 3300016404|Ga0182037_10551965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 972 | Open in IMG/M |
| 3300017924|Ga0187820_1192547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 633 | Open in IMG/M |
| 3300017926|Ga0187807_1260246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 570 | Open in IMG/M |
| 3300017932|Ga0187814_10126696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 948 | Open in IMG/M |
| 3300017974|Ga0187777_10068464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 2298 | Open in IMG/M |
| 3300018058|Ga0187766_10011332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5114 | Open in IMG/M |
| 3300018060|Ga0187765_10061528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1959 | Open in IMG/M |
| 3300020199|Ga0179592_10023706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2744 | Open in IMG/M |
| 3300021404|Ga0210389_11431203 | Not Available | 527 | Open in IMG/M |
| 3300021560|Ga0126371_13382688 | Not Available | 539 | Open in IMG/M |
| 3300022467|Ga0224712_10679227 | Not Available | 506 | Open in IMG/M |
| 3300025922|Ga0207646_10639293 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
| 3300025925|Ga0207650_11697324 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 535 | Open in IMG/M |
| 3300025939|Ga0207665_10598489 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 861 | Open in IMG/M |
| 3300026078|Ga0207702_11652021 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300026319|Ga0209647_1046640 | All Organisms → cellular organisms → Bacteria | 2370 | Open in IMG/M |
| 3300026498|Ga0257156_1122283 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300026557|Ga0179587_10370567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 931 | Open in IMG/M |
| 3300027516|Ga0207761_1075842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 653 | Open in IMG/M |
| 3300027646|Ga0209466_1079967 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300027766|Ga0209796_10148095 | Not Available | 735 | Open in IMG/M |
| 3300027882|Ga0209590_10020735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3312 | Open in IMG/M |
| 3300027909|Ga0209382_10630738 | All Organisms → cellular organisms → Bacteria | 1163 | Open in IMG/M |
| 3300031544|Ga0318534_10033706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 2808 | Open in IMG/M |
| 3300031544|Ga0318534_10057135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2193 | Open in IMG/M |
| 3300031544|Ga0318534_10231956 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
| 3300031564|Ga0318573_10735799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 530 | Open in IMG/M |
| 3300031573|Ga0310915_11153437 | Not Available | 537 | Open in IMG/M |
| 3300031668|Ga0318542_10173868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes | 1078 | Open in IMG/M |
| 3300031668|Ga0318542_10766357 | Not Available | 505 | Open in IMG/M |
| 3300031679|Ga0318561_10194602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1099 | Open in IMG/M |
