| Basic Information | |
|---|---|
| Family ID | F056751 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 137 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MNLQLIANEENQDRAQCGKNEAGGMISFVCRARKHVGNGA |
| Number of Associated Samples | 123 |
| Number of Associated Scaffolds | 137 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 60.58 % |
| % of genes near scaffold ends (potentially truncated) | 94.16 % |
| % of genes from short scaffolds (< 2000 bps) | 91.97 % |
| Associated GOLD sequencing projects | 119 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.31 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.080 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (13.139 % of family members) |
| Environment Ontology (ENVO) | Unclassified (16.058 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.095 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.47% β-sheet: 0.00% Coil/Unstructured: 48.53% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 137 Family Scaffolds |
|---|---|---|
| PF16326 | ABC_tran_CTD | 4.38 |
| PF10067 | DUF2306 | 1.46 |
| PF04456 | DUF503 | 1.46 |
| PF04828 | GFA | 1.46 |
| PF01663 | Phosphodiest | 1.46 |
| PF00691 | OmpA | 0.73 |
| PF00702 | Hydrolase | 0.73 |
| PF01610 | DDE_Tnp_ISL3 | 0.73 |
| PF00462 | Glutaredoxin | 0.73 |
| PF07730 | HisKA_3 | 0.73 |
| PF07690 | MFS_1 | 0.73 |
| PF13231 | PMT_2 | 0.73 |
| PF12979 | DUF3863 | 0.73 |
| PF02899 | Phage_int_SAM_1 | 0.73 |
| PF12867 | DinB_2 | 0.73 |
| PF00326 | Peptidase_S9 | 0.73 |
| PF00216 | Bac_DNA_binding | 0.73 |
| PF12833 | HTH_18 | 0.73 |
| PF13490 | zf-HC2 | 0.73 |
| PF08410 | DUF1737 | 0.73 |
| PF01027 | Bax1-I | 0.73 |
| PF01381 | HTH_3 | 0.73 |
| PF13414 | TPR_11 | 0.73 |
| PF00005 | ABC_tran | 0.73 |
| PF12706 | Lactamase_B_2 | 0.73 |
| PF04191 | PEMT | 0.73 |
| PF08818 | DUF1801 | 0.73 |
| PF13302 | Acetyltransf_3 | 0.73 |
| PF00027 | cNMP_binding | 0.73 |
| PF13545 | HTH_Crp_2 | 0.73 |
| PF01661 | Macro | 0.73 |
| PF04228 | Zn_peptidase | 0.73 |
| PF13474 | SnoaL_3 | 0.73 |
| PF10543 | ORF6N | 0.73 |
| COG ID | Name | Functional Category | % Frequency in 137 Family Scaffolds |
|---|---|---|---|
| COG1550 | Stress-induced protein YlxP, DUF503 family | Function unknown [S] | 1.46 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 1.46 |
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 0.73 |
| COG2110 | O-acetyl-ADP-ribose deacetylase (regulator of RNase III), contains Macro domain | Translation, ribosomal structure and biogenesis [J] | 0.73 |
| COG2321 | Predicted metalloprotease | General function prediction only [R] | 0.73 |
| COG3464 | Transposase | Mobilome: prophages, transposons [X] | 0.73 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.73 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.73 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.73 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.73 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.73 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.73 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.73 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.73 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.73 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.08 % |
| Unclassified | root | N/A | 2.92 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001545|JGI12630J15595_10083986 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 625 | Open in IMG/M |
| 3300001593|JGI12635J15846_10287254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1036 | Open in IMG/M |
| 3300001593|JGI12635J15846_10325679 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 951 | Open in IMG/M |
| 3300002071|JGIcombinedJ21915_10198307 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 721 | Open in IMG/M |
| 3300002909|JGI25388J43891_1043933 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 677 | Open in IMG/M |
| 3300004091|Ga0062387_100004456 | All Organisms → cellular organisms → Bacteria | 4446 | Open in IMG/M |
| 3300004479|Ga0062595_100956184 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 730 | Open in IMG/M |
| 3300004635|Ga0062388_101125257 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300005093|Ga0062594_102439244 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 573 | Open in IMG/M |
