| Basic Information | |
|---|---|
| Family ID | F056454 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 137 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MKSLRRIRRDKKGINTILAALLMVVIVVVAAVMVYAWSTGLL |
| Number of Associated Samples | 109 |
| Number of Associated Scaffolds | 137 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Archaea |
| % of genes with valid RBS motifs | 97.01 % |
| % of genes near scaffold ends (potentially truncated) | 97.08 % |
| % of genes from short scaffolds (< 2000 bps) | 92.70 % |
| Associated GOLD sequencing projects | 102 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Archaea (93.431 % of family members) |
| NCBI Taxonomy ID | 2157 |
| Taxonomy | All Organisms → cellular organisms → Archaea |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil (37.956 % of family members) |
| Environment Ontology (ENVO) | Unclassified (59.124 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (71.533 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.29% β-sheet: 0.00% Coil/Unstructured: 45.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 137 Family Scaffolds |
|---|---|---|
| PF11495 | Regulator_TrmB | 4.38 |
| PF06847 | Arc_PepC_II | 1.46 |
| PF00623 | RNA_pol_Rpb1_2 | 0.73 |
| PF14321 | DUF4382 | 0.73 |
| PF01037 | AsnC_trans_reg | 0.73 |
| PF00296 | Bac_luciferase | 0.73 |
| COG ID | Name | Functional Category | % Frequency in 137 Family Scaffolds |
|---|---|---|---|
| COG0086 | DNA-directed RNA polymerase, beta' subunit/160 kD subunit | Transcription [K] | 0.73 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.73 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.16 % |
| Unclassified | root | N/A | 5.84 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002561|JGI25384J37096_10237702 | All Organisms → cellular organisms → Archaea → TACK group | 532 | Open in IMG/M |
| 3300002562|JGI25382J37095_10174460 | All Organisms → cellular organisms → Archaea | 668 | Open in IMG/M |
| 3300002911|JGI25390J43892_10000883 | All Organisms → cellular organisms → Archaea | 5990 | Open in IMG/M |
| 3300002912|JGI25386J43895_10027496 | All Organisms → cellular organisms → Archaea | 1676 | Open in IMG/M |
| 3300002912|JGI25386J43895_10196451 | All Organisms → cellular organisms → Archaea | 506 | Open in IMG/M |
| 3300005171|Ga0066677_10545917 | All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Thermoproteales → Thermoproteaceae → Vulcanisaeta → Vulcanisaeta distributa | 663 | Open in IMG/M |
| 3300005176|Ga0066679_10703301 | All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Thermoproteales → Thermoproteaceae → Vulcanisaeta | 654 | Open in IMG/M |
| 3300005179|Ga0066684_10332073 | All Organisms → cellular organisms → Archaea | 1014 | Open in IMG/M |
| 3300005181|Ga0066678_10719283 | All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei | 664 | Open in IMG/M |
| 3300005186|Ga0066676_10026264 | All Organisms → cellular organisms → Archaea | 3111 | Open in IMG/M |
| 3300005186|Ga0066676_10644478 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 719 | Open in IMG/M |
| 3300005187|Ga0066675_11390982 | All Organisms → cellular organisms → Archaea | 515 | Open in IMG/M |
| 3300005555|Ga0066692_10544592 | All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Thermoproteales → Thermoproteaceae → Vulcanisaeta → Vulcanisaeta distributa | 734 | Open in IMG/M |
| 3300005555|Ga0066692_10851439 | All Organisms → cellular organisms → Archaea | 559 | Open in IMG/M |
| 3300005559|Ga0066700_10042603 | All Organisms → cellular organisms → Archaea | 2744 | Open in IMG/M |
| 3300005575|Ga0066702_10483711 | All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Thermoproteales → Thermoproteaceae → Vulcanisaeta → Vulcanisaeta distributa | 755 | Open in IMG/M |