| 3300031682|Ga0318560_10394015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 749 | Open in IMG/M |
| 3300031715|Ga0307476_10366899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1061 | Open in IMG/M |
| 3300031723|Ga0318493_10332760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 823 | Open in IMG/M |
| 3300031723|Ga0318493_10369211 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300031724|Ga0318500_10119023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1219 | Open in IMG/M |
| 3300031724|Ga0318500_10199747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 957 | Open in IMG/M |
| 3300031736|Ga0318501_10104998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1414 | Open in IMG/M |
| 3300031736|Ga0318501_10519810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 650 | Open in IMG/M |
| 3300031744|Ga0306918_11242894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 574 | Open in IMG/M |
| 3300031747|Ga0318502_10102721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1587 | Open in IMG/M |
| 3300031748|Ga0318492_10022205 | All Organisms → cellular organisms → Bacteria | 2772 | Open in IMG/M |
| 3300031748|Ga0318492_10377968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 743 | Open in IMG/M |
| 3300031748|Ga0318492_10588515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 593 | Open in IMG/M |
| 3300031748|Ga0318492_10722812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 534 | Open in IMG/M |
| 3300031751|Ga0318494_10073052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes | 1851 | Open in IMG/M |
| 3300031763|Ga0318537_10288531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 607 | Open in IMG/M |
| 3300031769|Ga0318526_10112006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes | 1095 | Open in IMG/M |
| 3300031771|Ga0318546_11254869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 520 | Open in IMG/M |
| 3300031778|Ga0318498_10021747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2723 | Open in IMG/M |
| 3300031779|Ga0318566_10247678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 883 | Open in IMG/M |
| 3300031793|Ga0318548_10044518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 2006 | Open in IMG/M |
| 3300031795|Ga0318557_10165414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1003 | Open in IMG/M |
| 3300031796|Ga0318576_10165299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1035 | Open in IMG/M |
| 3300031799|Ga0318565_10030080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 2453 | Open in IMG/M |
| 3300031805|Ga0318497_10264208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 956 | Open in IMG/M |
| 3300031819|Ga0318568_10700890 | Not Available | 629 | Open in IMG/M |
| 3300031835|Ga0318517_10334569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 684 | Open in IMG/M |
| 3300031860|Ga0318495_10030268 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2360 | Open in IMG/M |
