| Basic Information | |
|---|---|
| Family ID | F056513 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 137 |
| Average Sequence Length | 44 residues |
| Representative Sequence | TVVGAHGKQTQVAVTPGISENGYVQVTPVHSGALAAGDRVVVSG |
| Number of Associated Samples | 120 |
| Number of Associated Scaffolds | 137 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.73 % |
| % of genes near scaffold ends (potentially truncated) | 99.27 % |
| % of genes from short scaffolds (< 2000 bps) | 87.59 % |
| Associated GOLD sequencing projects | 117 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (65.693 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (49.635 % of family members) |
| Environment Ontology (ENVO) | Unclassified (40.146 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (41.606 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 26.39% Coil/Unstructured: 73.61% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 137 Family Scaffolds |
|---|---|---|
| PF00005 | ABC_tran | 84.67 |
| PF12704 | MacB_PCD | 14.60 |
| PF00171 | Aldedh | 0.73 |
| COG ID | Name | Functional Category | % Frequency in 137 Family Scaffolds |
|---|---|---|---|
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.73 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.73 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.73 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 65.69 % |
| Unclassified | root | N/A | 34.31 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2166559006|FI_contig10627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 993 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10227824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 757 | Open in IMG/M |
| 3300004479|Ga0062595_101885103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 572 | Open in IMG/M |
| 3300004635|Ga0062388_102687480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 524 | Open in IMG/M |
| 3300005169|Ga0066810_10138528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 572 | Open in IMG/M |
| 3300005439|Ga0070711_101524375 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 583 | Open in IMG/M |
| 3300005712|Ga0070764_10480217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 745 | Open in IMG/M |
| 3300005764|Ga0066903_102257098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 1050 | Open in IMG/M |
| 3300005764|Ga0066903_103144523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 893 | Open in IMG/M |
| 3300006028|Ga0070717_11222817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 683 | Open in IMG/M |
| 3300006050|Ga0075028_100787011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 579 | Open in IMG/M |
| 3300006755|Ga0079222_10272080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1083 | Open in IMG/M |
| 3300006806|Ga0079220_10767408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 723 | Open in IMG/M |
| 3300006871|Ga0075434_102083544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 572 | Open in IMG/M |
| 3300006903|Ga0075426_10075341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2410 | Open in IMG/M |
| 3300007788|Ga0099795_10189543 | Not Available | 862 | Open in IMG/M |
| 3300009176|Ga0105242_11053749 | Not Available | 824 | Open in IMG/M |
| 3300010049|Ga0123356_12187462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 691 | Open in IMG/M |
| 3300010301|Ga0134070_10357585 | Not Available | 568 | Open in IMG/M |
| 3300010359|Ga0126376_10590905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1048 | Open in IMG/M |
| 3300010361|Ga0126378_11309247 | Not Available | 819 | Open in IMG/M |
| 3300010361|Ga0126378_13396535 | Not Available | 505 | Open in IMG/M |
| 3300010366|Ga0126379_10008978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Kitasatospora → Kitasatospora aureofaciens | 6911 | Open in IMG/M |
