| Basic Information | |
|---|---|
| Family ID | F056610 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 137 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MKTKKPNIDWSLTTEVVGVALASYGLFLIFPPISFIALGGFLIWATEKE |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 137 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 74.26 % |
| % of genes near scaffold ends (potentially truncated) | 35.77 % |
| % of genes from short scaffolds (< 2000 bps) | 80.29 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (40.876 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (32.847 % of family members) |
| Environment Ontology (ENVO) | Unclassified (64.964 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (69.343 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.65% β-sheet: 0.00% Coil/Unstructured: 49.35% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 137 Family Scaffolds |
|---|---|---|
| PF03354 | TerL_ATPase | 36.50 |
| PF01391 | Collagen | 30.66 |
| PF01844 | HNH | 4.38 |
| PF00575 | S1 | 1.46 |
| PF05065 | Phage_capsid | 0.73 |
| PF04860 | Phage_portal | 0.73 |
| COG ID | Name | Functional Category | % Frequency in 137 Family Scaffolds |
|---|---|---|---|
| COG4626 | Phage terminase-like protein, large subunit, contains N-terminal HTH domain | Mobilome: prophages, transposons [X] | 36.50 |
| COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 0.73 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.35 % |
| Unclassified | root | N/A | 3.65 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001282|B570J14230_10035026 | All Organisms → cellular organisms → Bacteria | 1753 | Open in IMG/M |
| 3300002835|B570J40625_100317236 | All Organisms → cellular organisms → Bacteria | 1567 | Open in IMG/M |
| 3300003277|JGI25908J49247_10056158 | All Organisms → Viruses → Predicted Viral | 1015 | Open in IMG/M |
| 3300003277|JGI25908J49247_10058481 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
| 3300003277|JGI25908J49247_10089484 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300003393|JGI25909J50240_1038094 | All Organisms → Viruses → Predicted Viral | 1030 | Open in IMG/M |
| 3300003413|JGI25922J50271_10000496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 11650 | Open in IMG/M |
| 3300003413|JGI25922J50271_10001167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 7727 | Open in IMG/M |
| 3300003413|JGI25922J50271_10026099 | All Organisms → Viruses → Predicted Viral | 1426 | Open in IMG/M |
| 3300003491|JGI25924J51412_1062202 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 575 | Open in IMG/M |
| 3300003493|JGI25923J51411_1020210 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 1354 | Open in IMG/M |
| 3300005517|Ga0070374_10287240 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300005581|Ga0049081_10021181 | All Organisms → cellular organisms → Bacteria | 2469 | Open in IMG/M |
| 3300005581|Ga0049081_10181827 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300005581|Ga0049081_10285430 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 572 | Open in IMG/M |
| 3300005583|Ga0049085_10036285 | All Organisms → Viruses → Predicted Viral | 1813 | Open in IMG/M |
| 3300005583|Ga0049085_10042690 | All Organisms → Viruses → Predicted Viral | 1651 | Open in IMG/M |
| 3300005662|Ga0078894_10172486 | All Organisms → Viruses → Predicted Viral | 1952 | Open in IMG/M |
| 3300005662|Ga0078894_10376423 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1284 | Open in IMG/M |
| 3300005662|Ga0078894_10524621 | All Organisms → Viruses → Predicted Viral | 1061 | Open in IMG/M |
| 3300005662|Ga0078894_10576958 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300005662|Ga0078894_10680854 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
| 3300005662|Ga0078894_11223261 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 635 | Open in IMG/M |
| 3300005662|Ga0078894_11277567 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300005758|Ga0078117_1014293 | All Organisms → cellular organisms → Bacteria | 2047 | Open in IMG/M |
| 3300005805|Ga0079957_1003747 | All Organisms → cellular organisms → Bacteria | 12834 | Open in IMG/M |
| 3300005805|Ga0079957_1011247 | All Organisms → cellular organisms → Bacteria | 6709 | Open in IMG/M |