| 3300031879|Ga0306919_10379485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1082 | Open in IMG/M |
| 3300031893|Ga0318536_10446941 | Not Available | 651 | Open in IMG/M |
| 3300031897|Ga0318520_10006184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4874 | Open in IMG/M |
| 3300031897|Ga0318520_10272724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1014 | Open in IMG/M |
| 3300031910|Ga0306923_11339153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 757 | Open in IMG/M |
| 3300031945|Ga0310913_10826582 | Not Available | 653 | Open in IMG/M |
| 3300031954|Ga0306926_10185483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2581 | Open in IMG/M |
| 3300032008|Ga0318562_10526667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → unclassified Arthrobacter → Arthrobacter sp. Br18 | 684 | Open in IMG/M |
| 3300032025|Ga0318507_10514348 | Not Available | 521 | Open in IMG/M |
| 3300032039|Ga0318559_10244620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 829 | Open in IMG/M |
| 3300032039|Ga0318559_10358688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 679 | Open in IMG/M |
| 3300032043|Ga0318556_10056472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes | 1911 | Open in IMG/M |
| 3300032052|Ga0318506_10143314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1043 | Open in IMG/M |
| 3300032054|Ga0318570_10223786 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 852 | Open in IMG/M |
| 3300032054|Ga0318570_10245095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 812 | Open in IMG/M |
| 3300032055|Ga0318575_10415263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 683 | Open in IMG/M |
| 3300032060|Ga0318505_10407033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 643 | Open in IMG/M |
| 3300032068|Ga0318553_10280267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 871 | Open in IMG/M |
| 3300032089|Ga0318525_10186180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes | 1067 | Open in IMG/M |
| 3300032089|Ga0318525_10261287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 890 | Open in IMG/M |
| 3300032090|Ga0318518_10405932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 699 | Open in IMG/M |
| 3300032261|Ga0306920_101150565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1123 | Open in IMG/M |
| 3300032828|Ga0335080_11040264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 832 | Open in IMG/M |
| 3300033158|Ga0335077_10886136 | Not Available | 900 | Open in IMG/M |
| 3300033290|Ga0318519_10518369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 719 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 