| 3300005175|Ga0066673_10158860 | All Organisms → cellular organisms → Bacteria | 1264 | Open in IMG/M |
| 3300005184|Ga0066671_10231237 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
| 3300005435|Ga0070714_102107148 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 550 | Open in IMG/M |
| 3300005437|Ga0070710_10154064 | All Organisms → cellular organisms → Bacteria | 1419 | Open in IMG/M |
| 3300005437|Ga0070710_11082165 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300005447|Ga0066689_10034650 | All Organisms → cellular organisms → Bacteria | 2606 | Open in IMG/M |
| 3300005447|Ga0066689_10164658 | All Organisms → cellular organisms → Bacteria | 1326 | Open in IMG/M |
| 3300005450|Ga0066682_10461316 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 807 | Open in IMG/M |
| 3300005518|Ga0070699_100196626 | All Organisms → cellular organisms → Bacteria | 1792 | Open in IMG/M |
| 3300005518|Ga0070699_101939642 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 538 | Open in IMG/M |
| 3300005540|Ga0066697_10072249 | All Organisms → cellular organisms → Bacteria | 1982 | Open in IMG/M |
| 3300005554|Ga0066661_10220827 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter bradus | 1174 | Open in IMG/M |
| 3300005556|Ga0066707_10894786 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 544 | Open in IMG/M |
| 3300005591|Ga0070761_10762225 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300005921|Ga0070766_10318778 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
| 3300006031|Ga0066651_10513451 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300006031|Ga0066651_10639547 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 568 | Open in IMG/M |
| 3300006047|Ga0075024_100797258 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 528 | Open in IMG/M |
| 3300006059|Ga0075017_100022535 | All Organisms → cellular organisms → Bacteria | 4101 | Open in IMG/M |
| 3300006176|Ga0070765_101624806 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 608 | Open in IMG/M |
| 3300006176|Ga0070765_102058537 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 533 | Open in IMG/M |
| 3300006755|Ga0079222_10130958 | All Organisms → cellular organisms → Bacteria | 1387 | Open in IMG/M |
| 3300006844|Ga0075428_102581534 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300006893|Ga0073928_10654143 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 737 | Open in IMG/M |
| 3300009038|Ga0099829_11476801 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 561 | Open in IMG/M |
| 3300009137|Ga0066709_101366909 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
| 3300009524|Ga0116225_1302626 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300009637|Ga0116118_1134883 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 807 | Open in IMG/M |
| 3300009640|Ga0116126_1026695 | All Organisms → cellular organisms → Bacteria | 2471 | Open in IMG/M |
| 3300010333|Ga0134080_10132833 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1045 | Open in IMG/M |
| 3300010361|Ga0126378_10957064 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300010379|Ga0136449_103324199 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 618 | Open in IMG/M |
| 3300011120|Ga0150983_14482279 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 509 | Open in IMG/M |
| 3300012200|Ga0137382_10444354 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300012200|Ga0137382_10480342 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 881 | Open in IMG/M |
| 3300012201|Ga0137365_10337504 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1114 | Open in IMG/M |
| 3300012202|Ga0137363_10035223 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 3488 | Open in IMG/M |
| 3300012209|Ga0137379_10707688 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 913 | Open in IMG/M |
| 3300012210|Ga0137378_10922328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Collimonas → unclassified Collimonas → Collimonas sp. PA-H2 | 787 | Open in IMG/M |
| 3300012285|Ga0137370_10173321 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter | 1257 | Open in IMG/M |
| 3300012356|Ga0137371_10218516 | All Organisms → cellular organisms → Bacteria | 1490 | Open in IMG/M |
| 3300012357|Ga0137384_10975338 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 682 | Open in IMG/M |