| 3300006484|Ga0070744_10027604 | All Organisms → Viruses → Predicted Viral | 1681 | Open in IMG/M |
| 3300006641|Ga0075471_10410402 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300006802|Ga0070749_10392368 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300006805|Ga0075464_10071129 | All Organisms → Viruses → Predicted Viral | 1959 | Open in IMG/M |
| 3300007171|Ga0102977_1004944 | All Organisms → cellular organisms → Bacteria | 1299 | Open in IMG/M |
| 3300007516|Ga0105050_10411681 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 809 | Open in IMG/M |
| 3300007523|Ga0105052_10273339 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1127 | Open in IMG/M |
| 3300007523|Ga0105052_10486930 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 800 | Open in IMG/M |
| 3300007708|Ga0102859_1203126 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 589 | Open in IMG/M |
| 3300007708|Ga0102859_1229205 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 555 | Open in IMG/M |
| 3300007722|Ga0105051_10439539 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
| 3300007862|Ga0105737_1143317 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 618 | Open in IMG/M |
| 3300008107|Ga0114340_1204169 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 659 | Open in IMG/M |
| 3300008110|Ga0114343_1093345 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 1056 | Open in IMG/M |
| 3300008116|Ga0114350_1015713 | All Organisms → Viruses → Predicted Viral | 3244 | Open in IMG/M |
| 3300008117|Ga0114351_1063123 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2268 | Open in IMG/M |
| 3300008266|Ga0114363_1123296 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 897 | Open in IMG/M |
| 3300008266|Ga0114363_1197365 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 621 | Open in IMG/M |
| 3300008448|Ga0114876_1065978 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 1561 | Open in IMG/M |
| 3300009009|Ga0105105_10190117 | All Organisms → Viruses → Predicted Viral | 1058 | Open in IMG/M |
| 3300009026|Ga0102829_1270273 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 562 | Open in IMG/M |
| 3300009039|Ga0105152_10346897 | Not Available | 621 | Open in IMG/M |
| 3300009082|Ga0105099_10769939 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 601 | Open in IMG/M |
| 3300009160|Ga0114981_10232699 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1006 | Open in IMG/M |
| 3300009170|Ga0105096_10354440 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300009184|Ga0114976_10583945 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 568 | Open in IMG/M |
| 3300010354|Ga0129333_10101049 | All Organisms → Viruses → Predicted Viral | 2665 | Open in IMG/M |
| 3300010354|Ga0129333_10310893 | All Organisms → Viruses → Predicted Viral | 1409 | Open in IMG/M |
| 3300010354|Ga0129333_11419266 | Not Available | 571 | Open in IMG/M |
| 3300010354|Ga0129333_11523884 | Not Available | 547 | Open in IMG/M |
| 3300010354|Ga0129333_11732442 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
| 3300010370|Ga0129336_10108935 | All Organisms → Viruses → Predicted Viral | 1619 | Open in IMG/M |
| 3300012017|Ga0153801_1018594 | All Organisms → cellular organisms → Bacteria | 1238 | Open in IMG/M |
| 3300012471|Ga0129334_1115881 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 632 | Open in IMG/M |
| 3300012666|Ga0157498_1019411 | All Organisms → Viruses → Predicted Viral | 1060 | Open in IMG/M |
| 3300012962|Ga0129335_1103111 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 993 | Open in IMG/M |
| 3300012970|Ga0129338_1264934 | All Organisms → Viruses → Predicted Viral | 3094 | Open in IMG/M |
| 3300013004|Ga0164293_10557210 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300013005|Ga0164292_10297915 | All Organisms → cellular organisms → Bacteria | 1104 | Open in IMG/M |
| 3300013372|Ga0177922_11098986 | All Organisms → cellular organisms → Bacteria | 6774 | Open in IMG/M |
| 3300014811|Ga0119960_1016612 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 874 | Open in IMG/M |
| 3300017722|Ga0181347_1051823 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1238 | Open in IMG/M |
| 3300017736|Ga0181365_1019845 | All Organisms → cellular organisms → Bacteria | 1693 | Open in IMG/M |