| 3300010373|Ga0134128_10105026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Kitasatospora → Kitasatospora aureofaciens | 3212 | Open in IMG/M |
| 3300010375|Ga0105239_11494852 | Not Available | 780 | Open in IMG/M |
| 3300010376|Ga0126381_101439333 | Not Available | 996 | Open in IMG/M |
| 3300010397|Ga0134124_12122654 | Not Available | 600 | Open in IMG/M |
| 3300010876|Ga0126361_11164422 | Not Available | 758 | Open in IMG/M |
| 3300012206|Ga0137380_11470282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 566 | Open in IMG/M |
| 3300012349|Ga0137387_10690347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 739 | Open in IMG/M |
| 3300012357|Ga0137384_10245354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Stigmatella → Stigmatella aurantiaca → Stigmatella aurantiaca DW4/3-1 | 1495 | Open in IMG/M |
| 3300012683|Ga0137398_10022598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3440 | Open in IMG/M |
| 3300016319|Ga0182033_10974902 | Not Available | 753 | Open in IMG/M |
| 3300016387|Ga0182040_10474642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 995 | Open in IMG/M |
| 3300017822|Ga0187802_10134316 | Not Available | 941 | Open in IMG/M |
| 3300017932|Ga0187814_10392221 | Not Available | 540 | Open in IMG/M |
| 3300017946|Ga0187879_10824776 | Not Available | 518 | Open in IMG/M |
| 3300018007|Ga0187805_10521224 | Not Available | 558 | Open in IMG/M |
| 3300018037|Ga0187883_10073252 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Kitasatospora | 1798 | Open in IMG/M |
| 3300019887|Ga0193729_1063300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura mexicana | 1475 | Open in IMG/M |
| 3300020581|Ga0210399_10739795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 806 | Open in IMG/M |
| 3300020582|Ga0210395_10125975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Kitasatospora → unclassified Kitasatospora → Kitasatospora sp. MBT63 | 1903 | Open in IMG/M |
| 3300020583|Ga0210401_10899000 | Not Available | 744 | Open in IMG/M |
| 3300021088|Ga0210404_10053284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Kitasatospora | 1912 | Open in IMG/M |
| 3300021170|Ga0210400_10773588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 788 | Open in IMG/M |
| 3300021171|Ga0210405_10177611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Kitasatospora → unclassified Kitasatospora → Kitasatospora sp. MBT63 | 1687 | Open in IMG/M |
| 3300021171|Ga0210405_10888934 | Not Available | 678 | Open in IMG/M |
| 3300021180|Ga0210396_10090628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2770 | Open in IMG/M |
| 3300021181|Ga0210388_11054265 | Not Available | 695 | Open in IMG/M |
| 3300021401|Ga0210393_11406357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 557 | Open in IMG/M |
| 3300021401|Ga0210393_11454090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 546 | Open in IMG/M |
| 3300021402|Ga0210385_10340344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 1118 | Open in IMG/M |
| 3300021403|Ga0210397_10037004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3072 | Open in IMG/M |
| 3300021403|Ga0210397_10419456 | Not Available | 1003 | Open in IMG/M |
| 3300021404|Ga0210389_10852199 | Not Available | 711 | Open in IMG/M |
| 3300021406|Ga0210386_11095342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 676 | Open in IMG/M |
| 3300021406|Ga0210386_11641108 | Not Available | 532 | Open in IMG/M |
| 3300021420|Ga0210394_10678841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 903 | Open in IMG/M |
| 3300021477|Ga0210398_11136818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 619 | Open in IMG/M |
| 3300021478|Ga0210402_10836014 | Not Available | 846 | Open in IMG/M |
| 3300025898|Ga0207692_10372926 | Not Available | 884 | Open in IMG/M |