| 3300012925|Ga0137419_10633939 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 861 | Open in IMG/M |
| 3300012929|Ga0137404_11503057 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 623 | Open in IMG/M |
| 3300012988|Ga0164306_10050511 | All Organisms → cellular organisms → Bacteria | 2512 | Open in IMG/M |
| 3300014166|Ga0134079_10368233 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 659 | Open in IMG/M |
| 3300014638|Ga0181536_10166121 | Not Available | 1139 | Open in IMG/M |
| 3300016270|Ga0182036_10193675 | All Organisms → cellular organisms → Bacteria | 1484 | Open in IMG/M |
| 3300017927|Ga0187824_10065506 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
| 3300017935|Ga0187848_10053651 | All Organisms → cellular organisms → Bacteria | 1930 | Open in IMG/M |
| 3300017948|Ga0187847_10766666 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 545 | Open in IMG/M |
| 3300017998|Ga0187870_1184949 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 741 | Open in IMG/M |
| 3300018004|Ga0187865_1256056 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
| 3300018005|Ga0187878_1049940 | All Organisms → cellular organisms → Bacteria | 1893 | Open in IMG/M |
| 3300018006|Ga0187804_10561510 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 516 | Open in IMG/M |
| 3300018014|Ga0187860_1354097 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 558 | Open in IMG/M |
| 3300018022|Ga0187864_10245643 | Not Available | 823 | Open in IMG/M |
| 3300018038|Ga0187855_10943103 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 503 | Open in IMG/M |
| 3300018046|Ga0187851_10807610 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 527 | Open in IMG/M |
| 3300018057|Ga0187858_10040482 | All Organisms → cellular organisms → Bacteria | 3427 | Open in IMG/M |
| 3300018468|Ga0066662_11424546 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300019870|Ga0193746_1028869 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 569 | Open in IMG/M |
| 3300019870|Ga0193746_1033926 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 515 | Open in IMG/M |
| 3300019882|Ga0193713_1166036 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300019887|Ga0193729_1158638 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300020004|Ga0193755_1111564 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300020579|Ga0210407_10015995 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 5573 | Open in IMG/M |
| 3300020579|Ga0210407_10507929 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 942 | Open in IMG/M |
| 3300020580|Ga0210403_10959360 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 671 | Open in IMG/M |
| 3300020583|Ga0210401_10952335 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 717 | Open in IMG/M |
| 3300021088|Ga0210404_10209352 | Not Available | 1048 | Open in IMG/M |
| 3300021170|Ga0210400_10438016 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 1078 | Open in IMG/M |
| 3300021171|Ga0210405_10614308 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300021180|Ga0210396_10983266 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 716 | Open in IMG/M |
| 3300021403|Ga0210397_10771420 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 741 | Open in IMG/M |
| 3300021403|Ga0210397_11498938 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 524 | Open in IMG/M |
| 3300021420|Ga0210394_11193747 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 653 | Open in IMG/M |
| 3300021432|Ga0210384_11635049 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 549 | Open in IMG/M |
| 3300021433|Ga0210391_10401170 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1076 | Open in IMG/M |
| 3300021433|Ga0210391_11389891 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 540 | Open in IMG/M |
| 3300021477|Ga0210398_11323446 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 565 | Open in IMG/M |
| 3300021559|Ga0210409_10389807 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1248 | Open in IMG/M |
| 3300022534|Ga0224452_1105678 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 862 | Open in IMG/M |
| 3300023058|Ga0193714_1005270 | All Organisms → cellular organisms → Bacteria | 2063 | Open in IMG/M |
| 3300023058|Ga0193714_1036928 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 715 | Open in IMG/M |