| 3300017736|Ga0181365_1135693 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 587 | Open in IMG/M |
| 3300017747|Ga0181352_1161279 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 589 | Open in IMG/M |
| 3300017761|Ga0181356_1234305 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
| 3300017766|Ga0181343_1050986 | All Organisms → Viruses → Predicted Viral | 1218 | Open in IMG/M |
| 3300017777|Ga0181357_1214891 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 681 | Open in IMG/M |
| 3300017780|Ga0181346_1238791 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 640 | Open in IMG/M |
| 3300017780|Ga0181346_1279861 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 572 | Open in IMG/M |
| 3300017784|Ga0181348_1133782 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 942 | Open in IMG/M |
| 3300019784|Ga0181359_1031276 | All Organisms → cellular organisms → Bacteria | 2056 | Open in IMG/M |
| 3300019784|Ga0181359_1084432 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 1185 | Open in IMG/M |
| 3300019784|Ga0181359_1086212 | All Organisms → Viruses → Predicted Viral | 1169 | Open in IMG/M |
| 3300019784|Ga0181359_1235071 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 567 | Open in IMG/M |
| 3300020048|Ga0207193_1045523 | All Organisms → Viruses → Predicted Viral | 4705 | Open in IMG/M |
| 3300020159|Ga0211734_10532367 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300020159|Ga0211734_10753571 | All Organisms → cellular organisms → Bacteria | 3849 | Open in IMG/M |
| 3300020160|Ga0211733_10693723 | All Organisms → cellular organisms → Bacteria | 1602 | Open in IMG/M |
| 3300020161|Ga0211726_11001570 | All Organisms → Viruses → Predicted Viral | 2529 | Open in IMG/M |
| 3300020162|Ga0211735_10774237 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300020162|Ga0211735_11492420 | All Organisms → Viruses → Predicted Viral | 2900 | Open in IMG/M |
| 3300020172|Ga0211729_10580552 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1799 | Open in IMG/M |
| 3300020172|Ga0211729_10974530 | All Organisms → Viruses → Predicted Viral | 1561 | Open in IMG/M |
| 3300020494|Ga0208326_102619 | All Organisms → Viruses → Predicted Viral | 1638 | Open in IMG/M |
| 3300020498|Ga0208050_1002999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2202 | Open in IMG/M |
| 3300020570|Ga0208465_1007928 | All Organisms → cellular organisms → Bacteria | 1547 | Open in IMG/M |
| 3300021140|Ga0214168_1022647 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 1721 | Open in IMG/M |
| 3300021961|Ga0222714_10055317 | All Organisms → cellular organisms → Bacteria | 2720 | Open in IMG/M |
| 3300022407|Ga0181351_1108477 | All Organisms → cellular organisms → Bacteria | 1061 | Open in IMG/M |
| 3300022407|Ga0181351_1135863 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 903 | Open in IMG/M |
| 3300024343|Ga0244777_10357879 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 914 | Open in IMG/M |
| 3300025585|Ga0208546_1111363 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 607 | Open in IMG/M |
| 3300027563|Ga0209552_1136482 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 638 | Open in IMG/M |
| 3300027608|Ga0208974_1159951 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 566 | Open in IMG/M |
| 3300027627|Ga0208942_1052156 | All Organisms → Viruses → Predicted Viral | 1250 | Open in IMG/M |
| 3300027644|Ga0209356_1006861 | All Organisms → Viruses → Predicted Viral | 4138 | Open in IMG/M |
| 3300027644|Ga0209356_1216473 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
| 3300027656|Ga0209357_1203344 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
| 3300027659|Ga0208975_1090027 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300027769|Ga0209770_10000238 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 32847 | Open in IMG/M |
| 3300027769|Ga0209770_10159952 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300027769|Ga0209770_10258265 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 673 | Open in IMG/M |
| 3300027772|Ga0209768_10027889 | All Organisms → Viruses → Predicted Viral | 3107 | Open in IMG/M |
| 3300027804|Ga0209358_10079110 | All Organisms → Viruses → Predicted Viral | 1869 | Open in IMG/M |
