| Basic Information | |
|---|---|
| Family ID | F056651 |
| Family Type | Metagenome |
| Number of Sequences | 137 |
| Average Sequence Length | 46 residues |
| Representative Sequence | VTVVSASVLEALPIPSFEVVEDDLFDVPLPNLGFSGVAGNFKKVIK |
| Number of Associated Samples | 74 |
| Number of Associated Scaffolds | 137 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 32.12 % |
| % of genes from short scaffolds (< 2000 bps) | 97.08 % |
| Associated GOLD sequencing projects | 73 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.18 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (91.971 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (90.511 % of family members) |
| Environment Ontology (ENVO) | Unclassified (91.241 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (90.511 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 9.46% β-sheet: 0.00% Coil/Unstructured: 90.54% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.18 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 137 Family Scaffolds |
|---|---|---|
| PF13456 | RVT_3 | 0.73 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 91.97 % |
| All Organisms | root | All Organisms | 8.03 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003316|rootH1_10105981 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 1243 | Open in IMG/M |
| 3300005334|Ga0068869_100505490 | Not Available | 1010 | Open in IMG/M |
| 3300005718|Ga0068866_10150928 | Not Available | 1345 | Open in IMG/M |
| 3300006358|Ga0068871_100236574 | Not Available | 1587 | Open in IMG/M |
| 3300011119|Ga0105246_11762242 | Not Available | 590 | Open in IMG/M |
| 3300013296|Ga0157374_11225788 | Not Available | 772 | Open in IMG/M |
| 3300015267|Ga0182122_1000500 | Not Available | 1967 | Open in IMG/M |
| 3300015267|Ga0182122_1004544 | Not Available | 1063 | Open in IMG/M |
| 3300015267|Ga0182122_1005665 | Not Available | 999 | Open in IMG/M |
| 3300015268|Ga0182154_1008529 | Not Available | 896 | Open in IMG/M |
| 3300015268|Ga0182154_1019566 | Not Available | 721 | Open in IMG/M |
| 3300015269|Ga0182113_1018956 | Not Available | 811 | Open in IMG/M |
| 3300015269|Ga0182113_1044664 | Not Available | 637 | Open in IMG/M |
| 3300015269|Ga0182113_1060992 | Not Available | 581 | Open in IMG/M |
| 3300015274|Ga0182188_1001449 | Not Available | 1370 | Open in IMG/M |
| 3300015274|Ga0182188_1008504 | Not Available | 837 | Open in IMG/M |
| 3300015274|Ga0182188_1008926 | Not Available | 826 | Open in IMG/M |
| 3300015275|Ga0182172_1003115 | Not Available | 1210 | Open in IMG/M |
| 3300015276|Ga0182170_1016552 | Not Available | 773 | Open in IMG/M |
| 3300015277|Ga0182128_1003025 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 1231 | Open in IMG/M |
| 3300015279|Ga0182174_1003625 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 1215 | Open in IMG/M |
| 3300015279|Ga0182174_1006317 | Not Available | 1039 | Open in IMG/M |
| 3300015279|Ga0182174_1031363 | Not Available | 674 | Open in IMG/M |
| 3300015281|Ga0182160_1005409 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 1069 | Open in IMG/M |
| 3300015281|Ga0182160_1058390 | Not Available | 560 | Open in IMG/M |
| 3300015283|Ga0182156_1004556 | Not Available | 1156 | Open in IMG/M |
| 3300015283|Ga0182156_1081164 | Not Available | 515 | Open in IMG/M |
| 3300015285|Ga0182186_1026794 | Not Available | 698 | Open in IMG/M |
| 3300015285|Ga0182186_1060436 | Not Available | 553 | Open in IMG/M |
| 3300015285|Ga0182186_1064309 | Not Available | 543 | Open in IMG/M |
| 3300015287|Ga0182171_1009507 | Not Available | 937 | Open in IMG/M |
| 3300015287|Ga0182171_1011850 | Not Available | 882 | Open in IMG/M |
| 3300015287|Ga0182171_1012799 | Not Available | 863 | Open in IMG/M |
| 3300015287|Ga0182171_1066154 | Not Available | 549 | Open in IMG/M |
| 3300015287|Ga0182171_1083726 | Not Available | 511 | Open in IMG/M |