| 3300024225|Ga0224572_1076483 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 618 | Open in IMG/M |
| 3300024295|Ga0224556_1076928 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. S190 | 818 | Open in IMG/M |
| 3300025439|Ga0208323_1024348 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 1264 | Open in IMG/M |
| 3300025460|Ga0208562_1034665 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 1153 | Open in IMG/M |
| 3300025482|Ga0208715_1064966 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 655 | Open in IMG/M |
| 3300025905|Ga0207685_10596171 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300025915|Ga0207693_10201363 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1566 | Open in IMG/M |
| 3300025915|Ga0207693_10860131 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 697 | Open in IMG/M |
| 3300025916|Ga0207663_11705270 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300025939|Ga0207665_10482267 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 956 | Open in IMG/M |
| 3300025939|Ga0207665_10932344 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 689 | Open in IMG/M |
| 3300025945|Ga0207679_10750657 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 887 | Open in IMG/M |
| 3300026314|Ga0209268_1141298 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 592 | Open in IMG/M |
| 3300026528|Ga0209378_1235780 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 582 | Open in IMG/M |
| 3300026552|Ga0209577_10165322 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1727 | Open in IMG/M |
| 3300026557|Ga0179587_10147801 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1462 | Open in IMG/M |
| 3300026903|Ga0207462_1002615 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 726 | Open in IMG/M |
| 3300027364|Ga0209967_1039528 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 715 | Open in IMG/M |
| 3300027660|Ga0209736_1193718 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 529 | Open in IMG/M |
| 3300027698|Ga0209446_1054081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1017 | Open in IMG/M |
| 3300027862|Ga0209701_10410089 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter bradus | 753 | Open in IMG/M |
| 3300027884|Ga0209275_10165923 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 1178 | Open in IMG/M |
| 3300028047|Ga0209526_10231423 | All Organisms → cellular organisms → Bacteria | 1271 | Open in IMG/M |
| 3300028746|Ga0302233_10029278 | All Organisms → cellular organisms → Bacteria | 2351 | Open in IMG/M |
| 3300028775|Ga0302231_10278975 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300028801|Ga0302226_10281627 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 702 | Open in IMG/M |
| 3300028885|Ga0307304_10157665 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300029636|Ga0222749_10596876 | Not Available | 603 | Open in IMG/M |
| 3300029944|Ga0311352_10437964 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 1065 | Open in IMG/M |
| 3300030043|Ga0302306_10129768 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
| 3300030058|Ga0302179_10040331 | All Organisms → cellular organisms → Bacteria | 2134 | Open in IMG/M |
| 3300030399|Ga0311353_11275451 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 603 | Open in IMG/M |
| 3300030855|Ga0075374_10862054 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 695 | Open in IMG/M |
| 3300031128|Ga0170823_15201087 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 622 | Open in IMG/M |
| 3300031231|Ga0170824_123360127 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300031474|Ga0170818_102473856 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 790 | Open in IMG/M |
| 3300031708|Ga0310686_118805439 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300031823|Ga0307478_10493784 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
| 3300031837|Ga0302315_10153081 | All Organisms → cellular organisms → Bacteria | 1432 | Open in IMG/M |
| 3300032160|Ga0311301_10543334 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1702 | Open in IMG/M |
| 3300032174|Ga0307470_11019878 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 660 | Open in IMG/M |
| 3300032205|Ga0307472_100369720 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1186 | Open in IMG/M |
