NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F056830

Metagenome Family F056830

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F056830
Family Type Metagenome
Number of Sequences 137
Average Sequence Length 46 residues
Representative Sequence LDTYHVVLYIHLLALFIGIGAASILLVCLFQLRAAQTLADAVPWGSVA
Number of Associated Samples 120
Number of Associated Scaffolds 137

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 96.27 %
% of genes near scaffold ends (potentially truncated) 95.62 %
% of genes from short scaffolds (< 2000 bps) 94.16 %
Associated GOLD sequencing projects 116
AlphaFold2 3D model prediction Yes
3D model pTM-score0.52

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (79.562 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(14.598 % of family members)
Environment Ontology (ENVO) Unclassified
(23.358 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(56.204 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 55.26%    β-sheet: 0.00%    Coil/Unstructured: 44.74%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.52
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 137 Family Scaffolds
PF00571CBS 5.84
PF07992Pyr_redox_2 5.11
PF00753Lactamase_B 5.11
PF00400WD40 4.38
PF13450NAD_binding_8 3.65
PF13088BNR_2 2.92
PF00795CN_hydrolase 2.92
PF00118Cpn60_TCP1 2.92
PF00202Aminotran_3 2.92
PF01717Meth_synt_2 2.19
PF03631Virul_fac_BrkB 2.19
PF12697Abhydrolase_6 1.46
PF00664ABC_membrane 1.46
PF13602ADH_zinc_N_2 1.46
PF02789Peptidase_M17_N 0.73
PF06026Rib_5-P_isom_A 0.73
PF04237YjbR 0.73
PF01039Carboxyl_trans 0.73
PF00112Peptidase_C1 0.73
PF03006HlyIII 0.73
PF07883Cupin_2 0.73
PF12840HTH_20 0.73
PF00999Na_H_Exchanger 0.73
PF13424TPR_12 0.73
PF07719TPR_2 0.73
PF08402TOBE_2 0.73
PF01895PhoU 0.73
PF01565FAD_binding_4 0.73
PF06925MGDG_synth 0.73
PF13360PQQ_2 0.73
PF02036SCP2 0.73
PF00903Glyoxalase 0.73
PF00127Copper-bind 0.73
PF12680SnoaL_2 0.73
PF10944DUF2630 0.73
PF00293NUDIX 0.73
PF04101Glyco_tran_28_C 0.73
PF04151PPC 0.73
PF13091PLDc_2 0.73
PF00582Usp 0.73

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 137 Family Scaffolds
COG0459Chaperonin GroEL (HSP60 family)Posttranslational modification, protein turnover, chaperones [O] 2.92
COG0620Methionine synthase II (cobalamin-independent)Amino acid transport and metabolism [E] 2.19
COG1295Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase)Function unknown [S] 2.19
COG0025NhaP-type Na+/H+ or K+/H+ antiporterInorganic ion transport and metabolism [P] 0.73
COG0120Ribose 5-phosphate isomeraseCarbohydrate transport and metabolism [G] 0.73
COG0260Leucyl aminopeptidaseAmino acid transport and metabolism [E] 0.73
COG0475Kef-type K+ transport system, membrane component KefBInorganic ion transport and metabolism [P] 0.73
COG0707UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferaseCell wall/membrane/envelope biogenesis [M] 0.73
COG0777Acetyl-CoA carboxylase beta subunitLipid transport and metabolism [I] 0.73
COG0825Acetyl-CoA carboxylase alpha subunitLipid transport and metabolism [I] 0.73
COG1272Predicted membrane channel-forming protein YqfA, hemolysin III familyIntracellular trafficking, secretion, and vesicular transport [U] 0.73
COG2315Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR familyTranscription [K] 0.73
COG3004Na+/H+ antiporter NhaAEnergy production and conversion [C] 0.73
COG3263NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domainsEnergy production and conversion [C] 0.73
COG4651Predicted Kef-type K+ transport protein, K+/H+ antiporter domainInorganic ion transport and metabolism [P] 0.73
COG4799Acetyl-CoA carboxylase, carboxyltransferase componentLipid transport and metabolism [I] 0.73


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms79.56 %
UnclassifiedrootN/A20.44 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908045|KansclcFeb2_ConsensusfromContig806158All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1064Open in IMG/M
2166559005|cont_contig44597All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria893Open in IMG/M
2166559006|FI_contig23506All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria642Open in IMG/M
2170459002|F0B48LX02FJ9ZLAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria524Open in IMG/M