40.15% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.22% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.03% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.11% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.38% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.92% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.19% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.19% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.19% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.46% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.46% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.73% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.73% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.73% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.73% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.73% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.73% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.73% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.73% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.73% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.73% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.73% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027516 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 34 (SPAdes) | Environmental | Open in IMG/M |
| 3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027766 | Agave microbial communities from Guanajuato, Mexico - Or.Sf.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062595_1006263781 | 3300004479 | Soil | LFVGSVAQIREDLAARRDRFGLSYLVTADRDLPTLAEIAASG* |
| Ga0066388_1073681532 | 3300005332 | Tropical Forest Soil | TVFIGSVAQIRDDLQARRDRFGLSYLITPERELPALAAVVAGP* |
| Ga0066388_1080612731 | 3300005332 | Tropical Forest Soil | TVFIGSVAQIRDDLQARRDRFGLSYLITPERELPALAAVAAGP* |
| Ga0070678_1010213032 | 3300005456 | Miscanthus Rhizosphere | PTILIGSAAQIRDDLEQRRARFGLSYLVTSDKDLPTLTRVIDAW* |
| Ga0070706_1000790315 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | IGSPAQIRDDLQARRDRFGLSYLVTSDRDLPTLSAVIAAL* |
| Ga0070707_1022461542 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | FIGSVAQIREDLQARRERFGLSYLITPDQELPTLAAIIAGS* |
| Ga0070741_104870862 | 3300005529 | Surface Soil | MPTIFIGSVEQIREDLAARRELFGLSYLVTPDRDLPALAKITAG* |
| Ga0068856_1012868862 | 3300005614 | Corn Rhizosphere | VAQIRADLQARRERFGLSYLVTPDRELPTLAAVMAGS* |
| Ga0068856_1013554181 | 3300005614 | Corn Rhizosphere | WQMPTIFIGSVAQIREDLEARRERFGLSYLVTPDRDLPA* |
| Ga0068859_1023162622 | 3300005617 | Switchgrass Rhizosphere | GSVAQIRADLQARRERFGLSYLVTPDRELPTLAAIMAGS* |
| Ga0066905_1006688352 | 3300005713 | Tropical Forest Soil | GIDVEAVWQMPTIYIGSPAQIRDDLQARRDRFGLSYLVTSDRDLPALSKVIAGL* |
| Ga0066903_1020184501 | 3300005764 | Tropical Forest Soil | GSVAQIRDDLQARRDRFGLSYLITPERELPALAAVVAGP* |
| Ga0066903_1046583403 | 3300005764 | Tropical Forest Soil | MPTVFIGSVAQIRDDLQARRDRFGLSYLITPERELPALAAIVAGP* |
| Ga0066652_1003294743 | 3300006046 | Soil | HVTIAAEDVWQMPTIFIGSVAQIREDLQAGASGGLSCLVTPDHDLPALTAIIAGS* |
| Ga0070716_1000954192 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VAQIRADLQARRERFGLSYLVTLDRELPTLAAVMAGS* |
| Ga0070712_1018715492 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | IHQDLAARRDRFGLSYLVTADRELPALAEIAARG* |