| 3300015288|Ga0182173_1002078 | Not Available | 1402 | Open in IMG/M |
| 3300015289|Ga0182138_1041731 | Not Available | 629 | Open in IMG/M |
| 3300015289|Ga0182138_1065742 | Not Available | 551 | Open in IMG/M |
| 3300015291|Ga0182125_1008658 | Not Available | 987 | Open in IMG/M |
| 3300015291|Ga0182125_1023656 | Not Available | 751 | Open in IMG/M |
| 3300015291|Ga0182125_1036689 | Not Available | 664 | Open in IMG/M |
| 3300015291|Ga0182125_1076860 | Not Available | 536 | Open in IMG/M |
| 3300015292|Ga0182141_1024745 | Not Available | 740 | Open in IMG/M |
| 3300015292|Ga0182141_1028454 | Not Available | 712 | Open in IMG/M |
| 3300015294|Ga0182126_1010013 | Not Available | 955 | Open in IMG/M |
| 3300015295|Ga0182175_1005227 | Not Available | 1155 | Open in IMG/M |
| 3300015295|Ga0182175_1009161 | Not Available | 990 | Open in IMG/M |
| 3300015296|Ga0182157_1004003 | Not Available | 1267 | Open in IMG/M |
| 3300015298|Ga0182106_1002628 | Not Available | 1467 | Open in IMG/M |
| 3300015298|Ga0182106_1061066 | Not Available | 591 | Open in IMG/M |
| 3300015300|Ga0182108_1002085 | Not Available | 1553 | Open in IMG/M |
| 3300015300|Ga0182108_1022689 | Not Available | 795 | Open in IMG/M |
| 3300015302|Ga0182143_1006969 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 1084 | Open in IMG/M |
| 3300015302|Ga0182143_1007194 | Not Available | 1073 | Open in IMG/M |
| 3300015302|Ga0182143_1017108 | Not Available | 849 | Open in IMG/M |
| 3300015304|Ga0182112_1006121 | Not Available | 1126 | Open in IMG/M |
| 3300015304|Ga0182112_1101037 | Not Available | 510 | Open in IMG/M |
| 3300015305|Ga0182158_1030338 | Not Available | 724 | Open in IMG/M |
| 3300015305|Ga0182158_1104445 | Not Available | 503 | Open in IMG/M |
| 3300015307|Ga0182144_1049344 | Not Available | 639 | Open in IMG/M |
| 3300015307|Ga0182144_1064056 | Not Available | 592 | Open in IMG/M |
| 3300015308|Ga0182142_1013572 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 941 | Open in IMG/M |
| 3300015308|Ga0182142_1108064 | Not Available | 513 | Open in IMG/M |
| 3300015314|Ga0182140_1002135 | Not Available | 1566 | Open in IMG/M |
| 3300015314|Ga0182140_1054452 | Not Available | 635 | Open in IMG/M |
| 3300015321|Ga0182127_1079305 | Not Available | 582 | Open in IMG/M |
| 3300015322|Ga0182110_1002057 | Not Available | 1618 | Open in IMG/M |
| 3300015323|Ga0182129_1087950 | Not Available | 548 | Open in IMG/M |
| 3300015323|Ga0182129_1116287 | Not Available | 502 | Open in IMG/M |
| 3300015342|Ga0182109_1091819 | Not Available | 701 | Open in IMG/M |
| 3300015342|Ga0182109_1172037 | Not Available | 556 | Open in IMG/M |
| 3300015343|Ga0182155_1037695 | Not Available | 942 | Open in IMG/M |
| 3300015343|Ga0182155_1161154 | Not Available | 570 | Open in IMG/M |
| 3300015344|Ga0182189_1016244 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 1253 | Open in IMG/M |
| 3300015345|Ga0182111_1041196 | Not Available | 973 | Open in IMG/M |
| 3300015345|Ga0182111_1232132 | Not Available | 513 | Open in IMG/M |
| 3300015346|Ga0182139_1070962 | Not Available | 804 | Open in IMG/M |
| 3300015346|Ga0182139_1099676 | Not Available | 710 | Open in IMG/M |
| 3300015347|Ga0182177_1133762 | Not Available | 638 | Open in IMG/M |
| 3300015351|Ga0182161_1137645 | Not Available | 655 | Open in IMG/M |
| 3300015351|Ga0182161_1251741 | Not Available | 515 | Open in IMG/M |
| 3300015355|Ga0182159_1182650 | Not Available | 668 | Open in IMG/M |
| 3300015361|Ga0182145_1097704 | Not Available | 634 | Open in IMG/M |
| 3300017404|Ga0182203_1007321 | Not Available | 1284 | Open in IMG/M |
| 3300017404|Ga0182203_1118392 | Not Available | 560 | Open in IMG/M |
| 3300017407|Ga0182220_1052534 | Not Available | 617 | Open in IMG/M |
| 3300017409|Ga0182204_1038462 | Not Available | 708 | Open in IMG/M |
| 3300017410|Ga0182207_1019483 | Not Available | 1017 | Open in IMG/M |
