NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F056575

Metagenome / Metatranscriptome Family F056575

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F056575
Family Type Metagenome / Metatranscriptome
Number of Sequences 137
Average Sequence Length 53 residues
Representative Sequence DGPLGNGTKAKVQFETYSNGAGVRLLNVGVTEHVAYEPENKISEDDELFMVG
Number of Associated Samples 115
Number of Associated Scaffolds 137

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 96.35 %
% of genes from short scaffolds (< 2000 bps) 91.24 %
Associated GOLD sequencing projects 97
AlphaFold2 3D model prediction Yes
3D model pTM-score0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (51.825 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(29.927 % of family members)
Environment Ontology (ENVO) Unclassified
(70.073 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(85.401 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 6.25%    β-sheet: 27.50%    Coil/Unstructured: 66.25%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.43
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 137 Family Scaffolds
PF027395_3_exonuc_N 44.53
PF05367Phage_endo_I 11.68
PF00476DNA_pol_A 0.73
PF06568DUF1127 0.73

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 137 Family Scaffolds
COG02585'-3' exonuclease Xni/ExoIX (flap endonuclease)Replication, recombination and repair [L] 44.53
COG0749DNA polymerase I, 3'-5' exonuclease and polymerase domainsReplication, recombination and repair [L] 0.73
COG5457Uncharacterized conserved protein YjiS, DUF1127 familyFunction unknown [S] 0.73


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A51.82 %
All OrganismsrootAll Organisms48.18 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000101|DelMOSum2010_c10125716Not Available997Open in IMG/M
3300000101|DelMOSum2010_c10127526Not Available985Open in IMG/M
3300000101|DelMOSum2010_c10190573Not Available700Open in IMG/M
3300000425|P_2C_Liq_2_UnCtyDRAFT_1005051All Organisms → Viruses → Predicted Viral2810Open in IMG/M
3300000928|OpTDRAFT_10064706All Organisms → Viruses → Predicted Viral1012Open in IMG/M
3300000949|BBAY94_10111830Not Available747Open in IMG/M
3300001352|JGI20157J14317_10136309Not Available792Open in IMG/M
3300004279|Ga0066605_10058549All Organisms → Viruses → Predicted Viral1711Open in IMG/M
3300004448|Ga0065861_1011330Not Available554Open in IMG/M
3300004460|Ga0066222_1019046Not Available971Open in IMG/M
3300006027|Ga0075462_10101118Not Available895Open in IMG/M
3300006029|Ga0075466_1049412All Organisms → Viruses → Predicted Viral1246Open in IMG/M
3300006637|Ga0075461_10069771Not Available1124Open in IMG/M
3300006752|Ga0098048_1101985Not Available868Open in IMG/M
3300006810|Ga0070754_10414617All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-6588Open in IMG/M
3300006916|Ga0070750_10191797Not Available908Open in IMG/M
3300006916|Ga0070750_10273053Not Available729Open in IMG/M
3300006920|Ga0070748_1108956Not Available1051Open in IMG/M
3300006920|Ga0070748_1177741All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-6784Open in IMG/M
3300006920|Ga0070748_1204532Not Available720Open in IMG/M
3300006920|Ga0070748_1246468Not Available643Open in IMG/M
3300006920|Ga0070748_1289618All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-6583Open in IMG/M
3300006922|Ga0098045_1008281All Organisms → Viruses → Predicted Viral3029Open in IMG/M
3300006922|Ga0098045_1121694All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-6608Open in IMG/M
3300006924|Ga0098051_1050558All Organisms → Viruses → Predicted Viral1149Open in IMG/M
3300006925|Ga0098050_1085319Not Available812Open in IMG/M
3300007229|Ga0075468_10055582All Organisms → Viruses → Predicted Viral1334Open in IMG/M
3300007229|Ga0075468_10241692Not Available514Open in IMG/M
3300007276|Ga0070747_1072110All Organisms → Viruses → Predicted Viral1297Open in IMG/M
3300007276|Ga0070747_1177506Not Available757Open in IMG/M
3300007280|Ga0101452_116722All Organisms → Viruses → Predicted Viral2251Open in IMG/M
3300007346|Ga0070753_1101511All Organisms → Viruses → Predicted Viral1123Open in IMG/M
3300007540|Ga0099847_1047325Not Available1358Open in IMG/M
3300008961|Ga0102887_1142936Not Available742Open in IMG/M
3300009002|Ga0102810_1083723All Organisms → Viruses → Predicted Viral1000Open in IMG/M
3300009027|Ga0102957_1173569All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-6768Open in IMG/M
3300009077|Ga0115552_1223665Not Available766Open in IMG/M
3300009472|Ga0115554_1278443Not Available664Open in IMG/M
3300009515|Ga0129286_10354431All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-6544Open in IMG/M