| 3300025900|Ga0207710_10244081 | Not Available | 897 | Open in IMG/M |
| 3300025928|Ga0207700_11439301 | Not Available | 612 | Open in IMG/M |
| 3300025929|Ga0207664_10200669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Kitasatospora | 1721 | Open in IMG/M |
| 3300025934|Ga0207686_11605571 | Not Available | 537 | Open in IMG/M |
| 3300026067|Ga0207678_10484935 | All Organisms → cellular organisms → Bacteria | 1077 | Open in IMG/M |
| 3300027590|Ga0209116_1032188 | Not Available | 1108 | Open in IMG/M |
| 3300027853|Ga0209274_10054158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Kitasatospora | 1910 | Open in IMG/M |
| 3300027855|Ga0209693_10375193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 689 | Open in IMG/M |
| 3300027857|Ga0209166_10453913 | Not Available | 662 | Open in IMG/M |
| 3300027884|Ga0209275_10185463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Kitasatospora | 1119 | Open in IMG/M |
| 3300028742|Ga0302220_10172147 | Not Available | 817 | Open in IMG/M |
| 3300028906|Ga0308309_11074848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 696 | Open in IMG/M |
| 3300030524|Ga0311357_10065057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3698 | Open in IMG/M |
| 3300031544|Ga0318534_10059974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Kitasatospora | 2142 | Open in IMG/M |
| 3300031544|Ga0318534_10328855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 881 | Open in IMG/M |
| 3300031549|Ga0318571_10308854 | Not Available | 597 | Open in IMG/M |
| 3300031549|Ga0318571_10450953 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 510 | Open in IMG/M |
| 3300031561|Ga0318528_10742501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 525 | Open in IMG/M |
| 3300031564|Ga0318573_10032349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 2456 | Open in IMG/M |
| 3300031564|Ga0318573_10796485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 508 | Open in IMG/M |
| 3300031573|Ga0310915_11257313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 511 | Open in IMG/M |
| 3300031640|Ga0318555_10233911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 992 | Open in IMG/M |
| 3300031680|Ga0318574_10494683 | Not Available | 716 | Open in IMG/M |
| 3300031682|Ga0318560_10341328 | Not Available | 808 | Open in IMG/M |
| 3300031715|Ga0307476_10213325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 1404 | Open in IMG/M |
| 3300031720|Ga0307469_11575904 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 630 | Open in IMG/M |
| 3300031724|Ga0318500_10267572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 832 | Open in IMG/M |
| 3300031736|Ga0318501_10628233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 590 | Open in IMG/M |
| 3300031744|Ga0306918_10796621 | Not Available | 738 | Open in IMG/M |
| 3300031747|Ga0318502_10302789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 940 | Open in IMG/M |
| 3300031747|Ga0318502_10359435 | Not Available | 862 | Open in IMG/M |
| 3300031748|Ga0318492_10479255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 659 | Open in IMG/M |
| 3300031751|Ga0318494_10188017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 1173 | Open in IMG/M |
| 3300031770|Ga0318521_10010092 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Kitasatospora | 4010 | Open in IMG/M |
| 3300031778|Ga0318498_10212263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 876 | Open in IMG/M |
| 3300031778|Ga0318498_10274931 | Not Available | 757 | Open in IMG/M |
| 3300031779|Ga0318566_10462710 | Not Available | 622 | Open in IMG/M |
| 3300031792|Ga0318529_10031713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 2194 | Open in IMG/M |
| 3300031792|Ga0318529_10081858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 1438 | Open in IMG/M |