| 3300027805|Ga0209229_10025190 | All Organisms → Viruses → Predicted Viral | 2587 | Open in IMG/M |
| 3300027805|Ga0209229_10069076 | All Organisms → cellular organisms → Bacteria | 1584 | Open in IMG/M |
| 3300027805|Ga0209229_10180428 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 947 | Open in IMG/M |
| 3300027808|Ga0209354_10246317 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300027808|Ga0209354_10413004 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 523 | Open in IMG/M |
| 3300027892|Ga0209550_10391274 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 863 | Open in IMG/M |
| 3300027976|Ga0209702_10358069 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 583 | Open in IMG/M |
| 3300031758|Ga0315907_10054584 | All Organisms → cellular organisms → Bacteria | 3502 | Open in IMG/M |
| 3300031758|Ga0315907_10152275 | All Organisms → Viruses → Predicted Viral | 1958 | Open in IMG/M |
| 3300031758|Ga0315907_10680356 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 786 | Open in IMG/M |
| 3300032462|Ga0335396_10117365 | All Organisms → cellular organisms → Bacteria | 1754 | Open in IMG/M |
| 3300033233|Ga0334722_10466597 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 908 | Open in IMG/M |
| 3300033233|Ga0334722_11119204 | Not Available | 553 | Open in IMG/M |
| 3300033521|Ga0316616_102774264 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 660 | Open in IMG/M |
| 3300033981|Ga0334982_0020640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3843 | Open in IMG/M |
| 3300034066|Ga0335019_0676408 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 595 | Open in IMG/M |
| 3300034066|Ga0335019_0736591 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 562 | Open in IMG/M |
| 3300034068|Ga0334990_0511088 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 639 | Open in IMG/M |
| 3300034071|Ga0335028_0030490 | All Organisms → Viruses → Predicted Viral | 3724 | Open in IMG/M |
| 3300034101|Ga0335027_0773045 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 560 | Open in IMG/M |
| 3300034106|Ga0335036_0016284 | All Organisms → cellular organisms → Bacteria | 6039 | Open in IMG/M |
| 3300034109|Ga0335051_0459419 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 597 | Open in IMG/M |
| 3300034116|Ga0335068_0096292 | All Organisms → cellular organisms → Bacteria | 1664 | Open in IMG/M |
| 3300034272|Ga0335049_0241155 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1249 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 32.85% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 8.76% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.30% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 5.84% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 5.11% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 4.38% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 4.38% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 4.38% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 4.38% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.92% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.19% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 2.19% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.19% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.46% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.46% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.46% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.73% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.73% |
| Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water | 0.73% |
| Freshwater, Surface Ice | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice | 0.73% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.73% |
| Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment | 0.73% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 0.73% |
| Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 0.73% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.73% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.73% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.73% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.73% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