2189573002|GZIGXIF02HHW2BAll Organisms → cellular organisms → Bacteria → Terrabacteria group511Open in IMG/M
3300000956|JGI10216J12902_112969154All Organisms → cellular organisms → Bacteria → Terrabacteria group703Open in IMG/M
3300001686|C688J18823_10468390All Organisms → cellular organisms → Bacteria → Terrabacteria group810Open in IMG/M
3300002244|JGI24742J22300_10115198All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium528Open in IMG/M
3300004081|Ga0063454_101519568Not Available574Open in IMG/M
3300004153|Ga0063455_100759780All Organisms → cellular organisms → Bacteria664Open in IMG/M
3300004643|Ga0062591_102269355All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium566Open in IMG/M
3300004643|Ga0062591_102433994All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300005169|Ga0066810_10179636Not Available521Open in IMG/M
3300005171|Ga0066677_10514899All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria687Open in IMG/M
3300005176|Ga0066679_10524924All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria771Open in IMG/M
3300005178|Ga0066688_10098755All Organisms → cellular organisms → Bacteria1781Open in IMG/M
3300005294|Ga0065705_10031234All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1136Open in IMG/M
3300005294|Ga0065705_10744626Not Available633Open in IMG/M
3300005336|Ga0070680_101218626All Organisms → cellular organisms → Bacteria → Terrabacteria group651Open in IMG/M
3300005356|Ga0070674_100354806All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1186Open in IMG/M
3300005436|Ga0070713_100126333All Organisms → cellular organisms → Bacteria2250Open in IMG/M
3300005436|Ga0070713_100654140All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1001Open in IMG/M
3300005440|Ga0070705_100156435All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes1518Open in IMG/M
3300005466|Ga0070685_10949062All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium643Open in IMG/M
3300005529|Ga0070741_10711419All Organisms → cellular organisms → Bacteria → Terrabacteria group885Open in IMG/M
3300005529|Ga0070741_11630506All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium527Open in IMG/M
3300005530|Ga0070679_100350839All Organisms → cellular organisms → Bacteria1423Open in IMG/M
3300005530|Ga0070679_100776463All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales901Open in IMG/M
3300005535|Ga0070684_102255086All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium514Open in IMG/M
3300005542|Ga0070732_10814060All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria570Open in IMG/M
3300005545|Ga0070695_100505095Not Available936Open in IMG/M
3300005545|Ga0070695_101124214All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium644Open in IMG/M
3300005560|Ga0066670_10929537Not Available530Open in IMG/M
3300005607|Ga0070740_10247952All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium728Open in IMG/M
3300005764|Ga0066903_105172839Not Available691Open in IMG/M
3300005874|Ga0075288_1064482All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium582Open in IMG/M
3300005894|Ga0075270_1088609Not Available502Open in IMG/M
3300006046|Ga0066652_100658042All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria994Open in IMG/M
3300006046|Ga0066652_101086572Not Available758Open in IMG/M
3300006173|Ga0070716_100951036All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300006797|Ga0066659_10163233All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1596Open in IMG/M
3300006806|Ga0079220_11191413All Organisms → cellular organisms → Bacteria627Open in IMG/M
3300006871|Ga0075434_101127613All Organisms → cellular organisms → Bacteria → Terrabacteria group797Open in IMG/M
3300006903|Ga0075426_10555805All Organisms → cellular organisms → Bacteria855Open in IMG/M
3300006954|Ga0079219_10208772All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1116Open in IMG/M
3300009012|Ga0066710_100519434All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1797Open in IMG/M
3300009176|Ga0105242_11891869All Organisms → cellular organisms → Bacteria → Terrabacteria group637Open in IMG/M
3300009792|Ga0126374_10401809All Organisms → cellular organisms → Bacteria958Open in IMG/M
3300010039|Ga0126309_10815442Not Available611Open in IMG/M
3300010322|Ga0134084_10201767All Organisms → cellular organisms → Bacteria → Terrabacteria group696Open in IMG/M