| 3300031792|Ga0318529_10574862 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 523 | Open in IMG/M |
| 3300031796|Ga0318576_10145185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1105 | Open in IMG/M |
| 3300031798|Ga0318523_10219312 | Not Available | 950 | Open in IMG/M |
| 3300031819|Ga0318568_10296405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 1004 | Open in IMG/M |
| 3300031819|Ga0318568_10553291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 717 | Open in IMG/M |
| 3300031821|Ga0318567_10211877 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 1083 | Open in IMG/M |
| 3300031821|Ga0318567_10586853 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 633 | Open in IMG/M |
| 3300031831|Ga0318564_10040257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Kitasatospora → unclassified Kitasatospora → Kitasatospora sp. MBT63 | 2017 | Open in IMG/M |
| 3300031833|Ga0310917_10654913 | Not Available | 712 | Open in IMG/M |
| 3300031835|Ga0318517_10500349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 547 | Open in IMG/M |
| 3300031859|Ga0318527_10252184 | Not Available | 750 | Open in IMG/M |
| 3300031860|Ga0318495_10043486 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1982 | Open in IMG/M |
| 3300031879|Ga0306919_11194460 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 578 | Open in IMG/M |
| 3300031880|Ga0318544_10384305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 546 | Open in IMG/M |
| 3300031890|Ga0306925_10122357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2785 | Open in IMG/M |
| 3300031941|Ga0310912_10607159 | Not Available | 851 | Open in IMG/M |
| 3300031941|Ga0310912_11209511 | Not Available | 575 | Open in IMG/M |
| 3300031954|Ga0306926_10114307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Kitasatospora | 3321 | Open in IMG/M |
| 3300031981|Ga0318531_10499887 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 551 | Open in IMG/M |
| 3300032008|Ga0318562_10664853 | Not Available | 600 | Open in IMG/M |
| 3300032041|Ga0318549_10035909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Kitasatospora → unclassified Kitasatospora → Kitasatospora sp. MBT63 | 1981 | Open in IMG/M |
| 3300032042|Ga0318545_10259156 | Not Available | 625 | Open in IMG/M |
| 3300032043|Ga0318556_10033976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2391 | Open in IMG/M |
| 3300032064|Ga0318510_10014554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2385 | Open in IMG/M |
| 3300032064|Ga0318510_10368995 | Not Available | 607 | Open in IMG/M |
| 3300032065|Ga0318513_10577240 | Not Available | 550 | Open in IMG/M |
| 3300032066|Ga0318514_10732512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 526 | Open in IMG/M |
| 3300032067|Ga0318524_10747387 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 516 | Open in IMG/M |
| 3300032076|Ga0306924_12426393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 528 | Open in IMG/M |
| 3300032205|Ga0307472_101616912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 637 | Open in IMG/M |
| 3300032515|Ga0348332_13661421 | Not Available | 747 | Open in IMG/M |
| 3300032782|Ga0335082_10359668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Kitasatospora | 1322 | Open in IMG/M |
| 3300032895|Ga0335074_11514118 | Not Available | 532 | Open in IMG/M |
| 3300032898|Ga0335072_10744602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 949 | Open in IMG/M |
| 3300032955|Ga0335076_10112888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2643 | Open in IMG/M |
| 3300033134|Ga0335073_10544528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Kitasatospora | 1312 | Open in IMG/M |