| 3300003413 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD | Environmental | Open in IMG/M |
| 3300003491 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003493 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005758 | Cyanobacteria communities in tropical freswater systems - freshwater lake in Singapore | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007171 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface layer) 8 sequencing projects | Environmental | Open in IMG/M |
| 3300007516 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 | Environmental | Open in IMG/M |
| 3300007523 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-03 | Environmental | Open in IMG/M |
| 3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
| 3300007722 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (megahit assembly) | Environmental | Open in IMG/M |
| 3300007862 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_0.2um | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009039 | Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cm | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012471 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012666 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2 | Environmental | Open in IMG/M |
| 3300012962 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012970 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020494 | Freshwater microbial communities from Lake Mendota, WI - 25SEP2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020570 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021140 | Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnion | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300025585 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027627 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027656 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027976 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes) | Environmental | Open in IMG/M |
| 3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300032462 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (spades assembly) | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034068 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031 | Environmental | Open in IMG/M |
| 3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034109 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME26Aug2009-rr0158 | Environmental | Open in IMG/M |
| 3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
| 3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J14230_100350263 | 3300001282 | Freshwater | MKKLKIDWSVITEVTGVGLATYGLFLIFPPVSFIALGLFLVYITEKE* |
| B570J40625_1003172362 | 3300002835 | Freshwater | MKLKKPKIDWSLTTEVAGVALASYGLFLIFPPISFIALGGFLIWATEKE* |
| JGI25908J49247_100561581 | 3300003277 | Freshwater Lake | MKAKKPNIDWSLTTEVVGVALASYGLFLIFPPISFIALGGFLIWATEKE* |
| JGI25908J49247_100584811 | 3300003277 | Freshwater Lake | MKAKKPEIDWSLTTEVIGVSLASYGLFLIFPPISFIALGGFLIWVTEKE* |
| JGI25908J49247_100894842 | 3300003277 | Freshwater Lake | MKTKKPNIDWSLTTEVVGVALASYGLFLIFPPISFIALGGFLIWATEKE* |
| JGI25909J50240_10380941 | 3300003393 | Freshwater Lake | MKAKKPNIDWSLTTEVVGVALASYGLFLIFPPISFIALGGFLIWA |
| JGI25922J50271_100004962 | 3300003413 | Freshwater Lake | MKLKKPNIDWSLTTEIVGVSLTTYGLFLIFPPISFIALGGFLIWVTEKE* |
| JGI25922J50271_100011676 | 3300003413 | Freshwater Lake | MKKLKIDWPVITEVTGVGLTTYGLFLIFPPVSFIALGLFLVYITEKE* |
| JGI25922J50271_100260994 | 3300003413 | Freshwater Lake | MKTKKPNIDWSLTTEVIGVGLAAYGLFLIFPPVSFIALGGFLIWATEKE* |
| JGI25924J51412_10622021 | 3300003491 | Freshwater Lake | DCSKISFNIRRNMKAKKPNIDWSLTTEVVGVALASYGLFLIFPPISFIALGGFLIWATEKE* |
| JGI25923J51411_10202101 | 3300003493 | Freshwater Lake | MKAKKPEIDWSLTTEVIGVSLASYGLFLIFPPISFIALGGF |
| Ga0070374_102872403 | 3300005517 | Freshwater Lake | DWSLTTEVIGVSLASYGLFLIFPPISFIALGGFLIWVTEKE* |
| Ga0049081_100211813 | 3300005581 | Freshwater Lentic | MKAKKPNIDWSLTTEVVGVALASYGLFLIFPPISFIALGGFLIWVTEKE* |
| Ga0049081_101818271 | 3300005581 | Freshwater Lentic | PNIDWSLTTEVVGVALASYGLFLIFPPVSFIALGGFLIWATEKE* |
| Ga0049081_102854303 | 3300005581 | Freshwater Lentic | KPKIDWSLTTEVIGVSLASYGLFLIFPPISFIALGSFLIWITEKN* |