3300010325|Ga0134064_10284054All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium624Open in IMG/M
3300010337|Ga0134062_10627189All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria557Open in IMG/M
3300010360|Ga0126372_10438288All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1206Open in IMG/M
3300010376|Ga0126381_100284562All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2257Open in IMG/M
3300010376|Ga0126381_102650225All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300010396|Ga0134126_10900042All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium995Open in IMG/M
3300010397|Ga0134124_10327495All Organisms → cellular organisms → Bacteria1436Open in IMG/M
3300011119|Ga0105246_11095569All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria727Open in IMG/M
3300011119|Ga0105246_11177159All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium704Open in IMG/M
3300011987|Ga0120164_1044422All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria653Open in IMG/M
3300012010|Ga0120118_1079122Not Available808Open in IMG/M
3300012198|Ga0137364_10902530All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria669Open in IMG/M
3300012199|Ga0137383_10412303Not Available990Open in IMG/M
3300012206|Ga0137380_11200851All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria643Open in IMG/M
3300012209|Ga0137379_11343560All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria619Open in IMG/M
3300012211|Ga0137377_10646871All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria993Open in IMG/M
3300012212|Ga0150985_115431868All Organisms → cellular organisms → Bacteria776Open in IMG/M
3300012285|Ga0137370_10098372All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1645Open in IMG/M
3300012356|Ga0137371_10753511Not Available743Open in IMG/M
3300012508|Ga0157315_1049352All Organisms → cellular organisms → Bacteria → Terrabacteria group560Open in IMG/M
3300012948|Ga0126375_11932275Not Available519Open in IMG/M
3300012958|Ga0164299_10698815All Organisms → cellular organisms → Bacteria → Terrabacteria group709Open in IMG/M
3300012960|Ga0164301_10766666All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria734Open in IMG/M
3300012977|Ga0134087_10508456Not Available608Open in IMG/M
3300012977|Ga0134087_10819066All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria506Open in IMG/M
3300012985|Ga0164308_10730524All Organisms → cellular organisms → Bacteria857Open in IMG/M
3300013102|Ga0157371_11294134All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium564Open in IMG/M
3300013296|Ga0157374_11080354All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria823Open in IMG/M
3300014166|Ga0134079_10048450All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1488Open in IMG/M
3300014325|Ga0163163_13230411All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium508Open in IMG/M
3300014497|Ga0182008_10714426Not Available574Open in IMG/M
3300015356|Ga0134073_10214510All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300015357|Ga0134072_10132058All Organisms → cellular organisms → Bacteria → Terrabacteria group803Open in IMG/M
3300015372|Ga0132256_103124508All Organisms → cellular organisms → Bacteria → Terrabacteria group557Open in IMG/M
3300017961|Ga0187778_10802110Not Available642Open in IMG/M
3300018431|Ga0066655_10828420All Organisms → cellular organisms → Bacteria → Terrabacteria group630Open in IMG/M
3300018468|Ga0066662_12272771All Organisms → cellular organisms → Bacteria → Terrabacteria group569Open in IMG/M
3300019362|Ga0173479_10162212All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria906Open in IMG/M
3300020005|Ga0193697_1014508Not Available1929Open in IMG/M
3300021080|Ga0210382_10531517All Organisms → cellular organisms → Bacteria → Terrabacteria group521Open in IMG/M
3300022756|Ga0222622_10844987All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium670Open in IMG/M
3300024055|Ga0247794_10333889All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium516Open in IMG/M
3300024254|Ga0247661_1093349All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria568Open in IMG/M
3300024323|Ga0247666_1114497All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300025906|Ga0207699_10347605All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1046Open in IMG/M