| 3300034819|Ga0373958_0012582 | Not Available | 1450 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 49.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.11% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.65% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.65% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.65% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.65% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.92% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.19% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.19% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.46% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.46% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.46% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.46% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.46% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.46% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.46% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.46% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.73% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.73% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.73% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.73% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.73% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.73% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.73% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.73% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.73% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.73% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.73% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.73% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.73% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559006 | Grass soil microbial communities from Rothamsted Park, UK - FI (heavy metals 2g/kg) assembled | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005169 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Host-Associated | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028742 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FI_00553930 | 2166559006 | Grass Soil | TQVAVTPGISENGYVQVTPVTAGKLAAGDRVVVSG |
| JGIcombinedJ51221_102278242 | 3300003505 | Forest Soil | ASGTSYVTVVGAHGIQTDVPVTPGISENGRVQVTPVHSGALATGGRVVVSG* |
| Ga0062595_1018851032 | 3300004479 | Soil | GAHGKQTEVTVTPGISENGFVQVTPAKSGALAAGNRVVVSG* |
| Ga0062388_1026874801 | 3300004635 | Bog Forest Soil | VAAIVTTASGTSYVTVAGAHGKQADVAVTPGISENGYVQVTPAKPGALAAGAHVTVSG* |
| Ga0066810_101385281 | 3300005169 | Soil | GAHGKQADVAVTPGISENGYVQVTPAKPGALAAGDHVVVSG* |
| Ga0070711_1015243752 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VVGAHGKQTEVTVTPGISENGFVQVTTAKSGALAAGNRVVVSG* |
| Ga0070764_104802172 | 3300005712 | Soil | TTASGTSYVTVAGPHGRQTQVPVTPGISENGYVQVTPVKAGRLAAGDSVVVSG* |
| Ga0066903_1022570983 | 3300005764 | Tropical Forest Soil | GKQTQVPVTPGISENGYVQVTAAKTGALAAGDSVVVSG* |
| Ga0066903_1031445232 | 3300005764 | Tropical Forest Soil | SGTSYVTVARADGKQHQVPVTPGISENGYVQVTPVRGGKLAVGDSVVVSG* |
| Ga0070717_112228172 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VVGAHGKKRQVAVTPGISENGYVQVSPVTSGALAVGDHVVVSG* |
| Ga0075028_1007870111 | 3300006050 | Watersheds | QRRVAVTAGISENGYVQVNASSPVTSGALAAGDRVVVSG* |
| Ga0079222_102720801 | 3300006755 | Agricultural Soil | VTTASGTSHVSVVGAHGKQTEVTVTPGISENGFVQVTPAKSGALAAGNRVVVSG* |
| Ga0079220_107674081 | 3300006806 | Agricultural Soil | KKRQVAVTPGISENGYVQVTPVTSGALAAGDRVVVGG* |
| Ga0075434_1020835442 | 3300006871 | Populus Rhizosphere | GGKQKQVAVTPGISENGYVQVTPVKSGTLAAGDSVVVSG* |
| Ga0075426_100753414 | 3300006903 | Populus Rhizosphere | VVGAHGKQTEVTVTPGISENGFVQVTPAKSGALAGGNRVVVSG* |
| Ga0099795_101895432 | 3300007788 | Vadose Zone Soil | GAHAKKRQVAVTPGISENGYVQVTPVTSGALAASDRVVVSG* |
| Ga0105242_110537491 | 3300009176 | Miscanthus Rhizosphere | IVTTASGTSHVTVVGAHGKQTEVTVTPGISENGFVQVTPAKSGALAAGNRVVVSG* |