| Ga0049085_100362853 | 3300005583 | Freshwater Lentic | MKIKWPKINWSITTEVIGISLTSYGLFLILPAMSFIALGGFLIWITEKE* |
| Ga0049085_100426903 | 3300005583 | Freshwater Lentic | MKLKKKDIDWSLSTEVIGVSLAAYGLFLIFPPISFIALGAFLVYITEKE* |
| Ga0078894_101724863 | 3300005662 | Freshwater Lake | MKIKWPNIDWSTTTEVLGVSLATYGLFLIFPPISFIALGGFLIWVTEKE* |
| Ga0078894_103764232 | 3300005662 | Freshwater Lake | MKTKKPNIDWSLTTEVVGVALAAYGLFLIFPPVSFIALGGFLIWATEKE* |
| Ga0078894_105246213 | 3300005662 | Freshwater Lake | IDWSLTTEVVGVALASYGLFLIFPPISFIALGGFLIWATEKE* |
| Ga0078894_105769582 | 3300005662 | Freshwater Lake | MKIKWPNIDWSTTTEVIGVSLASYGLFLIFPPISFIALGGFLIWVTEKE* |
| Ga0078894_106808543 | 3300005662 | Freshwater Lake | MKKLKIDWPVVTEVTGVSLTTYGLFLIFPPVSFIALGLFLVYITEKE* |
| Ga0078894_112232613 | 3300005662 | Freshwater Lake | MKTKKPNIDWSLTTEVIGVALASYGLFLIFPPISFIALGGFLIWATEKE* |
| Ga0078894_112775673 | 3300005662 | Freshwater Lake | VITEVTGVGLTTYGLFLIFPPVSFIALGLFLVYITEKE* |
| Ga0078117_10142933 | 3300005758 | Lake Water | MKKPKIDWSLLTEIAGVGLATYGLYLISMPIAFIALGTFLVYITEKE* |
| Ga0079957_100374710 | 3300005805 | Lake | MKKLKIDWPLITEIAGIGLATYGIYLISMPVAFIALGTFLIYTVEKE* |
| Ga0079957_10112474 | 3300005805 | Lake | MKKLKIDWPVITEIAGVGLATYGLYLISMPIAFIALGAFLVYINEKE* |
| Ga0070744_100276042 | 3300006484 | Estuarine | MKTKKPEIDWSLTTEVVGVALASYGLFLIFPPISFIALGGFLIWATEKE* |
| Ga0075471_104104022 | 3300006641 | Aqueous | MKTKKPNIDWSLTTEVVGVALASYGLFLIFPPVSFIALGGFLIWATEKE* |
| Ga0070749_103923682 | 3300006802 | Aqueous | MKTKKPTIDWSLTTEVVGVALASYGLFLIFPPISFIALGGFLIWATEKE* |
| Ga0075464_100711291 | 3300006805 | Aqueous | KILFTIRRNMKAKKPEIDWSLTTEVIGVSLASYGLFLIFPPISFIALGGFLIWVTEKE* |
| Ga0102977_10049443 | 3300007171 | Freshwater Lake | MKKPKIDWSLLTEIAGVGLATYGLYLISMPIAFIALGSFLIYINEKE* |
| Ga0105050_104116812 | 3300007516 | Freshwater | MKKFKTPTIDWPLTTEVVGIGLVTYGVFLIFPPASFIALGGFLIWVTEKE* |
| Ga0105052_102733392 | 3300007523 | Freshwater | MKKFKKPTIDWSLTTEVIGVGLVTYGVFLLFPPLSFIALGSFLVWAAEKE* |
| Ga0105052_104869302 | 3300007523 | Freshwater | MKKFKRLTIDWPLTTEVVGIGLVTYGVFLIFPPASFIALGGFLIWVTEKE* |
| Ga0102859_12031261 | 3300007708 | Estuarine | RRNMKTKKPNIDWSLTTEVVGVALASYGLFLIFPPVSFIALGGFLIWATEKE* |
| Ga0102859_12292051 | 3300007708 | Estuarine | RNMKTKKPNIDWSLTTEVVGVALASYGLFLIFPPVSFIALGGFLIWATEKE* |
| Ga0105051_104395392 | 3300007722 | Freshwater | MKRFKTPKIDWPLTTEVVGIGLVTYGVFLIFPPASFIALGGFLIWVTEK* |
| Ga0105737_11433172 | 3300007862 | Estuary Water | MKTKKPNIDWSLTTEVVGVALAAYGSFLIFPPVSFIALGGFLIWATEKE* |
| Ga0114340_12041692 | 3300008107 | Freshwater, Plankton | MKLKKPNIDWSLTTEVTGVALASYGLFLIFPPISFIALGGFLIWVTEKE* |
| Ga0114343_10933452 | 3300008110 | Freshwater, Plankton | MKIKWPKIDWSLTTEITGVALAAYGLFMIFPPISFTALGGFLIWATERQ* |
| Ga0114350_10157132 | 3300008116 | Freshwater, Plankton | MKIKRPKINWPIVTEIIGVSLASYGLFLILPAIAFIALGSFLVYITEKE* |
| Ga0114351_10631232 | 3300008117 | Freshwater, Plankton | MKKLKIDWPVITEVTGVGLATYGLFLIFPPVSFIALGLFLVYITEKE* |
| Ga0114363_11232963 | 3300008266 | Freshwater, Plankton | MKKLKIDWPVITEITGVGLTAYGLFLIFPPVSFIALGLFLVYITEKE* |
| Ga0114363_11973652 | 3300008266 | Freshwater, Plankton | MKKLRIDWSLLTEIAGVGLATYGLYLISMPIAFIALGTFLVYITEKE* |
| Ga0114876_10659782 | 3300008448 | Freshwater Lake | MKIKWPKIDWSLTTEITGVALAAYGLFLIFPPISFIALGGFLIWATERQ* |
| Ga0105105_101901171 | 3300009009 | Freshwater Sediment | RRNMKIKWPKIDWSLITEITGVALAAYGLFLIFPPISFIALGGFLIWATEKE* |
| Ga0102829_12702732 | 3300009026 | Estuarine | MKSKLPKADWSLTTEIVGVSLTTYGLFLIFPPIAFIALGSFLVYVTEKE* |
| Ga0105152_103468972 | 3300009039 | Lake Sediment | MKAKKLKLDWPLTTEVIGVSLASYGLFLIFPPISFIALGGFLIWVTEKE* |
| Ga0105099_107699392 | 3300009082 | Freshwater Sediment | MKIKWPKIDWSLTTEVVGVALAAYGLFLIFPPISFIALGGFLIWATEKE* |
| Ga0114981_102326991 | 3300009160 | Freshwater Lake | TTEVIGVSLASYGLFLIFPPISFIALGGFLIWVTEKE* |
| Ga0105096_103544401 | 3300009170 | Freshwater Sediment | IRRNMKTKKPNIDWSLTTEVVGVALASYGLFLIFPPISFIALGGFLIWATEKE* |
| Ga0114976_105839453 | 3300009184 | Freshwater Lake | EIDWSLTTEVIGVSLASYGLFLIFPPISFIALGGFLIWVTEKE* |
| Ga0129333_101010494 | 3300010354 | Freshwater To Marine Saline Gradient | TEIAGVGLATYGLYLISVPLAFIALGAFLVYINEKE* |
| Ga0129333_103108933 | 3300010354 | Freshwater To Marine Saline Gradient | MKKLKIDWPVITEVTGVGLTTYGLFMIFPPVSFIALGLFLVYITEKE* |