3300025913|Ga0207695_10426795Not Available1210Open in IMG/M
3300025916|Ga0207663_10107117All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1890Open in IMG/M
3300025917|Ga0207660_10893386All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium725Open in IMG/M
3300025924|Ga0207694_10526039All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium991Open in IMG/M
3300025928|Ga0207700_11019673All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria740Open in IMG/M
3300025941|Ga0207711_10990885All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium780Open in IMG/M
3300025949|Ga0207667_10499089All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1235Open in IMG/M
3300026023|Ga0207677_11594823All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium604Open in IMG/M
3300026308|Ga0209265_1013078All Organisms → cellular organisms → Bacteria2584Open in IMG/M
3300026308|Ga0209265_1046857All Organisms → cellular organisms → Bacteria1336Open in IMG/M
3300026308|Ga0209265_1241083All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria502Open in IMG/M
3300026335|Ga0209804_1109111All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1265Open in IMG/M
3300026523|Ga0209808_1292194All Organisms → cellular organisms → Bacteria → Terrabacteria group524Open in IMG/M
3300026542|Ga0209805_1368392Not Available549Open in IMG/M
3300027787|Ga0209074_10181292All Organisms → cellular organisms → Bacteria → Terrabacteria group779Open in IMG/M
3300027821|Ga0209811_10056730All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1348Open in IMG/M
3300028716|Ga0307311_10058629All Organisms → cellular organisms → Bacteria1032Open in IMG/M
3300028717|Ga0307298_10029110All Organisms → cellular organisms → Bacteria → Acidobacteria1462Open in IMG/M
3300028784|Ga0307282_10030045All Organisms → cellular organisms → Bacteria2343Open in IMG/M
3300028784|Ga0307282_10448482All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium626Open in IMG/M
3300028807|Ga0307305_10218714Not Available873Open in IMG/M
3300028810|Ga0307294_10074297All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1034Open in IMG/M
3300028811|Ga0307292_10261338Not Available720Open in IMG/M
3300028875|Ga0307289_10357047All Organisms → cellular organisms → Bacteria → Acidobacteria601Open in IMG/M
3300028875|Ga0307289_10454775All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium526Open in IMG/M
3300028884|Ga0307308_10398212Not Available660Open in IMG/M
3300031170|Ga0307498_10191498Not Available708Open in IMG/M
3300031170|Ga0307498_10224003All Organisms → cellular organisms → Bacteria → Terrabacteria group668Open in IMG/M
3300031170|Ga0307498_10475971Not Available506Open in IMG/M
3300031199|Ga0307495_10038294All Organisms → cellular organisms → Bacteria → Terrabacteria group924Open in IMG/M
3300031572|Ga0318515_10645189All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium562Open in IMG/M
3300031720|Ga0307469_12474210All Organisms → cellular organisms → Bacteria → Terrabacteria group507Open in IMG/M
3300031910|Ga0306923_10146957All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2689Open in IMG/M
3300031939|Ga0308174_10782055All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria801Open in IMG/M
3300032013|Ga0310906_10888636All Organisms → cellular organisms → Bacteria → Terrabacteria group635Open in IMG/M
3300032074|Ga0308173_11257651All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300032074|Ga0308173_11673399All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300032076|Ga0306924_11902238All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium617Open in IMG/M