3300010149|Ga0098049_1032752Not Available1686Open in IMG/M
3300010153|Ga0098059_1385474All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-6530Open in IMG/M
3300010368|Ga0129324_10199427Not Available813Open in IMG/M
3300010389|Ga0136549_10150059All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1048Open in IMG/M
3300011118|Ga0114922_11672246All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-6510Open in IMG/M
3300013010|Ga0129327_10703209All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-6566Open in IMG/M
3300016776|Ga0182046_1083218All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-6595Open in IMG/M
3300017697|Ga0180120_10417220All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-6526Open in IMG/M
3300017708|Ga0181369_1015087All Organisms → Viruses → Predicted Viral1928Open in IMG/M
3300017742|Ga0181399_1029901All Organisms → Viruses → Predicted Viral1482Open in IMG/M
3300017742|Ga0181399_1093716Not Available747Open in IMG/M
3300017749|Ga0181392_1057782All Organisms → Viruses → Predicted Viral1186Open in IMG/M
3300017749|Ga0181392_1081488Not Available975Open in IMG/M
3300017752|Ga0181400_1066141Not Available1095Open in IMG/M
3300017752|Ga0181400_1066185All Organisms → Viruses → Predicted Viral1095Open in IMG/M
3300017755|Ga0181411_1115049Not Available788Open in IMG/M
3300017765|Ga0181413_1173260Not Available648Open in IMG/M
3300017771|Ga0181425_1191267Not Available644Open in IMG/M
3300017813|Ga0188953_12386All Organisms → Viruses → Predicted Viral2114Open in IMG/M
3300018041|Ga0181601_10663148Not Available529Open in IMG/M
3300018041|Ga0181601_10697767Not Available511Open in IMG/M
3300018420|Ga0181563_10133343Not Available1582Open in IMG/M
3300019711|Ga0193993_1004034Not Available1314Open in IMG/M
3300019938|Ga0194032_1018380Not Available741Open in IMG/M
3300020169|Ga0206127_1173157Not Available810Open in IMG/M
3300020174|Ga0181603_10265990Not Available676Open in IMG/M
3300020175|Ga0206124_10178873Not Available845Open in IMG/M
3300020187|Ga0206130_10083494All Organisms → Viruses → Predicted Viral1979Open in IMG/M
3300020358|Ga0211689_1225388All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-6504Open in IMG/M
3300021371|Ga0213863_10395136All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-6560Open in IMG/M
3300021957|Ga0222717_10218750All Organisms → Viruses → Predicted Viral1121Open in IMG/M
3300021957|Ga0222717_10406341Not Available752Open in IMG/M
3300021961|Ga0222714_10550495All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-6584Open in IMG/M
3300021964|Ga0222719_10813734All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-6512Open in IMG/M
3300022053|Ga0212030_1021680Not Available868Open in IMG/M
3300022057|Ga0212025_1029379Not Available921Open in IMG/M
3300022063|Ga0212029_1012395All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1069Open in IMG/M
3300022068|Ga0212021_1104965All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-6579Open in IMG/M
3300022072|Ga0196889_1109152All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-6500Open in IMG/M
3300022168|Ga0212027_1041730All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-6589Open in IMG/M
3300022169|Ga0196903_1003481All Organisms → Viruses → Predicted Viral2111Open in IMG/M
3300022178|Ga0196887_1065483Not Available886Open in IMG/M
3300022183|Ga0196891_1023813All Organisms → Viruses → Predicted Viral1163Open in IMG/M
3300022183|Ga0196891_1076180All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-6596Open in IMG/M
3300022187|Ga0196899_1014901All Organisms → Viruses → Predicted Viral2977Open in IMG/M
3300022929|Ga0255752_10261346Not Available761Open in IMG/M
(restricted) 3300023109|Ga0233432_10343059Not Available674Open in IMG/M
3300023116|Ga0255751_10460521Not Available612Open in IMG/M
3300023685|Ga0228686_1040908Not Available637Open in IMG/M
3300024223|Ga0228601_1070007All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-6501Open in IMG/M
3300024231|Ga0233399_1038899All Organisms → Viruses → Predicted Viral1313Open in IMG/M
3300024335|Ga0228672_1147889Not Available611Open in IMG/M
3300024359|Ga0228628_1076790Not Available666Open in IMG/M
3300025070|Ga0208667_1070060All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-6530Open in IMG/M
3300025083|Ga0208791_1012726Not Available1915Open in IMG/M
3300025098|Ga0208434_1002236Not Available7228Open in IMG/M
3300025108|Ga0208793_1052579All Organisms → Viruses → Predicted Viral1250Open in IMG/M
3300025168|Ga0209337_1350768All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-6505Open in IMG/M