| Ga0129333_114192661 | 3300010354 | Freshwater To Marine Saline Gradient | MKKLKIDWPVITEVTGVGLVTYGLFLIFPPVSFIALGLFLVYITEKE* |
| Ga0129333_115238843 | 3300010354 | Freshwater To Marine Saline Gradient | TEVTGVGLTTYGLFLIFPPVSFIALGLFLVYITEKE* |
| Ga0129333_117324422 | 3300010354 | Freshwater To Marine Saline Gradient | WSLLTEIAGVGLATYGLYLISMPIAFIALGTFLVYITEKE* |
| Ga0129336_101089351 | 3300010370 | Freshwater To Marine Saline Gradient | KNTLRIRRIMKKLRIDWSLLTEIAGVGLATYGLYLISMPIAFIALGTFLVYITEKE* |
| Ga0153801_10185942 | 3300012017 | Freshwater | MKLKKPKIDWSLTTEVIGVSLASYGLFLIFPPISFIALGSFLIWITEKN* |
| Ga0129334_11158812 | 3300012471 | Aqueous | MKIKWPKIDWSIVVEVVGVALATYGLYMIAPAISFIALGSFLIWATERK* |
| Ga0157498_10194113 | 3300012666 | Freshwater, Surface Ice | TKKPNIDWSLTTEVVGVALASYGLFLIFPPVSFIALGGFLIWATEKE* |
| Ga0129335_11031113 | 3300012962 | Aqueous | MKIKWPKIDWSIVVEVVGVALPTYGLYMIAPAISFIALGSFLIWATERK* |
| Ga0129338_12649344 | 3300012970 | Aqueous | MKKLRIDWSLLTEIAGVGLATYGLYLISVPLAFIALGAFLVYINEKE* |
| Ga0164293_105572101 | 3300013004 | Freshwater | SKACSKILFTIRRNMKTKKPNIDWSLTTEVVGVALASYGLFLIFPPVSFIALGGFLIWATEKE* |
| Ga0164292_102979153 | 3300013005 | Freshwater | LTTEVVGVALASYGLFLIFPPVSFIALGGFLIWATEKE* |
| Ga0177922_110989867 | 3300013372 | Freshwater | MKIKKPNIDWSLTTEVVGVALASYGLFLIFPPVSFIALGGFLIWATEKE* |
| Ga0119960_10166121 | 3300014811 | Aquatic | MKTKKPNIDWSLTTEVIGVVLASYGLFLIFPPISFIALGGFLIWATEKE* |
| Ga0181347_10518232 | 3300017722 | Freshwater Lake | MKAKKPEIDWPLTTEVIGVSLASYGLFLIFPPISFIALGGFLIWVTEKE |
| Ga0181365_10198453 | 3300017736 | Freshwater Lake | MKAKKLKIDWPLTTEVIGVSLASYGLFLIFPPISFIALGGFLIWATEKE |
| Ga0181365_11356932 | 3300017736 | Freshwater Lake | FNIRRNMKAKKPNIDWSLTTEVVGVALASYGLFLIFPPISFIALGGFLIWATEKE |
| Ga0181352_11612791 | 3300017747 | Freshwater Lake | IMKKLKIDWPVITEVTGVGLTTYGLFLIFPPVSFIALGLFLVYITEKE |
| Ga0181356_12343052 | 3300017761 | Freshwater Lake | KPNIDWSLTTEVVGVALASYGLFLIFPPISFIALGGFLIWATEKE |
| Ga0181343_10509861 | 3300017766 | Freshwater Lake | IRRNMKTKKPNIDWSLTTEVVGVALASYGLFLIFPPISFIALGGFLIWATEKE |
| Ga0181357_12148912 | 3300017777 | Freshwater Lake | MKAKKPNIDWSLTTEVVGVALASYGLFLIFPPISFIAL |
| Ga0181346_12387912 | 3300017780 | Freshwater Lake | MMKLKKKDIDWSLSTEVIGVSLASYGLFLIFPPISFIALGGFLIWVTEKE |
| Ga0181346_12798612 | 3300017780 | Freshwater Lake | MKAKKPNIDWSLTTEVVGVALASYGLFLIFPPISFIALGGFLIWATE |
| Ga0181348_11337821 | 3300017784 | Freshwater Lake | MKTKKPNIDWSLTTEVVGVALASYGLFLIFPPISFIALGGF |
| Ga0181359_10312762 | 3300019784 | Freshwater Lake | MKAKKPEIDWSLTTEVIGVSLASYGLFLIFPPISFIALGGFLIWVTEKE |
| Ga0181359_10844322 | 3300019784 | Freshwater Lake | MKTKKPNIDWSLTTEVVGVALASYGLFLIFPPISFIALGGFLIWATEKE |
| Ga0181359_10862121 | 3300019784 | Freshwater Lake | MKAKKPNIDWSLTTEVVGVALASYGLFLIFPPISFIALGGFLIWATEKE |
| Ga0181359_12350712 | 3300019784 | Freshwater Lake | MKKLKIDWPVITEVTGVGLTTYGLFLIFPPVSFIALGLFLVYITEKE |
| Ga0207193_10455234 | 3300020048 | Freshwater Lake Sediment | MKLKKPKVDWSLTTEVVGVALASYGLFLIFPPISFIALGGFLIWATEKE |
| Ga0211734_105323672 | 3300020159 | Freshwater | MMKTKKPNIDWSLTTEIAGVALASYGLFLIFPPISFIALGGFLIWATEKE |
| Ga0211734_107535714 | 3300020159 | Freshwater | MKIKKPDMDWSLTTEVLGVGLASYGLFLIFPPISFIALGAFLIWVTEKE |
| Ga0211733_106937232 | 3300020160 | Freshwater | MKAKKPEIDWSLTTEIVGVALASYGLFLIFPPISFIALGGFLIWATEKE |
| Ga0211726_110015703 | 3300020161 | Freshwater | MKTKKPEIDWSLTTEVVGVALASYGLFLIFPPISFIALGGFLIWATEKE |
| Ga0211735_107742373 | 3300020162 | Freshwater | DWPVVTEVTGVSLTTYGLFLIFPPVSFIALGLFLVYITEKE |
| Ga0211735_114924202 | 3300020162 | Freshwater | MKAKKPEIDWSLTTEVVGVALASYGLFLIFPPISFIALGGFLIWATEKE |
| Ga0211729_105805522 | 3300020172 | Freshwater | MKFKLPKVDLSLLTEIVGVSLATYGLFLIFPPISFIALGAFLIYITEKE |
| Ga0211729_109745303 | 3300020172 | Freshwater | MKTKKPNIDWSLTTEVVGVALASYGLFLIFPPISFIALGGFLIWVTEKE |
| Ga0208326_1026192 | 3300020494 | Freshwater | MKKLKIDWSVITEVTGVGLATYGLFLIFPPVSFIALGLFLVYITEKE |
| Ga0208050_10029993 | 3300020498 | Freshwater | MKLKKPKIDWSLTTEVAGVALASYGLFLIFPPISFIALGGFLIWATEKE |
| Ga0208465_10079282 | 3300020570 | Freshwater | MKIKWPKIDWSLTTEVIGVGLATYGLFLIFPPISFIALGGFLIWATEKE |
| Ga0214168_10226471 | 3300021140 | Freshwater | MKLKKPKIDWSLTTEVAGVALASYGLFLIFPPISFIALGG |
| Ga0222714_100553173 | 3300021961 | Estuarine Water | MKKLKIDWPVVTEITGVGLTTYGLFLIFPPVSFIALGLFLVYITEKE |