3300032089|Ga0318525_10722281Not Available507Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil14.60%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil10.95%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.57%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil5.84%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.11%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.65%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil3.65%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil3.65%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere3.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.92%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.19%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.19%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.19%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.46%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere1.46%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.46%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost1.46%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil1.46%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.46%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil1.46%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.46%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.46%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.73%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.73%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.73%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.73%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.73%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.73%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.73%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.73%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.73%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.73%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.73%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.73%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.73%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.73%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.73%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.73%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.73%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.73%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.73%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.73%
SimulatedEngineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated0.73%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908045Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011EnvironmentalOpen in IMG/M
2166559005Simulated microbial communities from Lyon, FranceEngineeredOpen in IMG/M
2166559006Grass soil microbial communities from Rothamsted Park, UK - FI (heavy metals 2g/kg) assembledEnvironmentalOpen in IMG/M
2170459002Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cmEnvironmentalOpen in IMG/M
2189573002Grass soil microbial communities from Rothamsted Park, UK - FE1 (NaCl 30g/L 5ml)EnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001305Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300002244Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1Host-AssociatedOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005169Soil and rhizosphere microbial communities from Laval, Canada - mgHPAEnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005607Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005874Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404EnvironmentalOpen in IMG/M
3300005894Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_203EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011987Permafrost microbial communities from Nunavut, Canada - A20_80cm_0MEnvironmentalOpen in IMG/M
3300012010Permafrost microbial communities from Nunavut, Canada - A7_35cm_12MEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012508Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510Host-AssociatedOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300015356Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300020005Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2EnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300024055Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6EnvironmentalOpen in IMG/M
3300024254Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02EnvironmentalOpen in IMG/M
3300024323Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026308Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes)EnvironmentalOpen in IMG/M
3300026335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes)EnvironmentalOpen in IMG/M
3300026523Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes)EnvironmentalOpen in IMG/M