3300025543|Ga0208303_1063279Not Available862Open in IMG/M
3300025594|Ga0209094_1022212All Organisms → Viruses → Predicted Viral1974Open in IMG/M
3300025594|Ga0209094_1051511Not Available1067Open in IMG/M
3300025621|Ga0209504_1003544Not Available9708Open in IMG/M
3300025630|Ga0208004_1101184Not Available683Open in IMG/M
3300025637|Ga0209197_1032417All Organisms → Viruses → Predicted Viral1963Open in IMG/M
3300025647|Ga0208160_1085681Not Available837Open in IMG/M
3300025652|Ga0208134_1097444Not Available819Open in IMG/M
3300025653|Ga0208428_1059815All Organisms → Viruses → Predicted Viral1138Open in IMG/M
3300025653|Ga0208428_1081319Not Available934Open in IMG/M
3300025653|Ga0208428_1098196Not Available827Open in IMG/M
3300025701|Ga0209771_1186444Not Available610Open in IMG/M
3300025705|Ga0209374_1042364All Organisms → Viruses → Predicted Viral1711Open in IMG/M
3300025769|Ga0208767_1261200All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-6533Open in IMG/M
3300025771|Ga0208427_1035225All Organisms → Viruses → Predicted Viral1901Open in IMG/M
3300025806|Ga0208545_1105689Not Available728Open in IMG/M
3300025806|Ga0208545_1132276Not Available615Open in IMG/M
3300025810|Ga0208543_1101360All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-6687Open in IMG/M
3300025832|Ga0209307_1061896All Organisms → Viruses → Predicted Viral1300Open in IMG/M
3300025849|Ga0209603_1055322All Organisms → Viruses → Predicted Viral2041Open in IMG/M
3300026187|Ga0209929_1079091Not Available882Open in IMG/M
3300026483|Ga0228620_1085619Not Available661Open in IMG/M
3300026504|Ga0247587_1179197All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-6519Open in IMG/M
3300027820|Ga0209578_10469215All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-6568Open in IMG/M
(restricted) 3300027837|Ga0255041_10214087Not Available681Open in IMG/M
(restricted) 3300027861|Ga0233415_10107680All Organisms → Viruses → Predicted Viral1233Open in IMG/M
3300027917|Ga0209536_103024602All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-6541Open in IMG/M
3300028109|Ga0247582_1060608All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-6990Open in IMG/M
3300028131|Ga0228642_1082491Not Available828Open in IMG/M
3300028287|Ga0257126_1020558All Organisms → Viruses → Predicted Viral3192Open in IMG/M
3300028287|Ga0257126_1146906Not Available786Open in IMG/M
3300029632|Ga0135266_100561All Organisms → Viruses → Predicted Viral1388Open in IMG/M
3300031696|Ga0307995_1163611Not Available815Open in IMG/M
3300031696|Ga0307995_1257248Not Available596Open in IMG/M
3300031706|Ga0307997_10222126All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-6691Open in IMG/M
3300032088|Ga0315321_10135547All Organisms → Viruses → Predicted Viral1655Open in IMG/M
3300032373|Ga0316204_10511874Not Available893Open in IMG/M
3300033742|Ga0314858_018867All Organisms → Viruses → Predicted Viral1495Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous29.93%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine9.49%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater7.30%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater7.30%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine5.84%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh5.11%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water2.92%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient2.19%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine2.19%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine2.19%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine2.19%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater2.19%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine2.19%
MarineEnvironmental → Aquatic → Marine → Inlet → Unclassified → Marine1.46%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater1.46%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.46%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water1.46%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment0.73%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.73%
Marine SedimentEnvironmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment0.73%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface0.73%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment0.73%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat0.73%
Marine Surface WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water0.73%
Sea-Ice BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine0.73%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.73%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.73%
EnviromentalEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Enviromental0.73%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.73%
Freshwater And MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine0.73%
Marine HarborEnvironmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor0.73%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Unclassified → Unclassified → Saline Water0.73%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment0.73%
Marine Methane Seep SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment0.73%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface0.73%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300000425Marine microbial community from Union City, CA, USA - Pond 2C Liquid 2EnvironmentalOpen in IMG/M
3300000928Marine plume microbial communities from the Columbia River - 25 PSUEnvironmentalOpen in IMG/M
3300000949Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94Host-AssociatedOpen in IMG/M
3300001352Pelagic Microbial community sample from North Sea - COGITO 998_met_07EnvironmentalOpen in IMG/M
3300004279Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_10mEnvironmentalOpen in IMG/M
3300004448Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300004460Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300006027Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006637Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNAEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300006922Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaGEnvironmentalOpen in IMG/M
3300006924Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaGEnvironmentalOpen in IMG/M
3300006925Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaGEnvironmentalOpen in IMG/M
3300007229Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300007276Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31EnvironmentalOpen in IMG/M
3300007280Marine coastal surface water microbial communities in Port Hacking, Sydney, Australia ? TJ18 time pointEnvironmentalOpen in IMG/M
3300007346Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31EnvironmentalOpen in IMG/M
3300007540Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007541Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaGEnvironmentalOpen in IMG/M
3300007549Estuarine microbial communities from the Columbia River estuary - metaG 1548B-02EnvironmentalOpen in IMG/M
3300008961Estuarine microbial communities from the Columbia River estuary - metaG 1550B-02EnvironmentalOpen in IMG/M
3300009002Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573EnvironmentalOpen in IMG/M
3300009027Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MGEnvironmentalOpen in IMG/M
3300009077Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328EnvironmentalOpen in IMG/M
3300009472Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404EnvironmentalOpen in IMG/M
3300009515Microbial community of beach aquifer sediment core from Cape Shores, Lewes, Delaware, USA - CF-2EnvironmentalOpen in IMG/M
3300010149Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaGEnvironmentalOpen in IMG/M
3300010153Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaGEnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300010389Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsfEnvironmentalOpen in IMG/M
3300011118Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaGEnvironmentalOpen in IMG/M
3300013010Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNAEnvironmentalOpen in IMG/M
3300016776Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011505AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017697Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2)EnvironmentalOpen in IMG/M
3300017708Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaGEnvironmentalOpen in IMG/M
3300017742Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21EnvironmentalOpen in IMG/M
3300017749Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15EnvironmentalOpen in IMG/M
3300017752Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22EnvironmentalOpen in IMG/M
3300017755Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09EnvironmentalOpen in IMG/M
3300017765Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28EnvironmentalOpen in IMG/M
3300017771Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13EnvironmentalOpen in IMG/M
3300017813Saline water viral communities from Saloum River inverse estuary, Senegal ? P2EnvironmentalOpen in IMG/M
3300018041Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019711Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BLC_4-5_MGEnvironmentalOpen in IMG/M