| 3300017410|Ga0182207_1138544 | Not Available | 547 | Open in IMG/M |
| 3300017411|Ga0182208_1033218 | Not Available | 760 | Open in IMG/M |
| 3300017411|Ga0182208_1085677 | Not Available | 573 | Open in IMG/M |
| 3300017413|Ga0182222_1005601 | Not Available | 1070 | Open in IMG/M |
| 3300017415|Ga0182202_1011804 | Not Available | 1065 | Open in IMG/M |
| 3300017415|Ga0182202_1030535 | Not Available | 807 | Open in IMG/M |
| 3300017420|Ga0182228_1016804 | Not Available | 1114 | Open in IMG/M |
| 3300017420|Ga0182228_1042368 | Not Available | 762 | Open in IMG/M |
| 3300017424|Ga0182219_1024193 | Not Available | 869 | Open in IMG/M |
| 3300017424|Ga0182219_1089892 | Not Available | 579 | Open in IMG/M |
| 3300017425|Ga0182224_1109551 | Not Available | 576 | Open in IMG/M |
| 3300017427|Ga0182190_1112482 | Not Available | 574 | Open in IMG/M |
| 3300017430|Ga0182192_1004912 | Not Available | 1619 | Open in IMG/M |
| 3300017430|Ga0182192_1127996 | Not Available | 559 | Open in IMG/M |
| 3300017430|Ga0182192_1145759 | Not Available | 534 | Open in IMG/M |
| 3300017433|Ga0182206_1009793 | Not Available | 1178 | Open in IMG/M |
| 3300017433|Ga0182206_1087504 | Not Available | 609 | Open in IMG/M |
| 3300017436|Ga0182209_1056249 | Not Available | 721 | Open in IMG/M |
| 3300017436|Ga0182209_1080525 | Not Available | 645 | Open in IMG/M |
| 3300017438|Ga0182191_1024916 | Not Available | 960 | Open in IMG/M |
| 3300017438|Ga0182191_1070420 | Not Available | 692 | Open in IMG/M |
| 3300017438|Ga0182191_1093577 | Not Available | 630 | Open in IMG/M |
| 3300017442|Ga0182221_1042069 | Not Available | 772 | Open in IMG/M |
| 3300017442|Ga0182221_1050563 | Not Available | 732 | Open in IMG/M |
| 3300017442|Ga0182221_1064537 | Not Available | 679 | Open in IMG/M |
| 3300017442|Ga0182221_1096933 | Not Available | 600 | Open in IMG/M |
| 3300017443|Ga0182193_1108146 | Not Available | 619 | Open in IMG/M |
| 3300017681|Ga0182226_1054265 | Not Available | 727 | Open in IMG/M |
| 3300017683|Ga0182218_1030743 | Not Available | 818 | Open in IMG/M |
| 3300017683|Ga0182218_1037076 | Not Available | 774 | Open in IMG/M |
| 3300017683|Ga0182218_1081933 | Not Available | 611 | Open in IMG/M |
| 3300017683|Ga0182218_1108661 | Not Available | 561 | Open in IMG/M |
| 3300017684|Ga0182225_1057410 | Not Available | 669 | Open in IMG/M |
| 3300017684|Ga0182225_1120746 | Not Available | 532 | Open in IMG/M |
| 3300017686|Ga0182205_1002453 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 1919 | Open in IMG/M |
| 3300017686|Ga0182205_1028386 | Not Available | 905 | Open in IMG/M |
| 3300017686|Ga0182205_1035317 | Not Available | 845 | Open in IMG/M |
| 3300017689|Ga0182231_1070994 | Not Available | 660 | Open in IMG/M |
| 3300017690|Ga0182223_1042501 | Not Available | 676 | Open in IMG/M |
| 3300017690|Ga0182223_1122694 | Not Available | 504 | Open in IMG/M |
| 3300025899|Ga0207642_10899271 | Not Available | 567 | Open in IMG/M |
| 3300025908|Ga0207643_10001790 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 11959 | Open in IMG/M |
| 3300025926|Ga0207659_11533039 | Not Available | 570 | Open in IMG/M |
| 3300025935|Ga0207709_10665276 | Not Available | 830 | Open in IMG/M |
| 3300025938|Ga0207704_10067726 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 2247 | Open in IMG/M |
| 3300026023|Ga0207677_10523139 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 1029 | Open in IMG/M |
| 3300026023|Ga0207677_10749631 | Not Available | 870 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Miscanthus Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere | 90.51% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 5.11% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.46% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.73% |