| 3300005586|Ga0066691_10607201 | All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Thermoproteales → Thermoproteaceae → Vulcanisaeta → Vulcanisaeta distributa | 650 | Open in IMG/M |
| 3300005764|Ga0066903_102274534 | All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Thermoproteales → Thermoproteaceae | 1047 | Open in IMG/M |
| 3300006032|Ga0066696_10204050 | All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Thermoproteales → Thermoproteaceae → Vulcanisaeta | 1262 | Open in IMG/M |
| 3300006796|Ga0066665_11665728 | All Organisms → cellular organisms → Archaea | 504 | Open in IMG/M |
| 3300006797|Ga0066659_11884269 | Not Available | 507 | Open in IMG/M |
| 3300007255|Ga0099791_10358936 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 699 | Open in IMG/M |
| 3300007255|Ga0099791_10684065 | All Organisms → cellular organisms → Archaea | 504 | Open in IMG/M |
| 3300007258|Ga0099793_10153089 | All Organisms → cellular organisms → Archaea | 1092 | Open in IMG/M |
| 3300007258|Ga0099793_10393656 | All Organisms → cellular organisms → Archaea → TACK group | 680 | Open in IMG/M |
| 3300007265|Ga0099794_10504712 | All Organisms → cellular organisms → Archaea | 637 | Open in IMG/M |
| 3300009038|Ga0099829_11014200 | All Organisms → cellular organisms → Archaea → TACK group | 688 | Open in IMG/M |
| 3300009038|Ga0099829_11476959 | All Organisms → cellular organisms → Archaea | 561 | Open in IMG/M |
| 3300009088|Ga0099830_10789907 | All Organisms → cellular organisms → Archaea → TACK group | 783 | Open in IMG/M |
| 3300009089|Ga0099828_11284275 | All Organisms → cellular organisms → Archaea | 648 | Open in IMG/M |
| 3300009090|Ga0099827_11649213 | Not Available | 559 | Open in IMG/M |
| 3300009090|Ga0099827_11717829 | All Organisms → cellular organisms → Archaea | 547 | Open in IMG/M |
| 3300010068|Ga0127442_118215 | All Organisms → cellular organisms → Archaea | 568 | Open in IMG/M |
| 3300010068|Ga0127442_135291 | All Organisms → cellular organisms → Archaea | 1121 | Open in IMG/M |
| 3300010069|Ga0127467_112583 | All Organisms → cellular organisms → Archaea | 555 | Open in IMG/M |
| 3300010071|Ga0127477_120350 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 783 | Open in IMG/M |
| 3300010073|Ga0127429_103864 | All Organisms → cellular organisms → Archaea | 535 | Open in IMG/M |
| 3300010078|Ga0127487_112706 | All Organisms → cellular organisms → Archaea | 710 | Open in IMG/M |
| 3300010078|Ga0127487_113715 | All Organisms → cellular organisms → Archaea | 625 | Open in IMG/M |
| 3300010084|Ga0127461_1014824 | All Organisms → cellular organisms → Archaea | 651 | Open in IMG/M |
| 3300010085|Ga0127445_1026092 | All Organisms → cellular organisms → Archaea → TACK group | 726 | Open in IMG/M |
| 3300010086|Ga0127496_1094878 | All Organisms → cellular organisms → Archaea → TACK group | 551 | Open in IMG/M |
| 3300010087|Ga0127492_1092105 | All Organisms → cellular organisms → Archaea | 1014 | Open in IMG/M |
| 3300010088|Ga0127476_1004015 | All Organisms → cellular organisms → Archaea | 578 | Open in IMG/M |
| 3300010091|Ga0127485_1032618 | All Organisms → cellular organisms → Archaea | 622 | Open in IMG/M |
| 3300010091|Ga0127485_1083763 | All Organisms → cellular organisms → Archaea | 560 | Open in IMG/M |
| 3300010092|Ga0127468_1060396 | All Organisms → cellular organisms → Archaea | 551 | Open in IMG/M |
| 3300010093|Ga0127490_1073602 | All Organisms → cellular organisms → Archaea → TACK group | 679 | Open in IMG/M |
| 3300010102|Ga0127453_1022210 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1017 | Open in IMG/M |
| 3300010102|Ga0127453_1044919 | All Organisms → cellular organisms → Archaea | 564 | Open in IMG/M |
| 3300010103|Ga0127500_1054179 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1082 | Open in IMG/M |