3300019938Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW8Nov16_MGEnvironmentalOpen in IMG/M
3300020169Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160419_1EnvironmentalOpen in IMG/M
3300020174Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041409US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020175Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2EnvironmentalOpen in IMG/M
3300020187Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160512_1EnvironmentalOpen in IMG/M
3300020358Marine microbial communities from Tara Oceans - TARA_B100000768 (ERX555925-ERR599009)EnvironmentalOpen in IMG/M
3300021371Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300021964Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34DEnvironmentalOpen in IMG/M
3300022053Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2)EnvironmentalOpen in IMG/M
3300022057Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2)EnvironmentalOpen in IMG/M
3300022063Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v2)EnvironmentalOpen in IMG/M
3300022068Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2)EnvironmentalOpen in IMG/M
3300022072Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3)EnvironmentalOpen in IMG/M
3300022168Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v2)EnvironmentalOpen in IMG/M
3300022169Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022178Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3)EnvironmentalOpen in IMG/M
3300022183Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3)EnvironmentalOpen in IMG/M
3300022187Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3)EnvironmentalOpen in IMG/M
3300022929Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaGEnvironmentalOpen in IMG/M
3300023109 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MGEnvironmentalOpen in IMG/M
3300023116Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaGEnvironmentalOpen in IMG/M
3300023685Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 50R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024223Seawater microbial communities from Monterey Bay, California, United States - 1DEnvironmentalOpen in IMG/M
3300024231Seawater microbial communities from Monterey Bay, California, United States - 43DEnvironmentalOpen in IMG/M
3300024335Seawater microbial communities from Monterey Bay, California, United States - 90DEnvironmentalOpen in IMG/M
3300024359Seawater microbial communities from Monterey Bay, California, United States - 34DEnvironmentalOpen in IMG/M
3300025070Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025083Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025098Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025108Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025168Marine viral communities from the Pacific Ocean - LP-53 (SPAdes)EnvironmentalOpen in IMG/M
3300025543Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025594Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 (SPAdes)EnvironmentalOpen in IMG/M
3300025621Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 (SPAdes)EnvironmentalOpen in IMG/M
3300025630Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025637Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512 (SPAdes)EnvironmentalOpen in IMG/M
3300025647Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025652Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes)EnvironmentalOpen in IMG/M
3300025653Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025701Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025705Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_10m (SPAdes)EnvironmentalOpen in IMG/M
3300025769Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes)EnvironmentalOpen in IMG/M
3300025771Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025806Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025832Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 (SPAdes)EnvironmentalOpen in IMG/M
3300025849Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes)EnvironmentalOpen in IMG/M
3300026187Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026483Seawater microbial communities from Monterey Bay, California, United States - 23DEnvironmentalOpen in IMG/M
3300026504Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 46R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027820Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 (SPAdes)EnvironmentalOpen in IMG/M
3300027837 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_3EnvironmentalOpen in IMG/M