| 3300033888|Ga0334792_043414 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 1432 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.14% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.22% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.76% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 7.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.30% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.30% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.84% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.38% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.65% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.92% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.19% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.19% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.19% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.19% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.19% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.46% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.46% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.46% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.46% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.46% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.73% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.73% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.73% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.73% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.73% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.73% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.73% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.73% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.73% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.73% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.73% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002071 | Barrow Graham LP Ref core NGADG0011-312 (Barrow Graham LP Ref core NGADG0011-312,NGADG0011-212, ASSEMBLY_DATE=20131010) | Environmental | Open in IMG/M |
| 3300002909 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009637 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 | Environmental | Open in IMG/M |
| 3300009640 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017998 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150 | Environmental | Open in IMG/M |
| 3300018004 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100 | Environmental | Open in IMG/M |
| 3300018005 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_150 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018014 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40 | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019870 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m1 | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300023058 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m1 | Environmental | Open in IMG/M |
| 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5 | Host-Associated | Open in IMG/M |
| 3300024295 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5 | Environmental | Open in IMG/M |
| 3300025439 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025460 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025482 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G01A1-11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300028801 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030043 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030855 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA9 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031837 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033888 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-3-X1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12630J15595_100839861 | 3300001545 | Forest Soil | MNLQLIANEENQDRAQCGKNEAGGMISFVCRAREHVGKGAADDRSDDADHNRP |
| JGI12635J15846_102872542 | 3300001593 | Forest Soil | MNPQLIANEENQDGAKCGKNEAGGMISFIRRARKHVANAAADDRSDDAEH |
| JGI12635J15846_103256791 | 3300001593 | Forest Soil | MNLQLIASEENQDRSQYGKNETGGMISFVGRARKHMGHG |
| JGIcombinedJ21915_101983073 | 3300002071 | Arctic Peat Soil | MNLQLIANEENQDRAQCGKNEAGGMISFVCRARKHVGKX |
| JGI25388J43891_10439331 | 3300002909 | Grasslands Soil | MDIQLDANIENQDRAKCGKNEAGGMKSSGCRVRKHVGNRAADDRPD |