3300026542Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028716Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198EnvironmentalOpen in IMG/M
3300028717Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028810Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031199Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_SEnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
KansclcFeb2_007583202124908045SoilMDTYHVVLYIHLLALFLGLGAASVLLACLTQLRKAQ
cont_0597.000033102166559005SimulatedLNTYHAILFLHLMFLFVGIGAGAVLLVCLFQLRVARTLEQAVPWGGVAG
FI_002597502166559006Grass SoilLNTYHAILFLHLMFLFVGVGAGAVLLVCLFQLRAARTLEQAVP
E1_035662802170459002Grass SoilLNTYHYVLYVHLLALFVGIGAGSVLLTCLFQIRAAGTVEQAVPWGSCPAGWRAS
FE1_038161102189573002Grass SoilMDTYHVVLYIHLLALLLGIGAGSVLLTCLFQLRAARTVEQAVPWGIVSG
JGI10216J12902_11296915413300000956SoilMDTYHVVLYIHLLALFIGIGAASVLLACLLQLRKAQTLAE
C688J14111_1002966643300001305SoilLDTYHVVLYIHLLSLFVGVGAASVLIVCLFQLRGAAELSDAIPWGRVAGKIGRLFG
C688J18823_1046839023300001686SoilLNTYHYVLYVHLLALFVGIGAGSVLLACLLQLRAARTVEQAGPWGMLAAKV
JGI24742J22300_1011519823300002244Corn, Switchgrass And Miscanthus RhizosphereLDTYHVVLYLHLLALFIGIGAASILLVCIFQLRSAQTLADAIPWGRVAGKISRAFPIA
Ga0063454_10151956823300004081SoilLNTYHYVLYVHLLALFVGIGAGSVLLACLLQLRAARTVEQAGPWGMMAGKMGKLF
Ga0063455_10075978013300004153SoilLDTYHAVLYIHLLSLFIGIGAASILMVCLFQLRKAQTLMEAAPWGGVAAKIGRAFPVA
Ga0062591_10226935513300004643SoilLDTYHVVLYVHLLSLFIGIGAASILMVCLFQLRAAQTLAEAVPWGMVAGKIGR
Ga0062591_10243399413300004643SoilVSTYTVVLYLHLLSLFIGIGAASVLMACLFRLRAAQTLADAAPW
Ga0066810_1017963613300005169SoilLNTYHYVLYVHLLALFIGIGAGSVLLTCLFQLKAARTVEQAMPWGI
Ga0066677_1051489923300005171SoilLTTQGEALNTYHYVLYIHLLSLFVGIGAGSVLLTCLFQLRAARTLE
Ga0066679_1052492413300005176SoilLNTYHSVLYVHLLALFVGIGAGSVLLACLLQLRAASTVEQAAPWGM
Ga0066688_1009875513300005178SoilLNTYHYVLYIHLLSLFVGIGAGSVLLTCLFQLRAARTLEQAVPWGIVSG
Ga0065705_1003123423300005294Switchgrass RhizosphereLDTYHVVLYIHLLSLLVGXGXASVLVVCLFQLRGARELADAIPWGSVAGKIA
Ga0065705_1074462613300005294Switchgrass RhizosphereVLYIHLLALFIGIGAASVLLVCLFQLRAAQTLAEAVPWGMVAGKTGRAFPIA
Ga0070680_10121862613300005336Corn RhizosphereMDTYHVVLYIHLLALFIGIGAASVLLACLLQLRKAQTLAEAGPWGMVAG
Ga0070674_10035480613300005356Miscanthus RhizosphereLDTYHVVLYIHLLSLFVGIGAASVLIVCLFQLRGARELMEAVPWGM
Ga0070713_10012633343300005436Corn, Switchgrass And Miscanthus RhizosphereLDTYHVVLYVHFLSVFIGLGAASVLMACLFRLRASETLADAAPWGMMAGKIGRAFPVAV
Ga0070713_10065414043300005436Corn, Switchgrass And Miscanthus RhizosphereMNTYHYVLYVHLMSLFVGIGAGSVLLACLLQLRAARTVEAAAPWGMLSGKVAK
Ga0070705_10015643523300005440Corn, Switchgrass And Miscanthus RhizosphereVDTYHYVLYIHLLSLIVGIGAAAVLSVCLFQLRGARELADALPWG
Ga0070685_1094906223300005466Switchgrass RhizosphereLDTYHVVLYIHLLSLFVGIGAASVLVVCLFQLRKATEFADAVPFGRVAGKVG
Ga0070741_1071141923300005529Surface SoilLDTYHVVLYIHLLSLFVGIGAASILTLCLFQLRASRTL*
Ga0070741_1163050623300005529Surface SoilVNTYHYVLFIHFLALFVGIGAGSVLLACLLQLRAAR
Ga0070679_10035083923300005530Corn RhizosphereVNTYHYVLYVHLMSLFVGIGAGSVLLVCLLQLRAARTVEQAAPWGMMAGKVGKLFPVAIL
Ga0070679_10077646333300005530Corn RhizosphereLNTYHGVLYFHLLFLFVGIGAGAVLLVCLFQLRAARTLEQAVPWGTVAG
Ga0070684_10225508613300005535Corn RhizosphereLDTYHVVLYIHLLSLFVGIGAAAVLVVCLFQLRGANELMQAVPFGMVA
Ga0070732_1081406023300005542Surface SoilVNTYHDVLYVHLLSLFIGIGAASVLLVSLFQLRAARTLEAAAPWGRVAGKV
Ga0070695_10050509523300005545Corn, Switchgrass And Miscanthus RhizosphereLDTYHYVLYIHLLSLFVGIGAATLLAVCLFQLRGARELTDALPWG
Ga0070695_10112421413300005545Corn, Switchgrass And Miscanthus RhizosphereLDTYHVVLYLHLLALFIGIGAASILLVCLFQLRSAQTLADAIPW
Ga0066670_1092953713300005560SoilLDTYHIVLYIHLLAVFIGVGAASVLMVCLFQLRAAKTLADAVPWGVVAGKTEHA
Ga0070740_1024795213300005607Surface SoilLDTYHVVLYIHLLALFVGIGAGTVLLVCLLQLRAAETLDTAVPWGVLAGRTEKAFP
Ga0066903_10517283913300005764Tropical Forest SoilLNTYHYVLYVHLLALFIGIGAGSVLLTCLFQLKGASTVEQAVPWGIVSGKVARLFPVA
Ga0075288_106448223300005874Rice Paddy SoilLDTYHVVLYIHLLSLFVGIGAASVLVVCLFQLRGARELTDAI
Ga0075270_108860913300005894Rice Paddy SoilLNTYHYVLYVHLLALFVGIGAGSVLLTCLFQLRAARTLEQAAPWGIVAGK
Ga0066652_10065804213300006046SoilLDTYHVVLYIHLLALFVGVGAGSVLLVCLFQLRAAQTLADAVPWGAVAGKTERAFPIAI
Ga0066652_10108657213300006046SoilVDTYLTVKYIHLLSLFIGIGAGAVLAACLFQLRAAGTLEQAVPWGMMAGK
Ga0070716_10095103613300006173Corn, Switchgrass And Miscanthus RhizosphereLDTYHVVLYIHFLALFVGIGAAAVLVTCLFQLRGAGTLADALPWG