| Ga0097621_1023377001 | 3300006237 | Miscanthus Rhizosphere | VAQIRADLQARRERFGLSYLVTPDRELPTLAAIMAGS* |
| Ga0066653_101801843 | 3300006791 | Soil | SGIDAEAVWGMPTVFIGSVTQIRADLQARRDRFGLSYLITPDRELPALAAVIAGQ* |
| Ga0075421_1005827113 | 3300006845 | Populus Rhizosphere | AETVWQMPTVYIGSAAQIREDLRARRERFGLSYLVAPDRDLPVLAEVIAGL* |
| Ga0075425_1026152902 | 3300006854 | Populus Rhizosphere | DAETVWQMPTVYIGSAAQIREDLRARRERFGLSYLVAPDRDLPVLAEVIAGL* |
| Ga0075424_1010305323 | 3300006904 | Populus Rhizosphere | VWEMPTVFIGSVAQIHDDLQARRDRFGLSYLITPDRELPVLSAVIAGT* |
| Ga0099829_107834871 | 3300009038 | Vadose Zone Soil | VDAVWQMPAIYIGSPAQIRDDLQARCERFGLSYLVTSDRDLPTLTEVIAGV* |
| Ga0099827_102375723 | 3300009090 | Vadose Zone Soil | MPTVFIGSAAQIRDDLRARRDRFGLSYLISSDRDLPALAEIIAGL* |
| Ga0126374_107390161 | 3300009792 | Tropical Forest Soil | IRDDLQARRDRFGLSYLVTSDRDLPALSKIIAGL* |
| Ga0126370_110371502 | 3300010358 | Tropical Forest Soil | ETVWDMPTVFIGSVAQIRDDLQARRDRFGLSYLITPERELPALAAVAAGP* |
| Ga0126370_116306732 | 3300010358 | Tropical Forest Soil | SVAQIRDDLQARRDRFGLSYLITPDRELPTLAAVVAGP* |
| Ga0126370_123703732 | 3300010358 | Tropical Forest Soil | VGSPEQIRADLRERRERFGLSYLITPDHQLPVLAQVIGGL* |
| Ga0126376_120644212 | 3300010359 | Tropical Forest Soil | ETAWQMPTLFVGSPEQIRADLRERRERFGLSYLITPDHQLPVLAQVIGGL* |
| Ga0126372_100285745 | 3300010360 | Tropical Forest Soil | MPAILIGSAAQIRENLQARRERFGLSNLVTSDRALPALTEIIASF* |
| Ga0126378_119936772 | 3300010361 | Tropical Forest Soil | EMPTVFIGSVAQIRDDLQARRDRFGLSYLITPDRELPALAAVIAGT* |
| Ga0126377_120400752 | 3300010362 | Tropical Forest Soil | FIGSVAQIREDLQARRERFGLSYLVTPDRELPTLAAIIAGS* |
| Ga0126379_101306044 | 3300010366 | Tropical Forest Soil | AQIRDDLQARRERFGLSYLVTSDHDLPALSTVIAAL* |
| Ga0134125_105286882 | 3300010371 | Terrestrial Soil | VAQIRADLQARRERFGLTYLVTPDRELPTLAAIMAGS* |
| Ga0134128_114751571 | 3300010373 | Terrestrial Soil | IGSAAQIREDLRARRERFGLSYLVAPDRDLPVLAEVIAGL* |
| Ga0126381_1005784823 | 3300010376 | Tropical Forest Soil | FIGSVAQIRDDLQARRDRFGLSYLITPERELPALAAVVAGP* |
| Ga0126381_1019788301 | 3300010376 | Tropical Forest Soil | GSAAQIREDLQARRDRFGLSYLITPDRELPALAAVIAGT* |
| Ga0134126_124970081 | 3300010396 | Terrestrial Soil | GIDAEAVWQMPTIFVGSVAQIHQDLAARRDRFGLSYLVTADRELPALAEIAARG* |
| Ga0126383_110401601 | 3300010398 | Tropical Forest Soil | IFIGSVAQIREDLQARRERFGLSYLVTPDRELPTLAAVIAGS* |
| Ga0137382_107349882 | 3300012200 | Vadose Zone Soil | SAAQIREDLQARRERFGLSYLVAPDRDLLMLAEVIAGL* |
| Ga0137380_110699152 | 3300012206 | Vadose Zone Soil | VWEMPTILIGSAAQIRADLHARRERFGLSYLVTTDRALPALTEIIAGLPDRIP* |
| Ga0137386_103700791 | 3300012351 | Vadose Zone Soil | ETVWQMPTLFIGSVAQIWEDLRSRRGRFGLSYLITSDSELPTLTQVIDGL* |
| Ga0137384_101395544 | 3300012357 | Vadose Zone Soil | DVNAVWEMPTVLIGSVTQIRADLQARQERFGLSYLVTSDRALPTLTEIIASL* |
| Ga0137390_110474722 | 3300012363 | Vadose Zone Soil | WQMPTLFIGSVAQIREDLRARRDRFGLSYLITSDSELPTLTQVIDGL* |
| Ga0137395_105716253 | 3300012917 | Vadose Zone Soil | WSGIDVEAVWEMPTVFIGSEAQIRDDLRARRDRFGLSYLITPDRELPVLAAVIAGG* |