3300027861 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MGEnvironmentalOpen in IMG/M
3300027917Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes)EnvironmentalOpen in IMG/M
3300028109Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 41R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028131Seawater microbial communities from Monterey Bay, California, United States - 53DEnvironmentalOpen in IMG/M
3300028287Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI060_120mEnvironmentalOpen in IMG/M
3300029632Marine harbor viral communities from the Pacific Ocean - SMB3EnvironmentalOpen in IMG/M
3300031696Marine microbial communities from Ellis Fjord, Antarctic Ocean - #262EnvironmentalOpen in IMG/M
3300031706Marine microbial communities from David Island wharf, Antarctic Ocean - #36EnvironmentalOpen in IMG/M
3300032088Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515EnvironmentalOpen in IMG/M
3300032373Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 2EnvironmentalOpen in IMG/M
3300033742Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawaterEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2010_1012571633300000101MarineTEGRESKRMWDFSSDGPLGNGTKAKVQFEVYANGAGVRLLNVGVTDHVPYEDNPVSEDDELFNV*
DelMOSum2010_1012752613300000101MarineSKRMWDFSSDGPLGNGTKAKVQFEVYANGAGVRLLNVGVTDHVPYEDNVVSEDDELFNV*
DelMOSum2010_1019057313300000101MarineNGTKAKVQFELYRDGVGVRLLNVGITEHVPYEDNNVLTEDDELFIV*
P_2C_Liq_2_UnCtyDRAFT_100505183300000425EnviromentalEGVENKRWWSFEDDGPLGNGTRAKVQFETYSKGAGVRLINLGVTDHIPYEDTYVANPDDELFNMDAA*
OpTDRAFT_1006470633300000928Freshwater And MarineMALAKVQFEVYANGAGVRLLNVGVTDHVPYESNNAVSEDDELFIV*
BBAY94_1011183013300000949Macroalgal SurfaceGNGTKAKVQFEVYANGAGVRLLNVGVTDHVPYEDNPVSEDDELFNV*
JGI20157J14317_1013630933300001352Pelagic MarineENKTWWSLEEDGELGNGTRAKVQFETYSNGAGLRLLAVGVTDHVSYEGASPSEDDELFMVD*
Ga0066605_1005854953300004279MarineLTEGRESKRMWDFSSDGPLGNGTKAKVQFEVYANGAGVRLLNVGVTDHVPYEDNVVSEDDELFNV*
Ga0065861_101133013300004448MarineAKVQFEVYANGAGVRLLNVGVTDHVPYEANNAVSEDDELFIV*
Ga0066222_101904633300004460MarineDGLLGNGTKAKVQFELYKDGVGVRLLNVGITEHVPYEDNNVLTEDDELFIV*
Ga0075462_1010111833300006027AqueousKAKVQFETYSNGAGVRLLNVGITEHVPYTSGEPTEDDKMFMVG*
Ga0075466_104941243300006029AqueousSNGAGVRLLNVGVTEHVAYEPENKISEDDELFMVG*
Ga0075461_1006977133300006637AqueousKKRMWSFVDDGPLGNGTKAKVQFETYAKGAGVRLMNIGVVDHVAYESNSEPSEDDKLFMVD*
Ga0098048_110198513300006752MarineTKGEDKKRMWSFVDDGPLGNGTKAKVQFETYAKGAGVRLMNIGVVDHVAYESNSEPSEDDKLFMVD*
Ga0070754_1041461733300006810AqueousFEEDGPLGNGTKAKVQFETYSNGAGVRLLNVGITEHVPYTSGEPTEDDKMFMVG*
Ga0070750_1019179733300006916AqueousETYSNGAGVRLLNVGITEHVPYTSGEPTEDDKMFMVG*
Ga0070750_1027305313300006916AqueousTKAKVQFEVYANGAGVRLLNVGVTDHVPYEDNPVSEDDELFNV*
Ga0070748_110895613300006920AqueousGPLGNGTKAKVQFETYSNGAGVRLLNVGITEHVPYTSGEPTEDDKMFMVG*
Ga0070748_117774133300006920AqueousGAPGIVNLTEGVDNKRAWVFSEDGPLGNGTEAKVQFDTYSNGSGVRLLNIGVTNHVPYSEGGPTEDDQLFMVG*
Ga0070748_120453213300006920AqueousEDKKRMWSFVDDGPLGNGTKAKVQFETYAKGAGVRLMNIGVVDHVAYESNSEPSEDDKLFMVD*
Ga0070748_124646813300006920AqueousGALGNGTRAKVQFETYSKGAGLRLIALGITDHVAYEGGGSNEDDELFMVD*
Ga0070748_128961833300006920AqueousVNLTDGRDNKRMWSFDDDGPLGNGTKAKVQFEVYAKGAGVRLLNIGVTEHVAYESNSEVTEDDELFII*
Ga0098045_100828113300006922MarineLWDFEKYGALGNGTKAKVQFETYASGAGIRLLNVGVTEHVSYVSLDEITEDDELFMVG*
Ga0098045_112169413300006922MarineTEGREGKRMWDFSSDGPLGNGTKAKVQFEVYANGAGVRLLNVGVTDHVPYEDNVVSEDDELFNV*
Ga0098051_105055843300006924MarineSLWSFDGDGTLGNGTKAKVQFETYSKGAGVRLIAIAVTDHVAWEEISSADDEIFMVG*
Ga0098050_108531913300006925MarineKAKVQFETYASGAGVRLMNVGITEHVAYETNSAPTEDDELFMVG*
Ga0075468_1005558243300007229AqueousGTKAKVQFETYSNGAGVRLIAIGVTDHVAWEDNSVPSADDELFMVG*
Ga0075468_1024169213300007229AqueousALGNGTRAKVQFETYSKGAGLRLIALGITDHVAYEGGGSNEDDELFMVD*
Ga0070747_107211043300007276AqueousGTKAKVQFETYSNGAGLRLIAIGVTDHVAWEDNNSSADDELFMVG*
Ga0070747_117750613300007276AqueousDGPLGNGTKAKVQFEVYANGAGVRLLNVGVTDHVPYEDNVVSEDDELFNV*
Ga0101452_11672223300007280Marine Surface WaterXANGAGVRLLNVGVTDHVPYEDNPVSEDDELFNV*
Ga0070753_110151133300007346AqueousTWWSLEEDGELGNGTRAKVQFETYSNGAGLRLLAVGVTDHVSYEGASPSEDDELFMVD*
Ga0099847_104732543300007540AqueousRMWSFADDGPLGNGTKAKVQFETYAKGAGVRLMNIGVVDHVSYESNSEISEDDKLFMVD*
Ga0099848_104658513300007541AqueousKRWWSYEEDGALGNGTKAKVQFEVYSRGAGVRLINVGVTELVEYVPQANEDDELFKVA*
Ga0102879_115890513300007549EstuarineFETYSNGAGVRLIAIGVTDHVAWEDNSIPSEDDQLFMVG*
Ga0102887_114293633300008961EstuarineWSFSEDGAIGNGTKAKVQFETYASGAGVRLMNVGITEHVAYETNSAPTEDDELFMVG*
Ga0102810_108372313300009002EstuarinePTVVNLTEGREKKRLWDYNEDGLIGNGSKAKVQFEVYANGAGVRLLNVGVTDHVPYESNNVTSEDDELFNV*
Ga0102957_117356913300009027Pond WaterNGMDKKTLWSFEEDGPLGNGTKAKVQFETYSNGAGVRLLNVGITEHVPYTSGEPTEDDKMFMVG*