| Ga0181351_11084772 | 3300022407 | Freshwater Lake | MKLKKKDIDWSLSTEVIGVSLASYGLFLIFPPISFIALGGFLIWVTEKE |
| Ga0181351_11358632 | 3300022407 | Freshwater Lake | MKTKKPNIDWSLTTEVVGVALASYGLFLIFPPISFIALGGFLIWATE |
| Ga0244777_103578791 | 3300024343 | Estuarine | MKTKKPNIDWSLTTEVVGVALASYGLFLIFPPVSFIALGGFLIWATEKE |
| Ga0208546_11113632 | 3300025585 | Aqueous | MKKLKIDWPVITEVTGVGLTTYGLFLIFPPVSFIA |
| Ga0209552_11364821 | 3300027563 | Freshwater Lake | MKKLKIDWPVITEVTGVGLTTYGLFLIFPPVSFIALGLFLVY |
| Ga0208974_11599511 | 3300027608 | Freshwater Lentic | MKTKKPNIDWSLTTEVVGVALASYGLFLIFPPISFIAL |
| Ga0208942_10521561 | 3300027627 | Freshwater Lentic | MKLKKKDIDWSLSTEVIGVSLAAYGLFLIFPPISFIALGAFLVYITEKE |
| Ga0209356_10068614 | 3300027644 | Freshwater Lake | DWSLTTEVIGVSLASYGLFLIFPPISFIALGGFLIWVTEKE |
| Ga0209356_12164731 | 3300027644 | Freshwater Lake | MKAKKLKIDWPLTTEVIGVSLASYGLFLIFPPISFIALGGFLIWVTEKE |
| Ga0209357_12033442 | 3300027656 | Freshwater Lake | EVIGVSLASYGLFLIFPPISFIALGGFLIWVTEKE |
| Ga0208975_10900271 | 3300027659 | Freshwater Lentic | KKPKIDWSLTTEVIGVSLASYGLFLIFPPISFIALGSFLIWITEKN |
| Ga0209770_1000023848 | 3300027769 | Freshwater Lake | MKLKKPNIDWSLTTEIVGVSLTTYGLFLIFPPISFIALGGFLIWVTEKE |
| Ga0209770_101599521 | 3300027769 | Freshwater Lake | TKKPNIDWSLTTEVVGVALASYGLFLIFPPISFIALGGFLIWATEKE |
| Ga0209770_102582652 | 3300027769 | Freshwater Lake | MKTKKPNIDWSLTTEVIGVGLAAYGLFLIFPPVSFIALGGFLIWATEKE |
| Ga0209768_100278893 | 3300027772 | Freshwater Lake | DWSLSTEVIGVSLASYGLFLIFPPISFIALGGFLIWVTEKE |
| Ga0209358_100791103 | 3300027804 | Freshwater Lake | MKKLKIDWPVVTEVTGVSLTTYGLFLIFPPVSFIALGLFLVYITEKE |
| Ga0209229_100251903 | 3300027805 | Freshwater And Sediment | MKKLKIDWPVITEITGVGLTAYGLFLIFPPVSFIALGLFLVYITEKE |
| Ga0209229_100690762 | 3300027805 | Freshwater And Sediment | MKIKWPKIDWSLITEITGVALSAYGLFLIFPPISFIALGGFLIWATERQ |
| Ga0209229_101804281 | 3300027805 | Freshwater And Sediment | MKKLKIDWPLVTEVTGVGLTTYGLFLIFPPVSFIALGLFLVYITEKE |
| Ga0209354_102463173 | 3300027808 | Freshwater Lake | DWPLTTEVIGVSLASYGLFLIFPPISFIALGGFLIWVTEKE |
| Ga0209354_104130041 | 3300027808 | Freshwater Lake | MKIKWPKINWSITTEVIGISLTSYGLFLILPAMSFIALGGFLIW |
| Ga0209550_103912741 | 3300027892 | Freshwater Lake | MKKLKIDWPVITEVTGVSLTTYGLFLIFPPVSFIALGLFLVYITEKE |
| Ga0209702_103580692 | 3300027976 | Freshwater | MKKFKTPTIDWPLTTEVVGIGLVTYGVFLIFPPASFIALGGFLIWVTEKE |
| Ga0119944_10003614 | 3300029930 | Aquatic | MKKLKIDWPVITEIAGVGLATYGLYLISMPIAFIALGVFLVYITEKE |
| Ga0315907_100545844 | 3300031758 | Freshwater | MKKPKIDWSLLTEIAGVGLATYGLYLISMPIAFIALGTFLVYITEKE |
| Ga0315907_101522753 | 3300031758 | Freshwater | MKIKRPKINWPIVTEIIGVSLASYGLFLILPAIAFIALGSFLVYITEKE |
| Ga0315907_106803562 | 3300031758 | Freshwater | MKKFKIDWSLLTEIAGVGLATYGLFLISMPLAFIALGTFLVYINEKE |
| Ga0335396_101173653 | 3300032462 | Freshwater | MKKFKRLTIDWPLTTEVVGIGLVTYGVFLIFPPASFIALGGFLIWVTEK |
| Ga0334722_104665973 | 3300033233 | Sediment | MKIKKPKIDWTLLTEVVGVSLTTYGLFLIFPPMSFIALGAFLVYVTEKE |
| Ga0334722_111192042 | 3300033233 | Sediment | IKKPPKPEIDWSLTTEVIGVSLASYGLFLIFPPISFIALGGFLIWVTEKE |
| Ga0316616_1027742642 | 3300033521 | Soil | MKKLKIDWPVITEVTGVGLATYGLFLIFPPVSFIALGLFLVYITEKE |
| Ga0334982_0020640_2946_3095 | 3300033981 | Freshwater | MKIKKPKIDWTLLTEIVGVSLTTYGLFLIFPPMSFIALGAFLVYVTEKE |
| Ga0335019_0676408_481_594 | 3300034066 | Freshwater | VTEVTGVGLTTYGLFLIFPPVSFIALGLFLVYITEKE |
| Ga0335019_0736591_62_211 | 3300034066 | Freshwater | MKIKKPNIDWSLTTEVTGVALAAYGLFLIFPPISFIALGGFLIWATEKE |
| Ga0334990_0511088_514_639 | 3300034068 | Freshwater | MKKLKIDWSVITEVTGVGLATYGLFLIFPPVSFIALGLFLVY |
| Ga0335028_0030490_440_589 | 3300034071 | Freshwater | MKLKKPIIDWSLTTEIVGVSLATYGLFLIFPPISFIALGAFLVYISEKE |
| Ga0335027_0773045_419_559 | 3300034101 | Freshwater | KKPNIDWSLTTEVVGVALASYGLFLIFPPMSFIALGGFLIWATEKE |
| Ga0335036_0016284_4959_5108 | 3300034106 | Freshwater | MKTKKPNIDWSLTTEVVGVGLAAYGLFLIFPPISFIALGGFLIWATERQ |
| Ga0335051_0459419_2_112 | 3300034109 | Freshwater | MKTKKPNIDWSLTTEVVGVALASYGLFLICPPISFIA |
| Ga0335068_0096292_343_492 | 3300034116 | Freshwater | MKLKKPKVDWSLTTEIAGVALASYGLFLIFPPISFIALGGFLIWATEKE |
| Ga0335049_0241155_1_123 | 3300034272 | Freshwater | WSLTTEVVGVALASYGLFLIFPPVSFIALGGFLIWATEKE |
| ⦗Top⦘ |