| Ga0126369_109215464 | 3300012971 | Tropical Forest Soil | DAVWRMPTIYIGSPAQVRDDLQARRDRFGLSYLITSDRDLTTLNAVIAAL* |
| Ga0164306_107758302 | 3300012988 | Soil | AQIRADLQARRERFGLSYLVTPDRELPTLAAIMAGS* |
| Ga0163162_111021842 | 3300013306 | Switchgrass Rhizosphere | WQMPTVYIGSAAQIREDLRARRERFGLSYLVAPDRDLPVLAEVIAGL* |
| Ga0137403_102136242 | 3300015264 | Vadose Zone Soil | MPTILIGSAAQIREDLQARRERFGLSYLITTDRALPALTEIIASL* |
| Ga0182041_107065881 | 3300016294 | Soil | YIGSPAQIRADLQARRDRFGLSYLVTSDRDLPTLGTVIAAL |
| Ga0182033_103892441 | 3300016319 | Soil | MPTIYIGSPAQIRADLQARRDRFGLSYLVTSDRDLPTLSTVIAAL |
| Ga0182035_109134431 | 3300016341 | Soil | DVETVWQMPTIYIGSPAQIRADLQARRDRFGLSYLVTSDRDLPTLSAVIAAL |
| Ga0182032_119538441 | 3300016357 | Soil | TVWQMPTIYIGSPAQIRADLQARRDRFGLSYLVTSDRDLPTLSAVIAAL |
| Ga0182037_105458703 | 3300016404 | Soil | GSPAQVREDLQARRDRFGVSYLITSDRDLSTLNAVTAAR |
| Ga0182037_105519652 | 3300016404 | Soil | WQMPTIYIGSPAQIRDDLQARRDRFGLSYLVTSDRDLPTLSTVIAAL |
| Ga0187820_11925472 | 3300017924 | Freshwater Sediment | VWDMPTIYIGSIAQIRDDLRARRERFGLAYLITPDREQSALARVIAGL |
| Ga0187807_12602462 | 3300017926 | Freshwater Sediment | MPTIYIGSIAQIRDDLRARREGFGLAYLITPDREQSALARVIAGL |
| Ga0187814_101266962 | 3300017932 | Freshwater Sediment | MPTIYIGSIAQIRDDLRARRERFGLAYLITPDREQSALARVIAGL |
| Ga0187777_100684645 | 3300017974 | Tropical Peatland | VLIGSAGQIREDLQARRDRFGLSYLVTSDRTLPALTKIIAAF |
| Ga0187766_100113321 | 3300018058 | Tropical Peatland | SIAQIRDDLRARRERFGLAYLITPDHEQSALARVIAGL |
| Ga0187765_100615283 | 3300018060 | Tropical Peatland | VAQIREDLQARRERFGLSYLVTPDHDLPTLAAVIAGS |
| Ga0179592_100237061 | 3300020199 | Vadose Zone Soil | QIREDLQARRERFGLSYLVTSDRALPALAEIIAGL |
| Ga0210389_114312031 | 3300021404 | Soil | TIFIGSVGQIQADLQARRERFGLSYLVTPDRDLPALTKIIASL |
| Ga0126371_133826881 | 3300021560 | Tropical Forest Soil | IYIGSPAQIRADLQARRDRFGLSYLVTSDRDLPTLSTVIAAM |
| Ga0224712_106792272 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | VFIGSVAQIRADLQARRERFGLSYLVTLDRELPTLAAVMAGS |
| Ga0207646_106392933 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | FIGSVAQIREDLQARRERFGLSYLITPDQELPTLAAIIAGS |
| Ga0207650_116973242 | 3300025925 | Switchgrass Rhizosphere | IGSAAQIRDDLEQRRERFGLSYLVTSDKDLPTLTRVIAAW |
| Ga0207665_105984892 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VAQIRADLQARRERFGLSYLVTLDRELPTLAAVMAGS |
| Ga0207702_116520211 | 3300026078 | Corn Rhizosphere | PTVYIGSAAQIREDLRARRERFGLSYLVAPDRDLPVLAEVIAGL |
| Ga0209647_10466403 | 3300026319 | Grasslands Soil | GSVAQIREDLEARRERFGLSYLVTSDRALPALTEIIASL |
| Ga0257156_11222832 | 3300026498 | Soil | MPTIYIGSPAQIRDDLQARRDRFGLSYLVTSDRDLPTLSAVIAAL |
| Ga0179587_103705671 | 3300026557 | Vadose Zone Soil | TIFIGSVEQIRADLQARRERFGLSYLVTPDRDRPALAKIIASL |
| Ga0207761_10758422 | 3300027516 | Tropical Forest Soil | IEVEAVWDMPTIYIGSIAQIRDDLRARRERFGLAYLVTPDREQSALARVIAGL |
| Ga0209466_10799671 | 3300027646 | Tropical Forest Soil | MPTIYIGSVSQIREDLEARRERFGLSYLVTPDRDLPTLAEVITGL |