| Ga0123356_121874622 | 3300010049 | Termite Gut | VTTGSGTSYVAVAGADGKQTQVAVTPGISENGYVQVAPAHGGKLAVGDRVVVSG* |
| Ga0134070_103575851 | 3300010301 | Grasslands Soil | SSVTVVGAHAKKRQVAVTPGISENGYVQVTPVTSGALAAGDRVVVSG* |
| Ga0126376_105909053 | 3300010359 | Tropical Forest Soil | ATDVTVVGAHGKQTEVAVTPGISENGYVQVTPATPGALKAGDAVVVSG* |
| Ga0126378_113092471 | 3300010361 | Tropical Forest Soil | TTASGTSYVTVAGAHGKQTQVPVTPGISENGYVQVTPVKAGKLAAGDSVVVSG* |
| Ga0126378_133965351 | 3300010361 | Tropical Forest Soil | TEITVTPGISQNGYVQVTPSASGALAAGDRVVVSG* |
| Ga0126379_100089781 | 3300010366 | Tropical Forest Soil | GAHGKQTQVPVTPGISENGYVQVTPATPGALKAGDAVVVSG* |
| Ga0134128_101050264 | 3300010373 | Terrestrial Soil | AIVTTASGTSHVTVMGAHGKQTEVTVTPGISENGFVQVTSAKSGALAAGNRVVVSG* |
| Ga0105239_114948521 | 3300010375 | Corn Rhizosphere | KQTEVTVTPGISDNGFVQVTSAKSGALAAGNRVVVSG* |
| Ga0126381_1014393333 | 3300010376 | Tropical Forest Soil | TSYVTVASAHGKQTQVPVTPGISENGYVQVTPVHPGALAAGDHVVVSG* |
| Ga0134124_121226542 | 3300010397 | Terrestrial Soil | TTAAGTSSVTVVSAHGQQKRVPVTPGISENGYVQVTPSGPVTSGALAAGDRVVVSG* |
| Ga0126361_111644221 | 3300010876 | Boreal Forest Soil | KQTEVAVTPGISENGYVQVTPVTAGALAAGDRVAVSG* |
| Ga0137380_114702821 | 3300012206 | Vadose Zone Soil | VVGADGKHRQVAVTPGISENGYVQVTPVTSGALAAGDHVVVSG* |
| Ga0137387_106903471 | 3300012349 | Vadose Zone Soil | VTVAGAHGKPTQIAVTPGISENGYVQVTPVTAGKLAAGDRVVVSG* |
| Ga0137384_102453541 | 3300012357 | Vadose Zone Soil | RKVAVTPGISENGYVQVTPVTSRAFAAGDRVVVSG* |
| Ga0137398_100225981 | 3300012683 | Vadose Zone Soil | VVGAHGKQRRVAVTAGISENGYVQVNPSSPVTSGALAAGDRVVVSG* |
| Ga0182033_109749021 | 3300016319 | Soil | QTQVTVMPGISENGYVQVTPAAAGTLARGDRVVVSG |
| Ga0182040_104746421 | 3300016387 | Soil | VSVVGVHRKQTQVPVTPGTTENGYVQVSPVTAGALKAGDDVAVSG |
| Ga0187802_101343163 | 3300017822 | Freshwater Sediment | GKQTQVPVTPGISENGYVQVTPATPGALTTGDNVVVSG |
| Ga0187814_103922211 | 3300017932 | Freshwater Sediment | RGKQTQVPVTPGISENGYVQVTAGALAAGDRVAVSG |
| Ga0187879_108247761 | 3300017946 | Peatland | TGTSYVTVVGAHGTKSEVPVTPGITENGYVQVTPVAAGALSACDRVAVSG |
| Ga0187805_105212242 | 3300018007 | Freshwater Sediment | SGATYVTVAGPHGTHEVRVTPGLSENGYVQVTLATSGSLAAGDRVVVSG |
| Ga0187883_100732521 | 3300018037 | Peatland | TRIPVTPGISENGYVQVTPVTPGALAADDHVVVSG |
| Ga0193729_10633001 | 3300019887 | Soil | TVVAAGGKKTNVPVTPGLSENGYVQVTPVTAGALAAGDNVVVSG |
| Ga0210399_107397952 | 3300020581 | Soil | ASGTSDVTVVGAHGKQTEVPVTPGISENGYVQVTPVTPGALADGDRVAVSG |
| Ga0210395_101259751 | 3300020582 | Soil | TASGTSDVTVVGAHGKQTEVPVTPGISENGYVQVTPVTPGALAAGDHVAVSG |
| Ga0210401_108990002 | 3300020583 | Soil | TEVPVTPGISENGYVQVTPVTPGALAAGDRVAVSG |
| Ga0210404_100532841 | 3300021088 | Soil | TEVAVTPGISENGYVQVTPVTAGALAAGDHVAVSG |
| Ga0210400_107735881 | 3300021170 | Soil | AGTSYVTVVGAGHKQAQVPVTPGISENGYVQVTPATPGSLSAGQNVVVSG |
| Ga0210405_101776113 | 3300021171 | Soil | SGTSYVAVVGAHGKQTQVPVAPGISENGYVQVTPVTTGALAAGDHVAVSG |
| Ga0210405_108889341 | 3300021171 | Soil | AHGKQTDVPVTPGISENGYVQVTPKSSGALVAGDRVVVSG |
| Ga0210396_100906281 | 3300021180 | Soil | VATASGTSFVTVVGAHGKQTQVPVTPGISENGYVQVTPVTPGALKAGQNVVVSGS |
| Ga0210388_110542651 | 3300021181 | Soil | YVTEVGAAGKQAQVAVTPGISENGYVQVTPVRGGKLAAGDSVVVSG |
| Ga0210393_114063571 | 3300021401 | Soil | IVTTASGTSDVTVVGAHGKQTEVAVTPGISENGYVQVTPVTAGALTAGDRVAVSG |
| Ga0210393_114540902 | 3300021401 | Soil | DGKQTQVPVTPGISENGYVQVTAAAGHKLAAGDSVVVSG |
| Ga0210385_103403443 | 3300021402 | Soil | AHGKQTEVPVTPGISENGYVQVTPVTPGALAAGDRVAVSG |
| Ga0210397_100370044 | 3300021403 | Soil | ASGTSYVTVAGPHGRQTQVPVTPGISENGYVQVTPVKAGQLAAGDSVVVSG |
| Ga0210397_104194563 | 3300021403 | Soil | TQVPVTPGISENGYVQVTPAAGHKLTAGDSVVVSG |
| Ga0210389_108521991 | 3300021404 | Soil | VTMVGVHGKQTHVPVTPGISENGYVQVTPKSSGALAARDRVVVSG |
| Ga0210386_110953422 | 3300021406 | Soil | SGTSDVAVMGAHGKQTEVPVTPGISENGYVQVTPVTPGALAAGDRVAVSG |