Ga0066659_1016323333300006797SoilLDTYHVVLYIHLLALFVGIGAGAILLVCLFQLRGAQTLADAVPWGSVAGKTARAFP
Ga0066660_1059262733300006800SoilLDTYHVVLYIHFMSLFVGIGAGAVLVVCLFQLRAAQTLADAVPWGRVAGKAGRTFPIAI
Ga0079220_1119141313300006806Agricultural SoilLDTYHVVLYIHLLALFVGIGAGAILVLCLFQLRAARTLEAAAPWGAVA*
Ga0075434_10112761323300006871Populus RhizosphereMDTYHVVLYLHFLSLFIGIGAASVLLACLIQLRAAQTLMDAVPWGMVAGRSPRRSPSR*
Ga0075426_1055580513300006903Populus RhizosphereLNTYHYVLYVHLLSLFVGIGAGSVLLACLLQLRAARTVEQ
Ga0079219_1020877233300006954Agricultural SoilMDTYHVVLYIHLLALFIGIGAASVLLACLLQLRKAQTLAEAGPWGMVAGK
Ga0066710_10051943413300009012Grasslands SoilLDTYHVVLYVHLLAVFIGVGAASVLMVCLFQLKAAKTLADAVPWGAVAGKTERAFPVAIL
Ga0105242_1189186923300009176Miscanthus RhizosphereLDTYSVVLYLHLLSLFIGLGAASVLMECLFRLRAA
Ga0126374_1040180913300009792Tropical Forest SoilLNTYHYVLYLHLLSIFIGIGAGSVILACLLQLRAARTVEQAAPWGMMAGKV
Ga0126309_1081544223300010039Serpentine SoilVDTYHVVLYIHILSMLLGIGAASVLFACLFGLRGAQTLAD
Ga0134084_1020176723300010322Grasslands SoilLNTYHYVLYVHLLSLFLGIGAGSVLLTCLFQLRAAGTVEQAVPWG
Ga0134064_1028405413300010325Grasslands SoilLDRYHVALYIHFVSLLIGIGAASVLTVCAFQFRSARTLADAAPWGRVAAKVGRL
Ga0134062_1062718923300010337Grasslands SoilLNTYHYVLYVHLLSLFIGIGAGSVLLACLFQLRAARTLETAVPWGMLSG
Ga0126372_1043828813300010360Tropical Forest SoilVKTLNTYHYVLYVHLLSLFIGIGAGSVILVCLFQLRAARTL
Ga0126381_10028456213300010376Tropical Forest SoilVDTYHVVLYLHLLSLFIGLGAASILMACLFRLRASQTLADAAPWGM
Ga0126381_10265022513300010376Tropical Forest SoilLNTYHYVLYVHLLSLFVGIGAGSVILTCLLQLRAARTVEQAAPWGMMAGKVGK
Ga0134126_1090004223300010396Terrestrial SoilLDTYHVVLYLHLLALFIGIGAGSILLVCIFQLRSAQTLADAIPWGRVAGKIGRAF
Ga0134124_1032749513300010397Terrestrial SoilMDTYHVVLYIHLLALFIGIGAASVLLACLLQLRKAQTLAEAGPWGMVAGKVSRLFPIAI
Ga0105246_1109556913300011119Miscanthus RhizosphereLDTYHVVLYLHLLALFIGIGAGSILLVCIFQLRSALTLADAIPWGRVAGK
Ga0105246_1117715913300011119Miscanthus RhizosphereLDTYHYVLYVHLLSLFVGIGAAAVLSVCLFQLRGARELTDALP
Ga0120164_104442213300011987PermafrostLDTYHVVLYVHLLALFIGIGAASILLICLFQLRAAQTLAEAVPWGS
Ga0120118_107912223300012010PermafrostLDTYHVILYVHLMALFIGIGAGSVLLTCLFQLRAAGTLEEALPWGRVSGQ
Ga0137364_1090253013300012198Vadose Zone SoilVNTYHYVLYVHLLSLFVGIGAGAVVLACLLQLRAARTLEQAVPWG
Ga0137383_1041230313300012199Vadose Zone SoilLDTYHVVLYIHLLALFVGVGAAGVLLVCLFQLRSAQTVSD
Ga0137380_1120085113300012206Vadose Zone SoilLTTQGEALNTYHYVLYIHLLSLFVGIGAGSVLLTCLFQLR
Ga0137379_1134356013300012209Vadose Zone SoilLTTQGEALNTYHYVLYIHLLSLFVGIGAGSVLLTCLFQL
Ga0137377_1064687133300012211Vadose Zone SoilLNTYHYVLYIHLLSLFVGIGAGSVLLTCLFQLRAARTLEQAVPWGIV
Ga0150985_11543186813300012212Avena Fatua RhizosphereLDTYHAVLYIHLLSLFIGIGAASILMVCLFQLRKAQTLMEAAPWGGVAGKIGRAFP
Ga0137370_1009837223300012285Vadose Zone SoilLDTYHYVLYVHLLSLFVGIGAAAVLSVCLFQLRGARE
Ga0137371_1075351113300012356Vadose Zone SoilLDTYHVVLYIHFLALFIGIGAGSVLLVCLFQLRDAQTLADAVPW
Ga0157315_104935223300012508Arabidopsis RhizosphereLDTYHVVLYLHLLSLFIGIGAASILLVCTYQLRAAQTL
Ga0126375_1193227513300012948Tropical Forest SoilLDTYHVVLYIHLVSLLIGIGAASVLTVCAVQLRGARTLADAAPWGR
Ga0164299_1069881513300012958SoilLNTYHYVLYVHLLSLFVGIGAGSVLLACLLQLRAARTVEQAGPWGMM
Ga0164301_1076666623300012960SoilLNTYHYVLYVHLLALFVGIGAGSVLLACLLQLRAARTVEQAGPWGMMAGKMGKFFPIA
Ga0134087_1050845623300012977Grasslands SoilVDTYHYVLYIHLLSLFVGIGAAAVLSLCLFQLRDARELADALPWGRVA
Ga0134087_1081906613300012977Grasslands SoilLDTYHVVLYIHFMALFVGIGAGAVLLVCLFQLRAAQTLAEAVP
Ga0164308_1073052423300012985SoilLNTYHYVLYVHLLALFVGIGAGSVLLACLLQLRAARTVEQAGPWG
Ga0157371_1129413423300013102Corn RhizosphereLDTYHYVLYVHLLSLFVGIGAASVLVVCLFQLRKATEFADA
Ga0157374_1108035423300013296Miscanthus RhizosphereLDTYHVVLYLHLLALFIGIGAGSILLVCIFQLRSALTLADAI
Ga0134079_1004845033300014166Grasslands SoilLNTYHYVLYVHLLALFVGIGAGSVLLACLLQLRAARTVEQAGPWGMMAGKMG
Ga0163163_1323041113300014325Switchgrass RhizosphereLDTYHVVLYLHLLSLFVGIGAASVLVVCLFQLRKATEFADAVPFGRVA
Ga0182008_1071442623300014497RhizosphereVNTYHSILYVHLLSLFVGIGAGSVLLACLFQLRAARAVEQAAP
Ga0134073_1021451013300015356Grasslands SoilLDTYHAVLYVHLLSLFIGVGAASILMVCLFQLRKAQTLMEAAP
Ga0134072_1013205813300015357Grasslands SoilLNTYHYVLYVHLLALFVGIGAGSVLLACLLQLRAARTVEQAG
Ga0132256_10312450813300015372Arabidopsis RhizosphereLNTYHYVLYVHLLSLFVGIGAGPVLLACLLQLRAA
Ga0187778_1080211013300017961Tropical PeatlandLNTYHYVLYVHLLSLFLGIGAGSVLLTCLFQLRAARTVEQAVPWGIV