| Sugarcane Root And Bulk Soil | Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil | 0.73% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.73% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.73% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003316 | Sugarcane root Sample L1 | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015267 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015268 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015269 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015274 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015275 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015276 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015277 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015279 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015281 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015283 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015285 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015287 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015288 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015289 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015291 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015292 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015294 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015295 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015296 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015298 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015300 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015302 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015304 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015305 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015307 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015308 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015314 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015321 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015322 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015323 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015342 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015343 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015344 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015345 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015346 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015347 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015351 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015355 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015361 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017404 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017407 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017409 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017410 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017411 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017413 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017415 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017420 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017424 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017425 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017427 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017430 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017433 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017436 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017438 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017442 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017443 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017681 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017683 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017684 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017686 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017689 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017690 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| rootH1_101059812 | 3300003316 | Sugarcane Root And Bulk Soil | VIVVSASVPKAIPIPSFEVVVDDLFNVPLPNLGFSGVAGSFRKVIR* |
| Ga0068869_1005054902 | 3300005334 | Miscanthus Rhizosphere | VTVVSASVLEALPIPSFEVVEDDLFDVPLPNLGFSGVAGNFKKVIK* |
| Ga0068866_101509284 | 3300005718 | Miscanthus Rhizosphere | VTVVSASVLEALPIPSFEVVEDDLFDVPLPNLGFSGVARNFKKVIK* |
| Ga0068871_1002365745 | 3300006358 | Miscanthus Rhizosphere | EALPIPSFEVVEDDLFDVPLPNLGFSGVAGNFKKVIK* |
| Ga0105246_117622422 | 3300011119 | Miscanthus Rhizosphere | PCAPSVIVVSASVLEALPIPSFEVVEDDLFDVPLPNLGFSGVAENFKKVIK* |
| Ga0157374_112257881 | 3300013296 | Miscanthus Rhizosphere | VTVASASIPEAILVPSFEVVADDLFGVPLPSLGFLEVAGSFK |
| Ga0182122_10005004 | 3300015267 | Miscanthus Phyllosphere | VIVASASVLESLPIHSFEVVEDDLFDAPLPNLGFSGVAGNFKKVIK* |
| Ga0182122_10045442 | 3300015267 | Miscanthus Phyllosphere | VTVVSASILGAIPIPSFEVVEDDLFNVPLPNLGFLGVAGSFKKVIK* |
| Ga0182122_10056652 | 3300015267 | Miscanthus Phyllosphere | VTVASASVLEAIPVPSFEVVEDDLFDVPLPSLGFSGVASSFNKAIK* |
| Ga0182154_10085292 | 3300015268 | Miscanthus Phyllosphere | VIVVSASVPEAVPIPSFEVVEDDLFNVPLPNLGFSGVAGSFKKVIK* |
| Ga0182154_10195663 | 3300015268 | Miscanthus Phyllosphere | GAIPIPSFEAVEDDLFDVPLLSLGFSGVAGSFKKVIK* |
| Ga0182113_10189562 | 3300015269 | Miscanthus Phyllosphere | SASVPEVIPIPSFEVVEDDLFNVPLPNLGFSRVAGSFKKVIK* |
| Ga0182113_10446642 | 3300015269 | Miscanthus Phyllosphere | MTIVSASVLEAISIPSFEVVEDDLFNVPLPNLGFSGVAGSFKKVIK* |
| Ga0182113_10609922 | 3300015269 | Miscanthus Phyllosphere | MTVVSASVLGAIPIPSFEVVEDDLFDVPLPSLGFLEVAGSFKKAIK* |
| Ga0182188_10014491 | 3300015274 | Miscanthus Phyllosphere | SRKPAPCAPSVTVVSASVLEALPIPSFEVVEDDLFDVPLLNLGFSGVAGNFKKVIK* |
| Ga0182188_10085041 | 3300015274 | Miscanthus Phyllosphere | MTVVSASVLEALPIPSFEVVEDDLFDVPLPNLGFSGVARNFKKVIK* |
| Ga0182188_10089261 | 3300015274 | Miscanthus Phyllosphere | SRKPAPCAPSVIVVSASVLEAIPIPSFEVVEDDLFNVPLSNLGFSGVAGSFKKVIK* |
| Ga0182172_10031154 | 3300015275 | Miscanthus Phyllosphere | VTVVSASVLEALPIPSFEVVDDDLFDVPLPNLGFLGVAGNFKKVIK* |
| Ga0182170_10165521 | 3300015276 | Miscanthus Phyllosphere | VIVVSASVPEVIPIPSFEVVEDDLFNVPLPNLGFSGVAGSFKKVIK* |
| Ga0182128_10030253 | 3300015277 | Miscanthus Phyllosphere | VIVVSASVLEAIPIPSFEVVEDDLFDVPLPDLGFSGVASSSKKVIK* |
| Ga0182174_10036252 | 3300015279 | Miscanthus Phyllosphere | VIVVSASVLEALPIPSFEVVEDDLFDVPLLNLGFSGVARNFKKVIK* |
| Ga0182174_10063172 | 3300015279 | Miscanthus Phyllosphere | VTVAFASVPKAIPIPSFELVGDDLFDMPLLDLGFSGVAGNFKKVIK* |
| Ga0182174_10313631 | 3300015279 | Miscanthus Phyllosphere | VTVVSASVPEAIPIPSFEVVEDDLFNVPLPNLGFSRVAGSFKKVIK* |
| Ga0182160_10054092 | 3300015281 | Miscanthus Phyllosphere | VIVVSASVLEALPIPSFKVVEDDLFDVPLSNLGFSGVAGNFKNVIK* |
| Ga0182160_10583901 | 3300015281 | Miscanthus Phyllosphere | VTVVSASVLEAIPIPSFEVVEDDLFNVPLPNLGFSGVAGSFKKVIK* |
| Ga0182156_10045562 | 3300015283 | Miscanthus Phyllosphere | VKVVSASVLEALPIPSFEVVEDDLFDVPLPNLGFSGVAGNFKKVIK* |
| Ga0182156_10811641 | 3300015283 | Miscanthus Phyllosphere | PNVTIASASVPEAIPIPSFEVVEDDLFSVPLPDFIFSEVAGDFKKVIK* |
| Ga0182186_10267941 | 3300015285 | Miscanthus Phyllosphere | VTVVSASVPEAIPIPSFEVVDDDLFNVPLPNLGFSGV |
| Ga0182186_10604361 | 3300015285 | Miscanthus Phyllosphere | FFQYSRKPAPCAPSVTVVSASVLEALPIPSFEVVEDDLFDVPLPNLGFSGVAGNFKKVIK |
| Ga0182186_10643092 | 3300015285 | Miscanthus Phyllosphere | VTVVSASVPEAIPIPSFEVVEDDLFNVPLLNLGFSGVAGSFKKVIK* |
| Ga0182171_10095072 | 3300015287 | Miscanthus Phyllosphere | VTVVSASVLGAIPIPSFEVVEDDLFDVPLLNLGFSRVAGSFKKVIK* |
| Ga0182171_10118503 | 3300015287 | Miscanthus Phyllosphere | VTVVSASVLEALPIPSFEVVEDDLFDVPLPNPGFSGVAGNFKKVIK* |
| Ga0182171_10127993 | 3300015287 | Miscanthus Phyllosphere | VTVVSASVLEALPIPSFEVVEDDLFDVPLPNLGFLGVPGNFKKVIK* |