| Ga0210386_116411081 | 3300021406 | Soil | AHGKQTEVAVTPGISENGYVQVTPVTAGALAAGDRVAVSG |
| Ga0210394_106788412 | 3300021420 | Soil | SDVAVVGAHGKQTEVPVTPGISENGYVQVTPVTPGALAAGDRVAVSG |
| Ga0210398_111368182 | 3300021477 | Soil | GKQAQVAVTPGIFENGYVQVTPVRGGKLAAGDSVVVSG |
| Ga0210402_108360141 | 3300021478 | Soil | HGKKRQIPVTPGISENGYVQVTPSGPVTSGALAAGDRVVVSG |
| Ga0207692_103729261 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | VPVAAIVTTASGTSHVTVVGAHGKQTEVTVTPGISENGFVQVTTAKSGALAAGNRVVVSG |
| Ga0207710_102440812 | 3300025900 | Switchgrass Rhizosphere | HGQQKRVPVTPGISENGYVQVTPVTSGALAAGDRVVVSG |
| Ga0207700_114393011 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VTVAGAAGRQTQVAVTPGISENGYVQVTPVRGGRLTAGDSVVVSG |
| Ga0207664_102006693 | 3300025929 | Agricultural Soil | VTLAGARGRQAQVPVTPGLSENGFVQVTPAKPGALAAGDRVVVSG |
| Ga0207686_116055711 | 3300025934 | Miscanthus Rhizosphere | GQQKRVPVTPGISENGYVQVTPVTSGALAAGDRVVVSG |
| Ga0207678_104849351 | 3300026067 | Corn Rhizosphere | TVMGAHGKQTEVTVTPGISENGFVQVTPAKSGALAAGNRVVVSG |
| Ga0209116_10321881 | 3300027590 | Forest Soil | SYVTVVGAHGIQTDVPVTPGISENGHVQVTPVRSGALAAGDHVVVSG |
| Ga0209274_100541581 | 3300027853 | Soil | HGKQTQVPVTPGISENGYVQVTPVTAGALVAGDPVVVSG |
| Ga0209693_103751932 | 3300027855 | Soil | IVTTASGTSYVTVAGPHGRQTQVPVTPGISENGYVQVTPVKAGQLAAGDSVVVSG |
| Ga0209166_104539131 | 3300027857 | Surface Soil | TASGTSEVTVVGAHGKQTQVAVTPGISENGYVQVTPVTAGALVAGERVAVSG |
| Ga0209275_101854633 | 3300027884 | Soil | YVTVVGAHGKQTEISVTPGISENGYVQVTPVTAGALAAGDHVAVSG |
| Ga0302220_101721471 | 3300028742 | Palsa | DGKLTQVPVTPGISENGYVQVTPVKAGKLVAGDSVVVSG |
| Ga0308309_110748481 | 3300028906 | Soil | SGTSYVTVAGADGKQTQVPVTPGISENGYVQVTPAAGHKLTVGDSVVVSG |
| Ga0311357_100650575 | 3300030524 | Palsa | TQVPVTPGISDNGYVQVTPVMPGALKAGGRVVVSG |
| Ga0318534_100599741 | 3300031544 | Soil | SYVTVAGAHGKQTQVPVTPGISENGYVQVTPVTAGKLAAGDSVVVTG |
| Ga0318534_103288552 | 3300031544 | Soil | VHGQQTQVPVTPGISENGYVQVTPAHPGVLAAGDHVVVSG |
| Ga0318571_103088542 | 3300031549 | Soil | LGAHGKQTEVPVTPGISENGYVQVTPVKSGALAAGDRVVVSG |
| Ga0318571_104509531 | 3300031549 | Soil | TQVPVTPGISENGYVQVTSVTAGKLAAGDSVVVTG |
| Ga0318528_107425012 | 3300031561 | Soil | SGTSYVTVAGAQGKQTQVPVTPGISENGYVQVTPVTAGKLAAGDSVVVTG |
| Ga0318573_100323494 | 3300031564 | Soil | VTVARADGKQTQVPVTPGISENGYVQVTPVRGGKLAVGDSVVVSG |
| Ga0318573_107964852 | 3300031564 | Soil | VAAIVTTASGASDVTVVGAHGKQTKVAVTPGISENGYVQVIPSSPVHSGALAAGDRVVVS |
| Ga0310915_112573131 | 3300031573 | Soil | SYVTVARADGKQTQVPVTPGISENGYVQVTPVRGGKLAVGDTVVVSG |
| Ga0318555_102339111 | 3300031640 | Soil | HVTVVGAHSKQTDVTVTPGISENGYVQVTPAKSGALAAGDHVVVSG |
| Ga0318574_104946831 | 3300031680 | Soil | AIVTTGSGTSYVTVAGAHGKQTQVPVTPGISENGYVQVTPVIAGKLAAGDSVVVTG |
| Ga0318560_103413282 | 3300031682 | Soil | KQTDVTVTPGISENGYVQVTPAKSGALAAGDHVVVSG |
| Ga0307476_102133253 | 3300031715 | Hardwood Forest Soil | GTSDVAVVGAHGKQTEVPVTPGISENGYVQVTPVTPGALAAGDRVAVSG |
| Ga0307469_115759042 | 3300031720 | Hardwood Forest Soil | VAAIVTTASGTSHVSVVGAHGKQTEVTVTPGISENGFVQVTPAKSGALAAGNRVVVSG |
| Ga0318500_102675721 | 3300031724 | Soil | SGTSYVTVVRARGRQTQVPVTPGISENGYVQVTPVKPGALARGDRVVVSG |
| Ga0318501_106282331 | 3300031736 | Soil | PVAAIVTTGSGTSYVTVAGAQGKQTQVPVTPGISENGYVQVTSVTAGKLAAGDSVVVTG |
| Ga0306918_107966212 | 3300031744 | Soil | GTSYVTVVGAHGKRTDVPVTPGISENGYVQVTPVKSGALAAGDHVVVSG |
| Ga0318502_103027891 | 3300031747 | Soil | TQVPVTPGISENGYVQVTPVTAGKLAAGDSVVVTG |
| Ga0318502_103594352 | 3300031747 | Soil | SYVTVVGAHGKRTDVPVTPGISENGYVQVTPVKSGALAAGDHVVVSG |
| Ga0318492_104792552 | 3300031748 | Soil | SYVTVVGAHGKRTAVPVTPGISENGYVQVTPVKSGALAAGDHVVVSG |
| Ga0318494_101880173 | 3300031751 | Soil | TVVRARGRQTQVPVTPGISENGYVQVTPVKPGALARGDRVVVSG |
| Ga0318521_100100921 | 3300031770 | Soil | AHGKQTEVPVTPGISENGYVQVTPVKSGALAAGDRVVVSG |