| Ga0062387_1000044561 | 3300004091 | Bog Forest Soil | MGATTAHLEVDRGKMNIQLIANEENQDRAECGKNEACGMISFVFRARKHVGNGTADDGSDDAEH |
| Ga0062595_1009561842 | 3300004479 | Soil | MDLQFKANEEDQDRAQRGKNEAGGMKSLVCRARKHVANGAAK |
| Ga0062388_1011252572 | 3300004635 | Bog Forest Soil | MGKMDIQLIANEEKQDRTEGGKNETGGMITFVSRARKHVGNGAADDRTDNAEHDRPEDR* |
| Ga0062594_1024392441 | 3300005093 | Soil | MDVQLKANVEKQDRAKCGKNDSGGMKSSGCRVRKHVGNRAA |
| Ga0066673_101588601 | 3300005175 | Soil | MDVQLNANVEDEDRAKSGKNETGWMKSSGYRARKHMGNCAANDR |
| Ga0066671_102312371 | 3300005184 | Soil | MDIQLDANIENQDRAKCGKNEAGGMKSSGCRVRKHVGHGAADNRSD |
| Ga0070714_1021071482 | 3300005435 | Agricultural Soil | MDIQLDANVENQDRAKCGKNEAGGMKSSGCRVRKHVGNRAADDRSD |
| Ga0070710_101540643 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MDLQFKANEEDQDRAQRGKNEAGGMKSLVCRARKHVANGAAE |
| Ga0070710_110821651 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MNLQLIADVENQDRAQCGKNEAGGMISFVFRARKHVSNGAAEDRSDDAEHDRPEHR* |
| Ga0066689_100346501 | 3300005447 | Soil | MDIQLDANIENQDRAKCGKNEAGGMKSSGCRVRKHVGNRAANDRPDDAEH |
| Ga0066689_101646583 | 3300005447 | Soil | MDIQLDANIEDQDRAKCGKNEAGGMKSSGCRVRKHVGNRAANDRPDDAEH |
| Ga0066682_104613163 | 3300005450 | Soil | MDVQLNANVEEQDCAECGKNETGRMKSSGYRVRKHVCNGAADDRSDDAE |
| Ga0070699_1001966263 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MNLQFIADVENQDRAQCGKNEAGGMISFIFRARKHVSNGAAEDRSDDAEHDRPERR* |
| Ga0070699_1019396421 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MNLQFIADVEKQDCAQCGKNEAGGMISFVFRARKHVSNGAAED |
| Ga0066697_100722491 | 3300005540 | Soil | MDIQLDANIENQDRAKCGKNEAGGMKSSGCRVRKHVGNRA |
| Ga0066661_102208273 | 3300005554 | Soil | MNLQLIANEENQDRAQCGKNEAGGMISFVCRARKHVGNGA |
| Ga0066707_108947862 | 3300005556 | Soil | MDIQLKANVENQDRAKCGKNEAGGMKSSGCRVRKHVGNRAADDRSDDAE |
| Ga0070761_107622251 | 3300005591 | Soil | MNVQLVANEENQDRAECGKNEAGGMISFVCRARKHVA |
| Ga0070766_103187782 | 3300005921 | Soil | MDVQLVANEENQDRPQRGKYQAGRMISIVCWTKKHVGNGTAEDRSNDAKRDRPEERYVHVHH |
| Ga0066651_105134511 | 3300006031 | Soil | MDVQLNANVEDEDRAKSGKNETGWMKSSGYRARKHMGNC |
| Ga0066651_106395471 | 3300006031 | Soil | MQLDANVENQDRAEGGKNEAGGMESSGRGRKHVGNGAANDRSD |
| Ga0075024_1007972582 | 3300006047 | Watersheds | MNVQLIANEEDQDRAQCGKNQASGMISFVCRARKHV |
| Ga0075017_1000225353 | 3300006059 | Watersheds | MNLQLIANEENQDRAQCGKNEAGGMISFVCRARKHVGNGAADDRSDDAEHD |
| Ga0070765_1016248061 | 3300006176 | Soil | MDIQLDTNVENQDRAKCGKNEAGGMKSFVCRVRKHV |
| Ga0070765_1020585372 | 3300006176 | Soil | MDIQLNANVENQDRAKCGKNEAGGMKSFVCRVRKHV |
| Ga0079222_101309581 | 3300006755 | Agricultural Soil | MDLQFKANEEDQDRAQRGKNEAGGMKSLVSRARKHVAN |
| Ga0075428_1025815342 | 3300006844 | Populus Rhizosphere | MQLKAKVEDQDRAECGKNDTSGMKSSGRRRKHMGNGAANDRSDDA |
| Ga0073928_106541431 | 3300006893 | Iron-Sulfur Acid Spring | MNLQLIANEENQDRSQYGRNEAGGMISFVGRTRKHVGHGAAENRSD |
| Ga0099829_114768011 | 3300009038 | Vadose Zone Soil | MNLELEANEENQDRAEYRNNQAGGMISLIRRARKHVCN |
| Ga0066709_1013669091 | 3300009137 | Grasslands Soil | MDVQLNTNVEDQDRAECGKNEAGRMKSSGYRVRKHVG |
| Ga0116225_13026261 | 3300009524 | Peatlands Soil | MNVQLIANEENQDRAQCGKYQAGGMISVVCRAEKHVGNGTPKD* |
| Ga0116118_11348832 | 3300009637 | Peatland | MNLQLKANEENQDRAQCGKNEAGGMISFVCRARKHVGNGA |
| Ga0116126_10266951 | 3300009640 | Peatland | MNLQLKANEENQDRAQCGKNEAGGMISFVCRARKHVGN |
| Ga0134080_101328331 | 3300010333 | Grasslands Soil | MDIQLKANVENQDRAKCGKNEAGGMKSSGCRVRKH |
| Ga0126378_109570642 | 3300010361 | Tropical Forest Soil | MQLNAQVENQDRPNCGKNEAGGMKSSCRRRRKQVGNG |
| Ga0136449_1033241991 | 3300010379 | Peatlands Soil | MDFQFIANVESQDRAQCGKNEAGGMIALVFGAQKHVGNAAAEDL |
| Ga0150983_144822791 | 3300011120 | Forest Soil | MANEENQDGAQCRKNEASRMISFVLRAKHYVSNAAAEYRS |
| Ga0137382_104443543 | 3300012200 | Vadose Zone Soil | MQLNAQVENQDRPNGGKNESGGMKSSCRRRRKQVGNGA |
| Ga0137382_104803423 | 3300012200 | Vadose Zone Soil | MQLKANVEKQDRAKCGKNEAGGMKSSGCRVRKHVG |
| Ga0137365_103375042 | 3300012201 | Vadose Zone Soil | MDIQPDANVENQDRAKCGKNEAGGMKSSGYRARKHVGN |
| Ga0137363_100352231 | 3300012202 | Vadose Zone Soil | MDVQLNANVEEQDRAECGKNEACGMKSSGYRVRKHVCNGAADD |
| Ga0137379_107076882 | 3300012209 | Vadose Zone Soil | MDMQLKANVEKQDRAKCGKNDSGGMKSSGCRGRKHVGNRAADDR |
| Ga0137378_109223283 | 3300012210 | Vadose Zone Soil | MDVQLNANVEDQDRAKCGKNETGGMKSSGYRARKHVGNR |
| Ga0137370_101733213 | 3300012285 | Vadose Zone Soil | MDIQLNANVEDQDRAKCGKNETGGMKSLVCRMQKHVGNRAA |