| Ga0182171_10661542 | 3300015287 | Miscanthus Phyllosphere | VIVVSASILEALPIPSFEVVEDDLFDVPLPNLGFS |
| Ga0182171_10837261 | 3300015287 | Miscanthus Phyllosphere | APCAPSVTVVSASIPEAILIPSFEVVEDDLFNVPLPNLGFSGVACSFRKVIR* |
| Ga0182173_10020782 | 3300015288 | Miscanthus Phyllosphere | VTVVSASVLEAIPIPSFEVVEDDLFNVPLPNLGFSRVAGSFKKVIK* |
| Ga0182138_10417312 | 3300015289 | Miscanthus Phyllosphere | VIVVSASVLEALPIPSFEVVEDDLFDVPLPNLGFSGVAGNFKKVIK* |
| Ga0182138_10657422 | 3300015289 | Miscanthus Phyllosphere | VIVVSASVPEAIPTPSFEVVEDDLFNVPLSNLGFSGVAGSFKKVIK* |
| Ga0182125_10086583 | 3300015291 | Miscanthus Phyllosphere | MTIVSASVLEAISIPSFEVVEDDLFNVPLPNLGFSRVAGSFKKVIK* |
| Ga0182125_10236562 | 3300015291 | Miscanthus Phyllosphere | MTVVSASVLGAIRIPSFEVVEDDLFDVPLPSLGFSGVAGSFKKAIK* |
| Ga0182125_10366892 | 3300015291 | Miscanthus Phyllosphere | VTVVSASVPEAIPIPSFEVVEDDLFNVPLLNLGFLGVAGSFKKNIK* |
| Ga0182125_10768601 | 3300015291 | Miscanthus Phyllosphere | VIVVSASVLEALPIPCFEVVEDDLFDVPLPNLGFSGVAGNFKKVIK* |
| Ga0182141_10247452 | 3300015292 | Miscanthus Phyllosphere | MTVVSAFILGAIPIPSFEVVEDDLFDVPLPSLGFLEVAGSFKKAIK* |
| Ga0182141_10284541 | 3300015292 | Miscanthus Phyllosphere | VTIVSASVLEALPIPSFEVVEDDLFDVPLPNLGFSGVARNFKKVIK |
| Ga0182126_10100131 | 3300015294 | Miscanthus Phyllosphere | EALPIPSFEVVEDDLFDVPLPNIGFSGVAGNFKKVIK* |
| Ga0182175_10052273 | 3300015295 | Miscanthus Phyllosphere | VTVVSASVPEAIPIPFFEVVEDDLFNVPLPNLGFSGVAGSFKKVIK* |
| Ga0182175_10091612 | 3300015295 | Miscanthus Phyllosphere | VTVASASVLEAIPVPSFEVVADDLFDVPLLNLGSLEVAGSFKKAIK* |
| Ga0182157_10040035 | 3300015296 | Miscanthus Phyllosphere | LPIPSFEVVEDDLFDVPLPNLGFSGVARNFKKVIK* |
| Ga0182106_10026284 | 3300015298 | Miscanthus Phyllosphere | ASVLEALPIPSFEVVEDDLFDVPLLNLGFLGVAGNFKKVIK* |
| Ga0182106_10610661 | 3300015298 | Miscanthus Phyllosphere | QCAPSMTVVSTSVLEAILIPSFEVVEDDLFNVPLLNLGFSGVAGSFKKVIK* |
| Ga0182108_10020854 | 3300015300 | Miscanthus Phyllosphere | MTVVSASVPEAIPIPSFEVVEDDLFNVPLLNLGFSGVAGSFKKVIK* |
| Ga0182108_10226891 | 3300015300 | Miscanthus Phyllosphere | VTVVSASVLEALPIPSFEVVEDDLFDVPLPNLGFSGVAGNFKKV |
| Ga0182143_10069691 | 3300015302 | Miscanthus Phyllosphere | VTVVSTSILEALPIPSFEVVEDDLFDVPLPNLGFSGVAGNFKK |
| Ga0182143_10071941 | 3300015302 | Miscanthus Phyllosphere | IASASVPEAIPIPSFEVVEDDLFSVPLLDFIFLEVAGDFKKVIK* |
| Ga0182143_10171081 | 3300015302 | Miscanthus Phyllosphere | VIVVSASVPEDIPIPSFEVVEDDLFNVPLPNLGFSGVAGSFKKVIK* |
| Ga0182112_10061214 | 3300015304 | Miscanthus Phyllosphere | APCAPSMIVVSASVLGAIPIPSFEVVEEDLFDVPLPSLGFSGVAGSFKKVIK* |
| Ga0182112_11010371 | 3300015304 | Miscanthus Phyllosphere | VTVASASVLEAIPVPSFEVVEDDLFDVPLPSLGFSGVAGSFKKVIK* |
| Ga0182158_10303381 | 3300015305 | Miscanthus Phyllosphere | VTVVSASVLEAIPIPSFEVVEDDLFNVPLLNLGFSGVAGSFKKVIK* |
| Ga0182158_11044452 | 3300015305 | Miscanthus Phyllosphere | VTVASASVPEAIPVPSFEVVADDLFDVPLLNLGSLEVAGSFKKAIK* |
| Ga0182144_10493442 | 3300015307 | Miscanthus Phyllosphere | VTVAFASVPEAIPVPSFEVVEDDLFDVPLPSLGFSGVAGSFKKAIK* |
| Ga0182144_10640562 | 3300015307 | Miscanthus Phyllosphere | MTVVYASVLEALPIPSFEVVEDDLFDVPLPNLGFSGVAGNFKKVI* |
| Ga0182142_10135721 | 3300015308 | Miscanthus Phyllosphere | MTVVSASVLEALPIPSFEVVEDDLFDVPLSNLGFSGVAGNFKKVIK* |
| Ga0182142_11080642 | 3300015308 | Miscanthus Phyllosphere | VTVAFASVPKAIPIPSFELVGDDLFDMPLPDLGFLGVAGNFKK |
| Ga0182140_10021353 | 3300015314 | Miscanthus Phyllosphere | MTVVSASVLEAIPIPSFEVVEDDLFNVPLPNLGFSGVAGSFKKVIK* |
| Ga0182140_10544522 | 3300015314 | Miscanthus Phyllosphere | VPEAIPIPSFEVVEDDLFSVPLPDFIFLEVAGDFKKVIK* |
| Ga0182127_10793052 | 3300015321 | Miscanthus Phyllosphere | VTFVSTSVLEALPIPSFEVVDDDLFDVPLSNLGFLGVAGNFKKVIK* |
| Ga0182110_10020574 | 3300015322 | Miscanthus Phyllosphere | MTVVSASVPEAVLIPSFEVVEDDLFNVPLLNLGFSGVAGSFKKVIK* |
| Ga0182129_10879502 | 3300015323 | Miscanthus Phyllosphere | VLEALPIPSFEVVDDDLFDVPLPNICFSGVAGNFKKVIK* |