Ga0115552_122366533300009077Pelagic MarineSKGAGLRLINIGIIDHVAYEGGGSTEDDELFMVD*
Ga0115554_127844313300009472Pelagic MarineTRAKVQFETYSNGAGVRLLAVGVTDHVSYEGASPSEDDELFMVD*
Ga0129286_1035443113300009515SedimentGTKAKVQFETYSNGAGVRLLNVGITEHVPYTSGEPTEDDKMFMVG*
Ga0098049_103275213300010149MarineKGEDKKRMWSFVDDGPLGNGTKAKVQFETYAKGAGVRLMNIGVVDHVAYESNSEPSEDDKLFMVD*
Ga0098059_138547413300010153MarineLGNGTKAKVQFETYSNGAGVRLLNVGITEHVPYTSGEPTEDDKMFMVG*
Ga0129324_1019942713300010368Freshwater To Marine Saline GradientNKTWWSLEEDGELGNGTRAKVQFETYSNGAGLRLLAVGVTDHVSYEGASPSEDDELFMVD
Ga0136549_1015005943300010389Marine Methane Seep SedimentWSFEEDGALGNGTKAKVQFEVYSRGAGVRLVNVGVTELVEYVPKANEDDELFKVA*
Ga0114922_1167224613300011118Deep SubsurfaceAPNIVNLTNGMDKKTLWNFEEDGPLGNGTKAKVQFETYSNGAGVRLLNVGITEHVPYTSGEPTDDDRMFMVG*
Ga0129327_1070320933300013010Freshwater To Marine Saline GradientKVQFDVYANGAGVRLLNIGVTEHVAYENNSVISEDDELFAF*
Ga0182046_108321813300016776Salt MarshLWSFEEDGPLGNGTKAKVQFETYSNGAGVRLLNVGITEHVPYTSGEPTEDDKMFMVG
Ga0180120_1041722013300017697Freshwater To Marine Saline GradientNKRMWSFDDDGPLGNGTKAKVQFEVYAKGAGVRLLNIGVTEHVAYESNSEVTEDDELFII
Ga0181369_101508713300017708MarineETYSNGAGVRLIAVGITDHVAYEGGGGLTEDDELFMVG
Ga0181399_102990153300017742SeawaterFETYASGAGVRLMNVGITEHVAYETNSAPTEDDELFMVG
Ga0181399_109371633300017742SeawaterEDDGELGNGTRAKVQFETYSNGAGVRLLAVGVTDHVAYEGGGVSTEDDELFMVG
Ga0181392_105778213300017749SeawaterEDGELGNGTRAKVQFETYSNGAGVRLLAVGVTDHVAYEGGGVSTEDDELFMVG
Ga0181392_108148813300017749SeawaterSKRMWDFSSDGPLGNGTKAKVQFEIYAQGAGVRLLNVGITDHVPYEENNAVTEDDELFIV
Ga0181400_106614143300017752SeawaterAKVQFEIYAQGAGVRLLNVGITDHVPYEENNAVTEDDELFIL
Ga0181400_106618543300017752SeawaterAKVQFEIYAQGAGVRLLNVGITDHVPYEENNAVTEDDELFIV
Ga0181411_111504933300017755SeawaterESKRMWDFSSDGPLGNGTKAKVQFEVYANGAGVRLLNVGVTDHVPYEDNVVSEDDELFNV
Ga0181413_117326033300017765SeawaterKAKVQFETYASGAGVRLMNVGITEHVAYETNSAPTEDDELFMVG
Ga0181425_119126733300017771SeawaterWSFSEDGAIGNGTKAKVQFETYASGAGVRLMNVGITEHVAYETNSAPTEDDELFMVG
Ga0188953_1238663300017813Saline WaterTYSNGAGVRLKNVGVTEHVAYEMTNEPDPNDELFKVA
Ga0181601_1066314813300018041Salt MarshEEDGALGNGTRAKVQFETYSKGAGLRLIALGITDHVAYEGGGSTEDDELFMVD
Ga0181601_1069776713300018041Salt MarshGNGTRAKVQFETYSKGAGLRLIALGITDHVAYEGGGSNEDDELFMVD
Ga0181563_1013334313300018420Salt MarshYANGAGIRLLNVGVTEHVSYDSEPVMSEDDELFMVG
Ga0193993_100403413300019711SedimentKKTLWSFEEDGPLGNGTKAKVQFETYSNGAGVRLLNVGITEHVPYTSGEPTEDDKMFMVG
Ga0194032_101838013300019938FreshwaterPLGNGTKAKVQFETYSNGAGVRLLNVGVTEHVAYEPENKISEDDELFMVG
Ga0206127_117315713300020169SeawaterTKAKVQFEVYANGAGVRLLNVGVTDHVPYEDNNVITEDDELFII
Ga0181603_1026599033300020174Salt MarshDGALGNGTRAKVQFETYSKGAGLRLIALGITDHVAYEGGGSTEDDELFMVD
Ga0206124_1017887313300020175SeawaterWWSLEEDGALGNGTRAKVQFETYSKGAGLRLIALGITDHVAYEGGGSTEDDELFMVD
Ga0206130_1008349413300020187SeawaterGGAPGIVNLTEGVDNKRAWVFSEDGPLGNGTEAKVQFDTYSNGSGVRLLNIGVTNHVPYSEGGPTEDDQLFMVG
Ga0211689_122538813300020358MarineKRLWDYNGDGLLGNGTKAKVQFELYREGVGVRLLNVGITEHVPYEDSNVLTEDDELFIV
Ga0213863_1039513613300021371SeawaterENKRMWDFEADGPLGNGTKAKVQFDVYANGAGVRLLNIGVTEHVAYENNSVISEDDELFA
Ga0222717_1021875043300021957Estuarine WaterALGNGTKAKVQFEIYAQGAGVRLLNVGITDHVPYEENNAVTEDDELFIV
Ga0222717_1040634113300021957Estuarine WaterGNGTKAKVQFETYSNGAGLRLIAIGVTDHVAWQDNTSVSADDELFMVG
Ga0222714_1055049533300021961Estuarine WaterIGNGSKAKVQFEVYANGAGVRLLNVGVTEHVIYDNETVSEDDELFIV
Ga0222719_1081373433300021964Estuarine WaterYASGAGIRLLNVGVTEHVSYVSLDEITEDDELFMVG
Ga0212030_102168013300022053AqueousSWWSLEGDGALGNGTRAKVQFETYSKGAGLRLIAVGVTDHVAYEGASSTEDDEMFMVD
Ga0212025_102937933300022057AqueousDGELGNGTRAKVQFETYSNGAGLRLLAVGVTDHVSYEGASPSEDDELFMVD
Ga0212029_101239543300022063AqueousTLGNGTKAKVQFETYASGAGVRLIAIGVTDHVAWEDNSIPSEDDQLFMVG
Ga0212021_110496533300022068AqueousSFEEDGPLGNGTKAKVQFETYSNGAGVRLLNVGITEHVPYTSGEPTEDDKMFMVG
Ga0196889_110915213300022072AqueousAKVQFEVYAKGAGVRLLNIGVTEHVAYESNSEVTEDDELFII
Ga0212027_104173033300022168AqueousNIVNLTNGMDKKTLWSFEEDGPLGNGTKAKVQFETYSNGAGVRLLNVGITEHVPYTSGEPTEDDKMFMVG
Ga0196903_100348113300022169AqueousEDGELGNGTRAKVQFETYSNGAGLRLLAVGVTDHVSYEGASPSEDDELFMVD
Ga0196887_106548313300022178AqueousSDGPLGNGTKAKVQFEVYANGAGVRLLNVGVTDHVPYEDNVVSEDDELFNV
Ga0196891_102381313300022183AqueousDGPLGNGTKAKVQFETYSNGAGVRLLNVGVTEHVAYEPENKISEDDELFMVG
Ga0196891_107618033300022183AqueousTKAKVQFETYSNGAGVRLLNVGITEHVPYTSGEPTEDDKMFMVG
Ga0196899_101490113300022187AqueousLTEGVDNKRAWVFSEDGPLGNGTEAKVQFDTYSNGSGVRLLNIGVTNHVPYSEGGPTEDDQLFMVG
Ga0255752_1026134633300022929Salt MarshEDGSLGNGTRALVQFETYSKGAGLRLINIGIIDYVAYEGGGSTEDDELFMVD
(restricted) Ga0233432_1034305913300023109SeawaterLEEDGELGNGTRAKVQFETYSNGAGLRLLAVGVTDHVSYEGASPSEDDELFMVD