| Ga0209796_101480952 | 3300027766 | Agave | VGSAGQIRDDLRERRARFGLSYLVTSDADLPVLEIVIAGL |
| Ga0209590_100207352 | 3300027882 | Vadose Zone Soil | VETVWDMPTVFIGSAAQIRDDLRARRDRFGLSYLISSDRDLPALAEIIAGL |
| Ga0209382_106307381 | 3300027909 | Populus Rhizosphere | DAETVWQMPTVYIGSAAQIREDLRARRERFGLSYLVAPDRDLPVLAEVIAGL |
| Ga0318534_100337062 | 3300031544 | Soil | TVWEMPSVFIGSVAQIRDDLQARRDRFGLSYLITPDRELPVLAAIVAGP |
| Ga0318534_100571351 | 3300031544 | Soil | MPTIYIGSMAQIRDDLRARRERFGLSYLVTPDRELPTLAQVIAGL |
| Ga0318534_102319563 | 3300031544 | Soil | VWDMPTVFIGSVAQIRDDLQARRDRFGLSYLITPDRELPALAAVIAGT |
| Ga0318573_107357991 | 3300031564 | Soil | TVWQMPTIYIGSPAQIRDDLQARRDRFGLSYLVTSDRDLPTLSTVIAAL |
| Ga0310915_111534371 | 3300031573 | Soil | DVEAVWQMPTIYIGSPAQIRDDLQARRDRFGLSYLITSDRDLTTLNAVIAAL |
| Ga0318542_101738681 | 3300031668 | Soil | EALWQMPTIYIGSPAQIHEDLQARRERFGLSYLITSDRDLPTLGAVIAAR |
| Ga0318542_107663571 | 3300031668 | Soil | IDVETVWQMPTIYIGSPAQIRADLQARRDRFGLSYLVTSDRDLPTLSTVIAAL |
| Ga0318561_101946021 | 3300031679 | Soil | HIGSAAQIRDDLRARAERFGLTYLVTSDRDLPTLAEIAAGM |
| Ga0318560_103940152 | 3300031682 | Soil | WEMPTIFIGSPAQIRDDLQARRDRFGLSYLVTSDRDLPTLSAVIAGL |
| Ga0307476_103668991 | 3300031715 | Hardwood Forest Soil | AGTEVSTVWEMPTLFIGSVAQIREDLRARQERFGLSYLIATGRDLPGLTEIVGGL |
| Ga0318493_103327601 | 3300031723 | Soil | QIHEDLQARRERFGLSYLITSDRDLPTLGAVIAAR |
| Ga0318493_103692113 | 3300031723 | Soil | IGSVAQIRDDLQARRDRFGLSYLITPDSELPTLTAVIAGQ |
| Ga0318500_101190231 | 3300031724 | Soil | PTIYIGSMAQIRDDLRARRERFGLSYLVTPDRELPTLAQVIAGL |
| Ga0318500_101997472 | 3300031724 | Soil | IGSPAQIRADLQARRDRFGLSYLVTSDRDLPTLSAVIAAL |
| Ga0318501_101049983 | 3300031736 | Soil | AQIRDDLRARRERFGLSYLVTPDRELPTLAQVIAGL |
| Ga0318501_105198101 | 3300031736 | Soil | DVETVWQMPTIYIGSPAQIRDDLQARRDRFGLSYLVTSDRDLPTLSTVIAAL |
| Ga0306918_112428942 | 3300031744 | Soil | QMPTIHIGSAAQIRDDLRARAERFGLTYLVTSDRDLPTLAEIAAGM |
| Ga0318502_101027211 | 3300031747 | Soil | RGHAGPLQRLPAPIYIGSMAQIRDDLRARRERFGLSYLVTPDRELPTLAQVIAGL |
| Ga0318492_100222051 | 3300031748 | Soil | IDVETVWQMPTIYIGSPAQIRADLQARRDRFGLSYLVTSDRDLPTLSAVIAAL |
| Ga0318492_103779683 | 3300031748 | Soil | VWDMPTIYIGSMAQIRDDLRARRERFGLSYLVTPDRELPTLAQVIAGL |
| Ga0318492_105885151 | 3300031748 | Soil | VWDMPTVFIGSPGQIRDDLQARRERFGLSYLITPDRELPVLAAVIAAL |
| Ga0318492_107228121 | 3300031748 | Soil | QMPTIYIGSPAQIRDDLRARRDRFGLSYLVTSDRDLPTLGTVIAAL |
| Ga0318494_100730523 | 3300031751 | Soil | PAQIRDDLQARRDRFGLSYLVTSDRDLPTLSAVIAGL |
| Ga0318537_102885311 | 3300031763 | Soil | GWEGIEVEAVWQMPTIYIGSPAQIHEDLQARRERFGLSYLITSDRDLPTLGAVIAAR |
| Ga0318526_101120063 | 3300031769 | Soil | VEAVWQMPTIYIGSPAQIHEDLQARRERFGLSYLITSDRDLPTLGAVIAAR |
| Ga0318546_112548692 | 3300031771 | Soil | QIRDDLRARAERFGLTYLVTSDRDLPTLAEIAAGM |
| Ga0318498_100217472 | 3300031778 | Soil | MAQIRDDLRARRERFGLSYLVTPDRELPTLAQVIAGL |
| Ga0318566_102476782 | 3300031779 | Soil | YICSPAQIRDDLQARRDRFGLSYLVTSDRDLPTLSTVIAAL |
| Ga0318548_100445182 | 3300031793 | Soil | SGIDAETVWEMPTVFIGSVAQIRDDLQARRDRFGLSYLITPDRELPVLAAIVAGP |