| Ga0182129_11162872 | 3300015323 | Miscanthus Phyllosphere | VTVVSASVLEALPIPSFEVVEDDLFDVPLPNLGFSRVARNFKKVIK* |
| Ga0182109_10918192 | 3300015342 | Miscanthus Phyllosphere | MTVVSASVLEALPIPSFEVAEDDLFDVPLPNPSFSGVAGNFKKVIK* |
| Ga0182109_11720372 | 3300015342 | Miscanthus Phyllosphere | VTVVSASVLEALLIPSFEVVEDDLFDVPLPNLGFSGVAGNFKKVIK* |
| Ga0182155_10376952 | 3300015343 | Miscanthus Phyllosphere | ASTSVPEAIPIPSFEVVKDDLFSISLPDFIFSEVAGDFKKVIK* |
| Ga0182155_11611541 | 3300015343 | Miscanthus Phyllosphere | VTVVSASVLEALPISSFEVVEDDLFDVPLPNLGFSGV |
| Ga0182189_10162442 | 3300015344 | Miscanthus Phyllosphere | VTIASASVPEAIPVPSFEVVEDDLFDVPLPSLGFSGVAGSFKKAIK* |
| Ga0182111_10411962 | 3300015345 | Miscanthus Phyllosphere | VIVVSASVLEAIPIPSFEVVEDDLFNVPLPNLGFSGVAGSFKKVIK* |
| Ga0182111_12321322 | 3300015345 | Miscanthus Phyllosphere | VTVVSASVLEALPIPSFEVVEDDLFDVPLLNLGFSRVAGNFKKVIK* |
| Ga0182139_10709622 | 3300015346 | Miscanthus Phyllosphere | PNVTIASASVPKAIPIPSFEVVEDDLFSVPLPDFIFSEVAGDFKKVIK* |
| Ga0182139_10996761 | 3300015346 | Miscanthus Phyllosphere | VTVVSASIPEVIPIPSFEVVDDDLFNVPLPNLGFSGVAGSFKKVIK* |
| Ga0182177_11337622 | 3300015347 | Miscanthus Phyllosphere | MTVVSASILEVIPIPSFEVVEDDLFNVPLPNLGFSRVAGSFKKVIK* |
| Ga0182161_11376452 | 3300015351 | Miscanthus Phyllosphere | MTVVSASVLEALPIPSLEVVEDDLFDVPLPNLGFSGVAGNFKKVIK* |
| Ga0182161_12517412 | 3300015351 | Miscanthus Phyllosphere | APCAPSVTVVSASVLEALPIPSFEVVEDDLFDVPLPNLGFSGVAGNFKKVIK* |
| Ga0182159_11826501 | 3300015355 | Miscanthus Phyllosphere | VTVASASIPEAILVPSFEVVADDLFGVPLPSLGFLEVAGSFKKAIK* |
| Ga0182145_10977042 | 3300015361 | Miscanthus Phyllosphere | VTVASASVLEAILVPSFEVVEDDLFDVPLPSLGFSGVAGSFKKAIK* |
| Ga0182203_10073213 | 3300017404 | Miscanthus Phyllosphere | VTVVSASVPEAIPIPSFEVVEDDLFNVPLPNLGFSGVAGSFKKVIK |
| Ga0182203_11183921 | 3300017404 | Miscanthus Phyllosphere | VIVASASVPEAIPVPSFEVVANDLFDVPLLSLGFLEVVGSFKKAIN |
| Ga0182220_10525342 | 3300017407 | Miscanthus Phyllosphere | VTFSSASVLEAIPVPSFEVVENDLFNVPLPNLGFSGMAGSFKKVIK |
| Ga0182204_10384621 | 3300017409 | Miscanthus Phyllosphere | VTVVSASVLEAIPIPSFEVVEDDLFNVPLPNLGFSGVAGSFKKVIK |
| Ga0182207_10194833 | 3300017410 | Miscanthus Phyllosphere | RKLAPCAPSVTVVSASVLEAIPIPSFEVVEDDLFNVPLPNLGFSGVAGSFKKVIK |
| Ga0182207_11385441 | 3300017410 | Miscanthus Phyllosphere | VTVASASVPEAIPVPSFEVVADDLFDVPLPSLGFLEVACSFKKAISK |
| Ga0182207_11715422 | 3300017410 | Miscanthus Phyllosphere | FQYSRELAPCASNVTVASASVPEAIPVPSFQVVEDDLFDVPLPSLGFSGVAGSFNKVIK |
| Ga0182208_10332181 | 3300017411 | Miscanthus Phyllosphere | FFQYSHKPAPCAPSVTVVSASVLEAIPIPSFEVVEDDLFNVPLPNLGFSGVAGSFKKVIK |
| Ga0182208_10856771 | 3300017411 | Miscanthus Phyllosphere | SVTVASASVLEAIPVPSFEVVEDDLFDVPLPSLGFSGVASSFNKAIK |
| Ga0182222_10056013 | 3300017413 | Miscanthus Phyllosphere | PNVIVASASVPEAIPVPSFEVVADDLFDVPLPSLGFLEVAGNFKKAIK |
| Ga0182202_10118042 | 3300017415 | Miscanthus Phyllosphere | VIVVSASVPEAVPIPSFEVVEDDLFNVPLPNLGFSGVAGSFKKVIK |
| Ga0182202_10305353 | 3300017415 | Miscanthus Phyllosphere | NCFFHYSRKPAPCAPSVTVVSASVLEALPIPSFEVVEDDLFDVPLPNLGFSGVAGNFKKVIK |
| Ga0182228_10168042 | 3300017420 | Miscanthus Phyllosphere | VIVVSASVPEAIPIPSFEVVEDDLFNVPLPNLGFSRVAGSFKKVIK |
| Ga0182228_10423682 | 3300017420 | Miscanthus Phyllosphere | VIVVSASVLEALPIPSFEVVEDDLFDVPLLNLGFSRVAGNFKKVIK |
| Ga0182219_10241932 | 3300017424 | Miscanthus Phyllosphere | MTVVSTSVPEALPIPSFEVVEDDLFDVPLLNLNFSGVAGNFKKVIK |
| Ga0182219_10550202 | 3300017424 | Miscanthus Phyllosphere | FQYSRKPAPCAPSVIVVFASVPEAIPIPSFEVVEDDLFNVPLPNLGFSGVAGSFKKVIK |
| Ga0182219_10898922 | 3300017424 | Miscanthus Phyllosphere | MTVVSASVLGAIPIPSFEVVEDDLFDVPLPSLGFSGVAGSFKKAIK |
| Ga0182224_11095511 | 3300017425 | Miscanthus Phyllosphere | VTVVSTSILEALPIPSFEVVEDDLFDVPLPNLGFSGVAGNFKKVIK |
| Ga0182190_11124822 | 3300017427 | Miscanthus Phyllosphere | IPVPSFQVVEDDLFDVPLPSLGFSGVAVSFKKAIK |