Ga0255751_1046052133300023116Salt MarshGPLGNGTKAKVQFETYSNGAGLRLLNVGVTEHVAYEPENKISEDDELFMVG
Ga0228686_104090833300023685SeawaterSSDGPLGNGTKAKVQFEVYANGAGVRLLNVGVTDHVPYEDNVVSEDDELFNV
Ga0228601_107000713300024223SeawaterALGNGTKAKVQFEIYAKGAGVRLLNVGITDHVPYEENNAVTEDDELFIV
Ga0233399_103889943300024231SeawaterVENKRWWSFEDDGPLGNGTRAKVQFETYSKGAGVRLINLGVTDHIPYEDNYVANPDDELFNMDAA
Ga0228672_114788933300024335SeawaterWTLEEDGELGNGTRAKVQFETYSNGAGVRLLAVGVTDHVAYEGGGVSTEDDELFMVG
Ga0228628_107679013300024359SeawaterEDGALGNGTKAKVQFEIYAQGAGVRLLNVGITDHVPYEENNAVTEDDELFIV
Ga0208667_107006013300025070MarineDDGPLGNGTKAKVQFETYAKGAGVRLMNIGVVDHVAYESNSEPSEDDKLFMVD
Ga0208791_101272613300025083MarineYGALGNGTKAKVQFETYASGAGIRLLNVGVTEHVSYVSLDEITEDDELFMVG
Ga0208434_100223613300025098MarineVQFEVYAQGAGVRLLNVGVTDHVPYEENNAITEDDELFIV
Ga0208793_105257913300025108MarineEDGALGNGTKAMVQFETYSKGAGLRLIGIAVTDHVAYEAASSSEYDEMFMVD
Ga0209337_135076813300025168MarineAPTVVNLTEGRENKRLWDYNGDGLLGNGTKAKVQFELYRDGVGVRLLNVGITEHVPYEDNNVLTEDDELFIV
Ga0208303_106327933300025543AqueousTKAKVQFETYASGAGVRLIAIGVTDHVAWEDNSIPSEDDQLFMVG
Ga0209094_102221213300025594Pelagic MarineMWDFEADGPLGNGTKAKVQFDVYANGAGVRLLNIGVTEHVAYEKNSVISEDDELFAF
Ga0209094_105151133300025594Pelagic MarineNKRMWSFDDDGPLGNGTKAKVQFETYAKGAGVRLMNIGVVKHVSYESNSEPSEDDKLFMV
Ga0209504_100354413300025621Pelagic MarinePVGVVNLTNGTDNKSWWSFTEDGPLGNGTEAKVQFELYANGAGIRLVNIGVTNHVPFESTNTVTEDDKLFMVG
Ga0208004_110118413300025630AqueousGNGTKAKVQFETYAKGAGVRLMNIGVVDHVAYESNSEPSEDDKLFMVD
Ga0209197_103241763300025637Pelagic MarineYANGAGVRLLNVGVTDHVPYESNNVTSEDDELFNV
Ga0208160_108568133300025647AqueousALGNGTRAKVQFETYSKGAGLRLIAVGVTDHVAYEGASSTEDDEMFMVD
Ga0208134_109744413300025652AqueousVQFEVYANGAGVRLLNVGVTDHVPYEDNPVSEDDELFNV
Ga0208428_105981543300025653AqueousKAKVQFETYSNGAGVRLLNVGVTEHVAYEPENKISEDDELFMVG
Ga0208428_108131933300025653AqueousLTEGVDNKRAWVFSEDGPLGNGTEAKVQFDTYSNGQGVRLLNIGVTNHVPYSEGGPTEDDQLFMVG
Ga0208428_109819613300025653AqueousDGALGNGTRAKVQFETYSKGAGLRLIAVGVTDHVAYEGASSTEDDEMFMVD
Ga0209771_118644433300025701MarineWSLEEDGALGNGTRAKVQFETYSKGAGLRLIALGITDHVAYEGGGSTEDDELFMVE
Ga0209374_104236413300025705MarineLTEGRESKRMWDFSSDGPLGNGTKAKVQFEVYANGAGVRLLNVGVTDHVPYEDNVVSEDDELFNV
Ga0208767_126120013300025769AqueousKAKVQFETYSNGAGVRLLNVGITEHVPYTSGEPTEDDKMFMVG
Ga0208427_103522553300025771AqueousLTNGAENKTWWSLEEDGELGNGTRAKVQFETYSNGAGLRLLAVGVTDHVSYEGASPSEDDELFMVD
Ga0208545_110568933300025806AqueousGTKAKVQFETYSNGAGVRLIAIGVTDHVAWEDNSVPSADDELFMVG
Ga0208545_113227633300025806AqueousKVQFETYASGAGVRLMNVGITEHVAYETNSAPTEDDELFMVG
Ga0208543_110136013300025810AqueousFEEDGPLGNGTKAKVQFETYSNGAGVRLLNVGITEHVPYTSGEPTEDDKMFMVG
Ga0209307_106189613300025832Pelagic MarineTNGAENKTWWSLEEDGELGNGTRAKVQFETYSNGAGLRLLAVGVTDHVSYEGASPSEDDELFMVD
Ga0209603_105532263300025849Pelagic MarineEGPLGNGTKAKVQFEVYANGAGVRLLNIGVTEHVAYENNSVISEDDELFAF
Ga0209929_107909133300026187Pond WaterKVQFETYSKGAGLRLIALGITDHVAYEGGGSTEDDELFMVD
Ga0228620_108561933300026483SeawaterWWSFEDDGPLGNGTRAKVQFETYSKGAGVRLINLGVTDHIPYEDTYVANPDDELFNMDAA
Ga0247587_117919733300026504SeawaterEKKRLWDYNEDGLIGNGSKAKVQFEVYANGAGVRLLNVGVTEHVIYDNETISEDDELFIV
Ga0209578_1046921533300027820Marine SedimentWSFSEDGAIGNGTKAKVQFEIYASGAGVRLMNVGITEHVAYETNSAPTEDDELFMVG
(restricted) Ga0255041_1021408713300027837SeawaterNGTENKTWWSLEEDGELGNGTRAKVQFETYSNGAGLRLLAVGVTDHVSYEGASPSEDDELFMVD
(restricted) Ga0233415_1010768043300027861SeawaterAKVQFETYSKGAGLRLIAVGVTDHVAYEGGGSTEDDELFMVE
Ga0209536_10302460213300027917Marine SedimentGPLGNGTKAKVQFETYSNGAGVRLLNVGVTEHVAYEPENKISEDDELFMVG
Ga0247582_106060813300028109SeawaterMWDFSSDGPLGNGTKAKVQFEVYANGAGVRLLNVGVTDHVPYEDNVVSEDDELFNV
Ga0228642_108249133300028131SeawaterDDGPLGNGTRAKVQFETYSKGAGVRLINLGVTDHIPYEDTYVANPDDELFNMDAA
Ga0257126_102055813300028287MarineKRLWSFSEDGAIGNGTKAKVQFETYASGAGVRLMNVGITEHLAYETNSAPTEDDELFMVG
Ga0257126_114690633300028287MarineGELGNGTRAKVQFETYSNGAGLRLLAVGVTDHVSYEGASPSEDDELFMVD
Ga0135266_10056113300029632Marine HarborNSSSSFEEDGPLGNGTKAMVQFEVYSRGAGVRLVNVGVTEHVPYEPTAGGNNDDELFKVA
Ga0307995_116361133300031696MarineKVQFEIYANGAGVRLANVGVTEHVAYEMNSTVNEDDELFNV
Ga0307995_125724833300031696MarineKRLWDYEGDGLIGNGTKAKVQFEVYANGAGVRLVAVGVTEHIPYESNAVTSEDDELFNI
Ga0307997_1022212613300031706MarineMTDDGELGNGTSAKVQFETYSNGAGVRLLAIGVTDHVAWESTSGPSADDEMFMVG
Ga0315321_1013554713300032088SeawaterNEDGLIGNGSKAKVQFEVYANGAGVRLLNVGVTEHVIYDNETISEDDELFIV
Ga0316204_1051187413300032373Microbial MatGNGTKAKVQFETYASGAGVRLMNVGITEHVAYETNSAPTEDDELFMVG
Ga0314858_018867_2_1993300033742Sea-Ice BrineTEGRENKRLWNFSEDGPLGNGTKAKVQFEVYANGAGVRLLNVGVTDHVPYEANNAVSEDDELFIV


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.