| Ga0137371_102185162 | 3300012356 | Vadose Zone Soil | MDVQLNANVEDQDRAEGGKNEAGGMKSSGYRARKHVGNSATD |
| Ga0137384_109753382 | 3300012357 | Vadose Zone Soil | MDMQLKANVEKQDRAKCGKNDSGGMKSSGCRGRKHV |
| Ga0137419_106339391 | 3300012925 | Vadose Zone Soil | MNVQLIANEENQDRAQCGKNEAGGMISFVCRARKHV |
| Ga0137404_115030571 | 3300012929 | Vadose Zone Soil | MDMQLKANVEKQDRAKCGKNEAGGMKSSGCRVRKHVG |
| Ga0164306_100505111 | 3300012988 | Soil | MDVQLDANVEKQDRAKCGKNDSGGVKSSGNRAKQVG |
| Ga0134079_103682332 | 3300014166 | Grasslands Soil | MDIQLNANVEDQDRAKCGKNEAGGMISSGYRARKHVG |
| Ga0181536_101661212 | 3300014638 | Bog | MDVQLIANEENQDRAQCGENEAGGMISAVCRAPKHVGNGAA |
| Ga0182036_101936752 | 3300016270 | Soil | MNPQLVANEENQDRAQCGKNKAGGMISFVCWARKRVGNAAADDRS |
| Ga0187824_100655061 | 3300017927 | Freshwater Sediment | MNIQLIANEENQDRAQRGKNQAGRMISVVCRAEKHVGNGAPQDRSDDAEHDRPED |
| Ga0187848_100536513 | 3300017935 | Peatland | MNLQLIANEENQDRAQCGKNEAGGMISFVCRARKHVGN |
| Ga0187847_107666662 | 3300017948 | Peatland | MDLQLIANVESQDRAQRGENEAGGMIPVVSRARKHVGNGTSEDRSDNA |
| Ga0187870_11849491 | 3300017998 | Peatland | MNVQLKANEENQDRAQCGKNEPGGMISFVCRARKHVGKAAAQDRSDDAEH |
| Ga0187865_12560561 | 3300018004 | Peatland | MNLQLIVDEENQDRAQCGKNEAGGMVSFVCRARKHVGKGAAHNRSDDAE |
| Ga0187878_10499402 | 3300018005 | Peatland | MNVQLKANEENQDRAQYGKNEAGGMISFVSRAQKHVGNGAAE |
| Ga0187804_105615102 | 3300018006 | Freshwater Sediment | MNLQLIADVENQDRAQCGENEAGGMVSVVLRPRKHVGNGAAEDRSDD |
| Ga0187860_13540971 | 3300018014 | Peatland | MNLQLIANEENEDRAHGGENEAGRMISFICRARKHVRNGAAHDR |
| Ga0187864_102456431 | 3300018022 | Peatland | MDVQLIANEENQDRAQCGENEAGGMISAVCRAPKHVGNGAADDRSDD |
| Ga0187855_109431031 | 3300018038 | Peatland | MNLQLIANEEDQDCAHGGKYEASGMESFVCRARKHVGKAAAK |
| Ga0187851_108076101 | 3300018046 | Peatland | MNLQLVANEESQDCAQCRKNKAGWMISVVSGAKNQVGNTAAEERSDDAEHDCP |
| Ga0187858_100404824 | 3300018057 | Peatland | MNLQLIADVKYQDRAQCGKNEASGMISFVFRAQKYVGNGAAEDRSDDAEH |
| Ga0066662_114245462 | 3300018468 | Grasslands Soil | MQLNAQVENQDRAECGKNEAGGVKSSRCRVRKHVGNRAADDRSDDAE |
| Ga0193746_10288691 | 3300019870 | Soil | MQLKANVEKQDRAKCGKNDSGWMKSSGCRVRKHVCNRAA |
| Ga0193746_10339261 | 3300019870 | Soil | MDVQLDANVENQDRAECGKNESGGMKSSGYRAREHVGNGAA |
| Ga0193713_11660361 | 3300019882 | Soil | VQLKANVEKQDRAKCGKNDSGGMKSSGCRGRKHVG |
| Ga0193729_11586382 | 3300019887 | Soil | MDIQLDANVENQDRAKCRKNEAGGMKSFVCRVRKHVGNR |
| Ga0193755_11115642 | 3300020004 | Soil | VQLKANVEKQDRAKCGKNDSGGMKSSGCRVRKHVCNRAADD |
| Ga0210407_100159954 | 3300020579 | Soil | MNLKFIADVEKQNCAQGGKNEAGGMISFVFRARKHVSNGAAEDRSDDAEHDRPERR |
| Ga0210407_105079291 | 3300020579 | Soil | MDIQPDANVEDQDRAKCGKNEAGGMESSGGRVRKHVG |
| Ga0210403_109593601 | 3300020580 | Soil | MNVQLVANKKNQDRAQCGKNKAGGMIAFVCRARKHVRNGAAEDASD |
| Ga0210401_109523352 | 3300020583 | Soil | MNIQLIANKKNEHCAQGGKDEAGGMISLVGRACKHVGNAAADDPSNDAEDDR |
| Ga0210404_102093522 | 3300021088 | Soil | MNLQLIANEENQDRAQCGKNEAGRMISFVCRARKHVGKGAAQDRSDDAEHD |
| Ga0210400_104380162 | 3300021170 | Soil | MNVQLIANEENQDRAQRGKNQAGGMILFVCRAQKHVSNGAPKDRSDDAEHDC |
| Ga0210405_106143082 | 3300021171 | Soil | MNLQLVANEENQNRAQCGKNEAGGVISFVCRAGKHVDNTAA |
| Ga0210396_109832661 | 3300021180 | Soil | MNLQLIANEENQDRAQCGKNETGGMISFVCRARKHVGNGAADDRSD |
| Ga0210397_107714202 | 3300021403 | Soil | MNIQLIANKKNEHCAQGGKDEAGGMISLVGRACKHVGNAAADDPSNDAEDDRP |
| Ga0210397_114989381 | 3300021403 | Soil | MNLQLIANEENQDRAQCGENEAGGMISFVCRARKHVANAA |
| Ga0210394_111937471 | 3300021420 | Soil | MNVQLVANEENQDRAECGKNEAGGMISFVCRARKHVGNAAADDRSE |
| Ga0210384_116350491 | 3300021432 | Soil | MNLQLIANEENQDRAQCGKNEAGRMISFVCRARKHVGKG |
| Ga0210391_104011701 | 3300021433 | Soil | MNFQLEADKEDQDRAQRGENEAGGMISLVLRAKNHVGNTAAEE |
| Ga0210391_113898911 | 3300021433 | Soil | MNPQLITNEEDQDRAQRGKNETGGMISFVCRARKHVANAATDYRADDAEHYR |
| Ga0210398_113234461 | 3300021477 | Soil | MNVQLIADVENQDRAQGGKNEAGGMISFVCRARKHVSNAATD |
| Ga0210409_103898071 | 3300021559 | Soil | MNVQLMANEENQDRAQCGKNQAGGMISFICRAQKHVGNG |
| Ga0224452_11056782 | 3300022534 | Groundwater Sediment | MQLKASVENQDRAKCGKNDAGGMKSSGCRRRKQVGNGPAEDRSDDAEH |
| Ga0193714_10052703 | 3300023058 | Soil | MDVQLNANVEDQDRAECGKNEPGGMKSSGYRARKHVCNS |
| Ga0193714_10369282 | 3300023058 | Soil | MDVQLDANVENQDRAKCGKNETGGMKSSGYRARKHVGNR |
| Ga0224572_10764832 | 3300024225 | Rhizosphere | MNVQLIANEKNEDRAQCRKNKASGMISFVCWAEKQMGDGAPEDR |