Ga0066655_1082842013300018431Grasslands SoilLNTYHYVLYVHLLSLFLGIGAGSVRLTCLSQLRAAGTVAQARPWGTVSGRVARPLPVASL
Ga0066662_1227277113300018468Grasslands SoilMDTYHVVLYIHLFALFIGIGAASVLLACLLQLRRAQTLAEAGPWGMVAGKGSRLFPI
Ga0173479_1016221233300019362SoilVNTYHYVLYVHLLALFVGIGAGAVLLACLLQLRAARTLEQAVPWG
Ga0193697_101450813300020005SoilLDTYHVVLYLHLLALFIGIGAASILLVCIFQLRSAQTLSD
Ga0210382_1053151723300021080Groundwater SedimentLDTYHVVLYIHLLALFIGIGAASILLVCLFQLRAAQTLADAVPWGSVA
Ga0222622_1084498723300022756Groundwater SedimentLDTYHVVLYIHLLSLFVGIGAASVLIVCLFQLRGARELTDAIPWG
Ga0247794_1033388923300024055SoilLDTYHVVLYIHLLSLLVGIGAASVLVVCLFQLRGARELMEAV
Ga0247661_109334913300024254SoilLNTYHGVLYFHLLFLFVGIGAGAVLLVCLFQLRAA
Ga0247666_111449713300024323SoilLNTYHYVLYVHLLALFVGIGAGSVLLACLLQLRAARTVEQAAPWGI
Ga0207699_1034760533300025906Corn, Switchgrass And Miscanthus RhizosphereMDTYHVVLYIHLLALFIGIGAASVLLACLLQLRKAQTLAEAGPWGMVAGKVSRLFP
Ga0207695_1042679513300025913Corn RhizosphereVNTYHYVLYVHLMSLFVGIGAGSVLLVCLLQLRAARTVEQA
Ga0207663_1010711723300025916Corn, Switchgrass And Miscanthus RhizosphereLDTYHVVLYLHLLALFIGIGAASILLVCLFQLRSAQT
Ga0207660_1089338613300025917Corn RhizosphereLDTYHVVLYLHLLALFIGIGAASILLVCLFQLRSAQTLAD
Ga0207694_1052603923300025924Corn RhizosphereLDTYHVVLYLHLLALFIGIGAASILLVCTYQLRSA
Ga0207700_1101967313300025928Corn, Switchgrass And Miscanthus RhizosphereVNTYHDVLYVHLLSLFIGIGAASVLLVSLFQLRAAR
Ga0207711_1099088513300025941Switchgrass RhizosphereLDTYHVVLYLHLLALFIGIGAASILLVCIFQLRSAQTLADAIPWGRVAGKIS
Ga0207667_1049908923300025949Corn RhizosphereLDTYHVVLYLHLLALFIGIGAASILLVCIFQLRSAQTLADAIP
Ga0207677_1159482323300026023Miscanthus RhizosphereLDTYHVVLYLHLLALFIGIGAGSILLVCIFQLRSALTLADAIPWGRVAGKI
Ga0209265_101307813300026308SoilLDKYHVALYIHFLSLLIGIGAASVLTVCAFQLRAART
Ga0209265_104685743300026308SoilLDTYHVVLYIHFLALFVGIGAGAVLLVCLFQLRTAQTLAD
Ga0209265_124108323300026308SoilLTTYHYVLYVHLLALFIGIGAGSVLLACLLQLRAARTVEQAGPWGMMAGKMGKL
Ga0209804_110911133300026335SoilLDTYHVVLYIHLLALFVGIGAGAVLLVCLFQLRGAQTLANAVPWGRVAG
Ga0209808_129219413300026523SoilLNTYHYVLYVHLLSLFLGIGAGSVLLTCLFQLRAAGTVEQAV
Ga0209805_136839223300026542SoilVDTYHYVLYIHLLSLFVGIGAAAVLSLCLFQLRGAR
Ga0209074_1018129223300027787Agricultural SoilMDTYQVVLYIHLLALFIGIGAASVLLSCLLQLRKA
Ga0209811_1005673013300027821Surface SoilLDTYHVVLYLHLLALFIGIGAGSILLVCIFQLRSA
Ga0307311_1005862923300028716SoilLDTYHVVLYIHFLALFVGIGAAGVLVTCLFQLRAAGTLADALPWGKVAG
Ga0307298_1002911013300028717SoilLDTYHVVLYIHFLALFVGIGAAGVLVTCLFQLRAAGTLADALPWGKVAGKT
Ga0307316_1004105823300028755SoilLDTYHVVLYIHFLALFVGIGAAGVLVTCLFQLRAAGTLADALPWGKVAGKTARVFPIAIL
Ga0307282_1003004513300028784SoilLDTYHVVLYIHFLALFVGIGAAGVLVTCLFQLRAAGTLADALPWGK
Ga0307282_1044848213300028784SoilLDTYHVVLYIHLLSLFVGIGAAAVLSVCLFQLRAAR
Ga0307305_1021871413300028807SoilLDTYHVVLYIHLLALFVGVGAAGVLLVCLFQLRGAQTVSDAAPWGAVAGKTGRFF
Ga0307294_1007429723300028810SoilLDTYHVVLYIHLLSLFVGIGAAAVLSVCLFQLRAARELTDAVPWGMVAGKTGRM
Ga0307292_1026133813300028811SoilLDTYHYVLYVHLLSLFVGIGAAAVLSVCLFQLRSARELTDALPWGRVA
Ga0307289_1035704713300028875SoilLDTYHVVLYIHFLALFVGIGAAGVLVTCLFQLRGAGT
Ga0307289_1045477513300028875SoilLDTYHVVLYIHLLSLFVGIGAASVLVVCLFQLRDARELTDAIPWGRVAGKIGRL
Ga0307308_1039821223300028884SoilLDTYHVVLYIHLLALFVGVGAAGVLLVCLFQLRGAQTVSDAAPWGAVAGKTGRF
Ga0307498_1019149823300031170SoilLDTYHVVLYLHLLALFIGIGAASILLVCIFQLRSAQTLADA
Ga0307498_1022400313300031170SoilMHLLALFLGIGAGSVLLVCLLQLRAARTLADAVPWG
Ga0307498_1047597113300031170SoilLDTYHVVLYLHLLSLLIGIGASSILLVCTFQLRSAQTLAD
Ga0307495_1003829413300031199SoilMDTYHVVLYIHLLSLFIGIGAGAVLLTCLFQLRAARTVEQAVPWGIVSGKV
Ga0318515_1064518923300031572SoilVDTYHVVLYLHLLSLFIGLGAASVLMACLFRLRVAQTLTDAAP
Ga0307469_1247421013300031720Hardwood Forest SoilLDTYHVVLYLHLLALFIGIGAGSILLVCIFQLRSAQTLADAIPWGRV
Ga0306923_1014695713300031910SoilLDTYHVVLYVHLLSLLLGIGAGSVLLTCLFQLRAAPTVEQAAPWGIVS
Ga0308174_1078205513300031939SoilLDTYHVVLYLHLLSLFIGIGAGSVLLTCLFQLKAAGTVEQAVPWG
Ga0310906_1088863623300032013SoilLDTYHVVLYLHLLALFIGIGAGSILLVCIFQLRSAQTLADAIPW
Ga0308173_1125765113300032074SoilMDTYHVVLYVHLLALFVGVGAGAVLSVCLFQLRSAQTLGDAVP
Ga0308173_1167339933300032074SoilMDTYHVVLYLHLISLFIGIGAGSVLLACLFQLRAARTVEQAVPWGI
Ga0306924_1190223813300032076SoilLDTYHVVLYVHLLSLLLGIGAGSVLLTCLFQLRAAPTVEQAAPWGIVSGKVA
Ga0318525_1072228113300032089SoilLNTYHYVLYVHLLSLFIGIGAGSVVLACLLQLRAA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.