| Ga0318557_101654141 | 3300031795 | Soil | QMPTIYIGSPAQIHEDLQARRERFGLSYLITSDRDLPTLGAVIAAR |
| Ga0318576_101652992 | 3300031796 | Soil | QMPTIYIGSPAQIRADLQARRDRFGLSYLVTSDRDLPTLSTVIAAL |
| Ga0318565_100300801 | 3300031799 | Soil | EMPSVFIGSVAQIRDDLQARRDRFGLSYLITPDRELPVLAAIVAGP |
| Ga0318497_102642082 | 3300031805 | Soil | AETVWEMPTVFIGSVAQIRDDLQARRDRFGLSYLITPDSELPTLAAVIAGQ |
| Ga0318568_107008901 | 3300031819 | Soil | VWQMPTIYIGSPAQIRDDLQARRDRFGLSYLVTSDRDLPTLSTVIAAL |
| Ga0318517_103345691 | 3300031835 | Soil | GTVWQMPTIHIGSAAQIRDDLRARAERFGLTYLVTSDRDLPTLAEIAAGM |
| Ga0318495_100302684 | 3300031860 | Soil | PAQIRADLQARRDRFGLSYLVTSDRDLPTLSAVIAAL |
| Ga0306919_103794853 | 3300031879 | Soil | PTIYIGSPAQVRDDLQARRDRFGLSYLITSDRDLTTLNAVIAAL |
| Ga0318536_104469411 | 3300031893 | Soil | MPTIYIGSPAQIRADLQARRDRFGLSYLVTSDRDLPTLSAVIAAL |
| Ga0318520_100061844 | 3300031897 | Soil | SVFIGSVAQIRDDLQARRDRFGLSYLITPDRELPVLAAIVAGP |
| Ga0318520_102727243 | 3300031897 | Soil | DMPTIYIGSMAQIRDDLRARRERFGLSYLVTPDRELPTLAQVIAGL |
| Ga0306923_113391531 | 3300031910 | Soil | VEAVWQMPTIFIGSPAQIRDDLQARRDRFGLSYLVTSDRDLPTLSAVIAGL |
| Ga0310913_108265821 | 3300031945 | Soil | SGIDAETVWEMPSVFIGSVAQIRDDLQARRDRFGLSYLITPDRELPVLAAIVVGP |
| Ga0306926_101854835 | 3300031954 | Soil | MAQIRDDLRARRERFGLSYLVTPGRELPTLAQVIAGL |
| Ga0318562_105266672 | 3300032008 | Soil | PTVFIGSPGQIRDDLQARRERFGLSYLITPDRELPVLAAVIAAL |
| Ga0318507_105143482 | 3300032025 | Soil | PAQIRADLQARRDRFGLSYLVTSDRDLPTLGTVIAAL |
| Ga0318559_102446202 | 3300032039 | Soil | IGSPAQIRDDLQARRDRFGLSYLVTSDRDLPTLSTVIAAL |
| Ga0318559_103586881 | 3300032039 | Soil | AQIRADLQARYDRFGLSYLVTSDRDLPTLSAVIAAL |
| Ga0318556_100564723 | 3300032043 | Soil | QMPTIYIGSPAQIRADLQARRDRFGLSYLVTSDRDLPTLSAVIAAL |
| Ga0318506_101433141 | 3300032052 | Soil | GSPAQIRADLQARRDRFGLSYLVTSDRDLPTLSAVIAAL |
| Ga0318570_102237861 | 3300032054 | Soil | AQIRDDLQARRDRFGLSYLVTSDRDLPTLSAVIAGL |
| Ga0318570_102450951 | 3300032054 | Soil | EGIGVEAVWQMPTIYIGSPAQIHEDLQARRERFGLSYLITSDRDLPTLGAVIAAR |
| Ga0318575_104152631 | 3300032055 | Soil | IYIGSPAQIRDDLRARRERFGLSYLVTSDRDLPTLSTVIAAL |
| Ga0318505_104070333 | 3300032060 | Soil | LQRLPAPIYIGSMAQIRDDLRARRERFGLSYLVTPGRELPTLAQVIAGL |
| Ga0318553_102802672 | 3300032068 | Soil | VWQMPTIYIGSPAQIRADLQARRDRFGLSYLVTSDRDLPTLSAVIAAL |
| Ga0318525_101861803 | 3300032089 | Soil | IGSPAQIRDDLQARRDRFGLSYLVTSDRDLPTLSAVIAGL |
| Ga0318525_102612871 | 3300032089 | Soil | IYIGSPAQIRDDLQARRDRFGLSYLVTSDRDLPTLSTVIAAL |
| Ga0318518_104059323 | 3300032090 | Soil | YIGSMAQIRDDLRARRERFGLSYLVTPDRELPTLAQVIAGL |
| Ga0306920_1011505652 | 3300032261 | Soil | MPTIYIGSPAQIRDDLQARRDRFGLSYLITSDRDLSTLNAVTAAR |
| Ga0335080_110402642 | 3300032828 | Soil | GAVWQMPTIFVGSVAQIHEDLAARRDRFGLSYLVTADRELPALAEIAARG |
| Ga0335077_108861361 | 3300033158 | Soil | DVWQMPAIFIGSAAQIREDLQARRERFGLSYLVTPDRELPTLAAIIAGS |
| Ga0318519_105183693 | 3300033290 | Soil | IGSMAQIRDDLRARRERFGLSYLVTPDRELPTLAQVIAGL |
| ⦗Top⦘ |