| Ga0224556_10769281 | 3300024295 | Soil | MNLELVADEENQDRAQCGKDDAGGMKSLVFRARNHMGEAAA |
| Ga0208323_10243481 | 3300025439 | Peatland | MNLQLIANEENEDRAHCGKNEAGGMISFICWARKHVRNGAAYDR |
| Ga0208562_10346651 | 3300025460 | Peatland | MNLQLIANEENEDRAHCGKNEAGGMISFICWARKHVRNGAA |
| Ga0208715_10649662 | 3300025482 | Arctic Peat Soil | MNLQLIANEENQDRAQCGKNEAGGMISFVCRARKHV |
| Ga0207685_105961711 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MDLQLKANKEDQDRAQRGKNKAGGMKSLVCRAGKHVADCAAEDGSD |
| Ga0207693_102013634 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MDIQLDANVENQDRAKCGKNEAGRMKSSGCRVRKHV |
| Ga0207693_108601311 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MDIQLDANVENQDRAKCGKNKAGGMKSFVCRVRKHVGNRPADDRSDDAE |
| Ga0207663_117052701 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MNLQLKANKEDQDRAQRGKNKAGGMISLICRAGKHVRNCAADDRSY |
| Ga0207665_104822672 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MQLKANVEKQDRAKRGKNDSGGMKSSGWRRKQVGNRAA |
| Ga0207665_109323441 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MDIELDAKVENQDRAKCGKNEAGGMKSSGCRVRKHVRKRAADD |
| Ga0207679_107506572 | 3300025945 | Corn Rhizosphere | VQLKADEEDEDRAECGKDDTGGMKSSARRRKHVGNSAADDRTEDA |
| Ga0209268_11412981 | 3300026314 | Soil | VGKTNVQLIASVENQDRAKCGKNETGGMISSGHWARKHVGNRAADDRSD |
| Ga0209378_12357801 | 3300026528 | Soil | MDIQLDANIENQDRAKCGKNEAGGMKSSGCRVRKHVGNRAA |
| Ga0209577_101653223 | 3300026552 | Soil | MDVQLNANVEEQDCAECGKNETGRMKSSGYRVRKHMCNSAA |
| Ga0179587_101478011 | 3300026557 | Vadose Zone Soil | MNLQLIENEENQDRAQCGKNEAGRMISFVCRARKHVGNGTAEDRSDDAEHDRP |
| Ga0207462_10026151 | 3300026903 | Soil | MDIQPDANVEDQDRAKCGKNEAGGMESSGCRVRKHVGNRAADD |
| Ga0209967_10395281 | 3300027364 | Arabidopsis Thaliana Rhizosphere | MDIQPDANVEDQDRAKCGKNEAGGMESSGCRVRKHVGN |
| Ga0209736_11937181 | 3300027660 | Forest Soil | MNLQLVANEENQDRAQCGKNEAGRMISFVSRARKHVGNAPA |
| Ga0209446_10540811 | 3300027698 | Bog Forest Soil | MNLQLIADKENQDRAQCGKNEASRMVPFVCRARKHVTNAAADDRP |
| Ga0209701_104100892 | 3300027862 | Vadose Zone Soil | MNLQLKANVENQDRAQCGKNEAGGMISFVCRARKHVSNGAADD |
| Ga0209275_101659231 | 3300027884 | Soil | MNLQPIANEENQDRSQYGKNEAGWMISFVPRARKHVGNGAAEDRSYDA |
| Ga0209526_102314231 | 3300028047 | Forest Soil | MNLQLIANEENQDRAQCGKNEAGGMIPFVCRARKHVGNGAADDRSDD |
| Ga0302233_100292781 | 3300028746 | Palsa | MREMDIQLIANEEKQNRAEAGKDEAGGMITFVSRARKHVGNSAADDRTDDAEHDRPEHR |
| Ga0302231_102789751 | 3300028775 | Palsa | LELDMGKMNPQLIANEEKQDRAEGGKNEAGGMIAFVFWARKHVGNGAADDRTDDA |
| Ga0302226_102816271 | 3300028801 | Palsa | MREMDIQLIANEEKQNRAEAGKDEAGGMITFVSRAQKHVGNGAADDRTDDADHDRPEHR |
| Ga0307304_101576653 | 3300028885 | Soil | MDIQPDANVEDQDRAKCGKNEAGGMESSGCRVRKHVGNRAADDRS |
| Ga0222749_105968762 | 3300029636 | Soil | MLDLGKMNIQLKANVQNQDRGQRGKNEAGGMKSFVCRTRKHVSNTAADDRSDDA |
| Ga0311352_104379641 | 3300029944 | Palsa | MDIQLIANEEKQDRAEGGKNEAGGMITFVSRAQKHVGNGAADDRTDDADH |
| Ga0302306_101297682 | 3300030043 | Palsa | MRKMDIQLIANEEKQDRAEAGKDEAGGMITFVSRARKHVGNSAADDRTDDAEHDRPE |
| Ga0302179_100403314 | 3300030058 | Palsa | MGKMNPQLIANEENKDRAECGKNEAGGMIAFVFWARKHVGNGAADDRTDDA |
| Ga0311353_112754511 | 3300030399 | Palsa | MNPQLEANEENQDRAQGGENEAGGMIAFISRARKHVGHGAAEDRSDD |
| Ga0075374_108620542 | 3300030855 | Soil | MDIQLDANVENQDRAKGGKNEAGGMKSFVCRVRKHVGNRAADD |
| Ga0170823_152010871 | 3300031128 | Forest Soil | MDIQLDANVENQDRAKGGKNEASGMKSFVCRVRKHVGNRAADDRSEDAE |
| Ga0170824_1233601272 | 3300031231 | Forest Soil | TRLDLRKMNPQLITNEEDQDRAQSGKNETGGMISFVCRARKHVANAATDYRADDAKH |
| Ga0170818_1024738561 | 3300031474 | Forest Soil | MDIQLDANVENQDRAKCGKNEAGGMKAFVCRVRKHVGNRAAD |
| Ga0310686_1188054391 | 3300031708 | Soil | MNFQLVADVENRDRTQCGKNEAGGMVSLVLRAKNHVANAAAKEGSDDAKND |
| Ga0307478_104937842 | 3300031823 | Hardwood Forest Soil | MNIQLIANEENQNRAQGGQNKASVMVSFIGRARKHVGNAAADDRSNDAK |
| Ga0302315_101530811 | 3300031837 | Palsa | MREMDIQLIANEEKQNRAEAGKDEAGGMITFVSRARKHVGNSAADDRTDDAEHDRPE |
| Ga0311301_105433341 | 3300032160 | Peatlands Soil | MNLELIADVENQDRAQRGKNEARGMISFVCRAPKDVR |
| Ga0307470_110198781 | 3300032174 | Hardwood Forest Soil | MDVQLDANVQDEDRAECGKNETSGMISSGYRARKHVGNGAAD |
| Ga0307472_1003697201 | 3300032205 | Hardwood Forest Soil | MNIQLIANEENQDRAQCGQDEAGGMISFVCRARKHVGNAAADDRPDDAEHDGPEDR |
| Ga0334792_043414_1313_1432 | 3300033888 | Soil | MNPQPNANIENQDCAQRGKDEAGGMESFAPRARKHVGDAA |
| ⦗Top⦘ |