| Ga0318498_102122632 | 3300031778 | Soil | SYVTVVRARGRQTQVPVTPGISENGYVQVTPVKPGALARGDRVVVSG |
| Ga0318498_102749311 | 3300031778 | Soil | GKQTGVPVTPGISENGYVQVTPARSGALAAGDHVVVSG |
| Ga0318566_104627101 | 3300031779 | Soil | VHGKHTRVPVTPGISENGYVQVTPVTAGKLAAGDRVVVSG |
| Ga0318529_100317134 | 3300031792 | Soil | TASGTSYVTVARADGKQTQVPVTPGISENGYVQVTPVRGGKLAVGDSVVVSG |
| Ga0318529_100818581 | 3300031792 | Soil | VAGAQGKQTQVPVTPGISENGYVQVTPVTAGKLAAGDSVVVTG |
| Ga0318529_105748621 | 3300031792 | Soil | AQVPVTPGIAENGYVQVTPAAGGRLATGDRVVVSG |
| Ga0318576_101451851 | 3300031796 | Soil | GTSYVTVAGAQGKQTQVPVTPGISENGYVQVTPVTAGKLAAGDSVVVTG |
| Ga0318523_102193121 | 3300031798 | Soil | TVVGAHGKQTQVAVTPGISENGYVQVTPVHSGALAAGDRVVVSG |
| Ga0318568_102964053 | 3300031819 | Soil | TVAGAHGKQTNVPVTPGISENGYVQVTPVRSGALAAGDHVVVSG |
| Ga0318568_105532912 | 3300031819 | Soil | TASGTSHVTVVGAHGRQTQVTVMPGISENGYVQVTPAAAGTLARGDRVVVSG |
| Ga0318567_102118773 | 3300031821 | Soil | VTAARADGKQTQVVVTPGISENGYVQVTPVRGGKLTVGDSVVVSG |
| Ga0318567_105868531 | 3300031821 | Soil | TVVGAHSKQTDVTVTPGISENGYVQVTPAKSGALAAGDHVVVSG |
| Ga0318564_100402571 | 3300031831 | Soil | VRARGRQTQVPVTPGISENGYVQVTPVKPGALARGDRVVVSG |
| Ga0310917_106549132 | 3300031833 | Soil | HGKQTQVAVTPGISENGYVQVTPVHSGALAAGDRVVVSG |
| Ga0318517_105003491 | 3300031835 | Soil | AIVTTGSGTSYVTVAGAHGKQTQVPVTPGISENGYVQVTPVTAGKLAAGDSVVVTG |
| Ga0318527_102521841 | 3300031859 | Soil | SGTSHVTVVGAHGRQTQVTVMPGISENGYVQVTPATAGTLARGDRVVVSG |
| Ga0318495_100434861 | 3300031860 | Soil | SYVTVAGAHGKQTQVPVTPGISENGYVQVTPVIAGKLAAGDSVVVTG |
| Ga0306919_111944602 | 3300031879 | Soil | AHGRQTQVTVMPGISENGYVQVTPAAAGTLARGDRVVVSG |
| Ga0318544_103843051 | 3300031880 | Soil | SYVTVAGAQGKQTQVPVTPGISENGYVQVTPAKSGALAAGDHVVVSG |
| Ga0306925_101223571 | 3300031890 | Soil | GAHGKQTQVPVTPGISENGYVQVTPVTAGKLAAGDSVVVTG |
| Ga0310912_106071591 | 3300031941 | Soil | GSGTSYVTVVGADSKQTQVPVTPGISENGYVQVTLVHAGQLAAGDSVVVSG |
| Ga0310912_112095111 | 3300031941 | Soil | AHGKQTQVAVTPGIAENGYVQVTPVTSGALAAGDRVVVSG |
| Ga0306926_101143075 | 3300031954 | Soil | QTEIPVTPGISENGYVQVTPVKPGALARGDRVVVSG |
| Ga0318531_104998872 | 3300031981 | Soil | GAHGKQTQVPVTPGISENGYVQVTPVIAGKLAAGDSVVVTG |
| Ga0318562_106648531 | 3300032008 | Soil | TDVPVTPGISENGYVQVTPVKSGALAAGDHVVVSG |
| Ga0318549_100359091 | 3300032041 | Soil | YVTVVRARGRQTQVPVTPGISENGYVQVTPVKPGALARGDRVVVSG |
| Ga0318545_102591562 | 3300032042 | Soil | VLGAHGKQTEVPVTPGISENGYVQVTPVKSGALAAGDRVVVSG |
| Ga0318556_100339764 | 3300032043 | Soil | VAGAHGKQTQVPVTPGISENGYVQVTPVTAGKLAAGDSVVVTG |
| Ga0318510_100145544 | 3300032064 | Soil | GKQTQVAVTPGISENGYVQVTPVRGGKLAVGDSVVVSG |
| Ga0318510_103689952 | 3300032064 | Soil | GEQTQVAVTPGISENGYIQVTPVRPGTLAAGGRVVVSG |
| Ga0318513_105772402 | 3300032065 | Soil | VSTASGTSDLTVAGAHGEQTQVAVTPGISENGYIQVTPVRPGTLAAGGRVVVSG |
| Ga0318514_107325121 | 3300032066 | Soil | TVVGAHGKHTQVAVTPGISENGFVQVTPAHGGKLIAGDSVVVSG |
| Ga0318524_107473872 | 3300032067 | Soil | IVTTGSGTSYVTVAGAQGKQTQVPVTPGISENGYVQVTPVTAGKLAAGDSVVVTG |
| Ga0306924_124263931 | 3300032076 | Soil | KQTQVPVTPGISENGYVQVTPVASGALAAGARVVVSG |
| Ga0307472_1016169122 | 3300032205 | Hardwood Forest Soil | AHGKQRRVPVTAGISENGYVQVNPSSPVTSGALAAGDRVVVSG |
| Ga0348332_136614211 | 3300032515 | Plant Litter | HGKQTNVPVTPGISEDGYVQVTPKPSGALAAGDRVVVSG |
| Ga0335082_103596681 | 3300032782 | Soil | QTQVAVTPGIAENGYVQVTPVRSGALAAGDRVVVSG |
| Ga0335074_115141181 | 3300032895 | Soil | KQTTVPVTPGISENGYVQVTPAKPGTLAAGDRVAVSG |
| Ga0335072_107446021 | 3300032898 | Soil | VAAIVTTAAGTSFVTVVGADRKQAQVPVTPGISENGYVQVTPVTPGALSAGQNVVVSS |
| Ga0335076_101128881 | 3300032955 | Soil | TQVAVTPGISENGYVQVTAVHSGALAAGDRVVVSG |
| Ga0335073_105445283 | 3300033134 | Soil | VTVVGAHGAQADVVVTPGIAENGYVQVTPAHAGALAAGDRVVVSG |
| Ga0373958_0012582_1335_1448 | 3300034819 | Rhizosphere Soil | KQTEVTVTPGISENGFVQVTTAKSGALAAGNRVVVSG |
| ⦗Top⦘ |