| Ga0182192_10049122 | 3300017430 | Miscanthus Phyllosphere | MTVVSASVLEAIPIPSFEVVEDDLFNVPLPNLGFSGVAGSFKKVIK |
| Ga0182192_11279961 | 3300017430 | Miscanthus Phyllosphere | VTVASASVLEAILVPSFEVVEDDLFDVPLPSLGFSGVAGSFKKVIK |
| Ga0182192_11457592 | 3300017430 | Miscanthus Phyllosphere | VTVVSASVLEALPIPSFEVVEDDLFDVPLPNLGFSGVAGNFKK |
| Ga0182206_10097932 | 3300017433 | Miscanthus Phyllosphere | MTVVSASVLEALPIPFFEVVEDDLFDVPLPNLGFSGVAGNFKKVIK |
| Ga0182206_10875042 | 3300017433 | Miscanthus Phyllosphere | VTVVSASILEAVPIPSFEVVEDDLFNVPLPNLGFSGVAGSFKKVIK |
| Ga0182209_10562492 | 3300017436 | Miscanthus Phyllosphere | VIVVSASVPEAIPIPSFEVVEDDLFNVPLPNLGFSGVAGSFKKVIK |
| Ga0182209_10805252 | 3300017436 | Miscanthus Phyllosphere | VTVASASVLEAIPVPSFEVVADDLFDVPLPSLGFLEVAGSFKKAIK |
| Ga0182191_10249162 | 3300017438 | Miscanthus Phyllosphere | VIVVSAYVLVALPIPSFEVVEDDLFDVPLPNLGFSGVAGNFKKVIK |
| Ga0182191_10704201 | 3300017438 | Miscanthus Phyllosphere | VTVAFASVPEAIPVPSFEVVEDDLFDVPLPSLGFSGVAGSFKKAIK |
| Ga0182191_10935772 | 3300017438 | Miscanthus Phyllosphere | MNCFFHYSQKPAPCAPSVIVVSASVLEALPIPSFKVVEDDLFDVPLSNLGFSGVAGNFKKVI |
| Ga0182221_10420692 | 3300017442 | Miscanthus Phyllosphere | NCFFQYSRKPAPYAPSVIVVSASVPEAVPMPSFEVVEDDLFNVPLPNLGFSGVVGSFKKVIK |
| Ga0182221_10505631 | 3300017442 | Miscanthus Phyllosphere | PEVIPIPFFEVVEDDLFSMPLPEFIFSEVAGDFKKVIK |
| Ga0182221_10645372 | 3300017442 | Miscanthus Phyllosphere | VTVVSASVPEALPIPSFEVVEDDLFDVPLPNLGFSGVAGNFKKVIK |
| Ga0182221_10969332 | 3300017442 | Miscanthus Phyllosphere | VIVVSASVPEALPIPSFEVVEDDLFDVPLPNLGFSGVAGNFKKVIK |
| Ga0182193_11081462 | 3300017443 | Miscanthus Phyllosphere | QYSHEPAPCAPSVIVVSASVLGAIPIPSFEVVEDDLFDVPLPSLGFSGVAGSFKKAIK |
| Ga0182226_10542651 | 3300017681 | Miscanthus Phyllosphere | VTVVSASVLEALPIPSFEVVEDDLFDVPLSNLGFLGVAGNFKKVIK |
| Ga0182218_10307431 | 3300017683 | Miscanthus Phyllosphere | VTVASASVLEAIPVPSFEVVADDLFDVPLLSLGFLEVAGSFKKAIK |
| Ga0182218_10370762 | 3300017683 | Miscanthus Phyllosphere | VTVVSASVLGAIPIPSFEVVEDDLFDVPLPSLGFSGVAGSFKKAIK |
| Ga0182218_10819332 | 3300017683 | Miscanthus Phyllosphere | VTVVSASVPEAIPIPSFEVVDDDLFNVPLPNLGFSGVAGSFKKAIK |
| Ga0182218_11086611 | 3300017683 | Miscanthus Phyllosphere | MTVVSASVPEAVLIPSFEVVEDDLFNVPLLNLGFLGVAGRFKKVIK |
| Ga0182225_10574101 | 3300017684 | Miscanthus Phyllosphere | MTVVSASVLGAIPIPSFEVVEDDLFDVPLLSLGFLEVVGSFKKAIN |
| Ga0182225_11207461 | 3300017684 | Miscanthus Phyllosphere | VTIASASVLEAIPVPSFEVVEDDLFDVPLLSLGFSRVAGSFKKAIK |
| Ga0182205_10024535 | 3300017686 | Miscanthus Phyllosphere | VTVVSASVLEALPIPSFEVVEDDLFDVPLPNLGFSGVARNFKKVIK |
| Ga0182205_10283861 | 3300017686 | Miscanthus Phyllosphere | VIVASASVPEAIPVPSFEVVADDLFDVPLLSLGFLEVAGSFKKAIK |
| Ga0182205_10353171 | 3300017686 | Miscanthus Phyllosphere | PEAIPIPSFEVVEDDLFSVPLPDFIFSEVAGDFKKVIK |
| Ga0182231_10709942 | 3300017689 | Miscanthus Phyllosphere | VTVVSASVLEALPIPSFEVVEDDLFDVPLSNLGFSGVAGNFKKVIK |
| Ga0182223_10425011 | 3300017690 | Miscanthus Phyllosphere | VPEAIPVPSFEVVANDLFDVPLLSLGFLEVAGNFKKAIK |
| Ga0182223_11226942 | 3300017690 | Miscanthus Phyllosphere | MTVVSAFILGAIPIPSFEVVEDDLFDVPLPSLGFSGVAGSFNKVIK |
| Ga0207642_108992712 | 3300025899 | Miscanthus Rhizosphere | VTVVSASVLEALPIPSFEVVEDDLFDVPLPNLGFSGVAGNFKKVIK |
| Ga0207643_100017907 | 3300025908 | Miscanthus Rhizosphere | VTVVSASVLEALPIPSFEVAEDDLFDVPLPNLGFSGVAGNFKKVIK |
| Ga0207659_115330391 | 3300025926 | Miscanthus Rhizosphere | VTVVSASVLEALPIPSFEVVEDDLFDVPLPNLGFSGVAGRFKKVIK |
| Ga0207709_106652762 | 3300025935 | Miscanthus Rhizosphere | VTVVSGSVLEALPIPSFEVVEDDLFDVPLPNLGFSGVAGNFKKVIK |
| Ga0207704_100677264 | 3300025938 | Miscanthus Rhizosphere | VTVVSASVLEALPIPSFEVVEDDLFDVPLPNHGFSGVAGNFKKVIK |
| Ga0207677_105231392 | 3300026023 | Miscanthus Rhizosphere | MTVVSASVLEALPIPSFEVVEDDLFDVPLLNLGFSGVAGNFKKVIK |
| Ga0207677_107496314 | 3300026023 | Miscanthus Rhizosphere | SVLEALPIPSFEVVEDDLFDVPLLNLGFSGVAGNFKKVIK |
| ⦗Top⦘ |