| 3300010103|Ga0127500_1084443 | All Organisms → cellular organisms → Archaea → TACK group | 586 | Open in IMG/M |
| 3300010107|Ga0127494_1086873 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 708 | Open in IMG/M |
| 3300010108|Ga0127474_1140379 | All Organisms → cellular organisms → Archaea | 744 | Open in IMG/M |
| 3300010109|Ga0127497_1144892 | All Organisms → cellular organisms → Archaea | 578 | Open in IMG/M |
| 3300010112|Ga0127458_1128431 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 762 | Open in IMG/M |
| 3300010112|Ga0127458_1149376 | All Organisms → cellular organisms → Archaea | 536 | Open in IMG/M |
| 3300010113|Ga0127444_1155534 | All Organisms → cellular organisms → Archaea | 692 | Open in IMG/M |
| 3300010115|Ga0127495_1046889 | All Organisms → cellular organisms → Archaea | 548 | Open in IMG/M |
| 3300010117|Ga0127449_1024899 | All Organisms → cellular organisms → Archaea | 595 | Open in IMG/M |
| 3300010122|Ga0127488_1134875 | All Organisms → cellular organisms → Archaea | 627 | Open in IMG/M |
| 3300010124|Ga0127498_1152268 | All Organisms → cellular organisms → Archaea → TACK group | 546 | Open in IMG/M |
| 3300010127|Ga0127489_1168445 | All Organisms → cellular organisms → Archaea | 695 | Open in IMG/M |
| 3300010130|Ga0127493_1122714 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 696 | Open in IMG/M |
| 3300010132|Ga0127455_1121641 | All Organisms → cellular organisms → Archaea | 979 | Open in IMG/M |
| 3300010140|Ga0127456_1009932 | All Organisms → cellular organisms → Archaea | 867 | Open in IMG/M |
| 3300010140|Ga0127456_1048011 | All Organisms → cellular organisms → Archaea | 568 | Open in IMG/M |
| 3300010142|Ga0127483_1220625 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1001 | Open in IMG/M |
| 3300010301|Ga0134070_10010641 | All Organisms → cellular organisms → Archaea | 2898 | Open in IMG/M |
| 3300010304|Ga0134088_10334795 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 734 | Open in IMG/M |
| 3300010398|Ga0126383_11961483 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300011120|Ga0150983_10708759 | All Organisms → cellular organisms → Archaea → TACK group | 629 | Open in IMG/M |
| 3300011120|Ga0150983_11628393 | All Organisms → cellular organisms → Archaea | 523 | Open in IMG/M |
| 3300011120|Ga0150983_14687883 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 703 | Open in IMG/M |
| 3300011269|Ga0137392_10216452 | All Organisms → cellular organisms → Archaea | 1570 | Open in IMG/M |
| 3300012096|Ga0137389_10993317 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 719 | Open in IMG/M |
| 3300012189|Ga0137388_10883116 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 827 | Open in IMG/M |
| 3300012199|Ga0137383_10519267 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 872 | Open in IMG/M |
| 3300012199|Ga0137383_10693008 | All Organisms → cellular organisms → Archaea | 744 | Open in IMG/M |
| 3300012200|Ga0137382_10757445 | All Organisms → cellular organisms → Archaea | 697 | Open in IMG/M |
| 3300012201|Ga0137365_11140665 | All Organisms → cellular organisms → Archaea → TACK group | 560 | Open in IMG/M |
| 3300012202|Ga0137363_10612121 | All Organisms → cellular organisms → Archaea | 920 | Open in IMG/M |
| 3300012205|Ga0137362_10512295 | All Organisms → cellular organisms → Archaea | 1037 | Open in IMG/M |
| 3300012206|Ga0137380_10974767 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 726 | Open in IMG/M |
| 3300012207|Ga0137381_11699157 | All Organisms → cellular organisms → Archaea → TACK group | 521 | Open in IMG/M |
| 3300012208|Ga0137376_10390597 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1208 | Open in IMG/M |
| 3300012209|Ga0137379_10825317 | Not Available | 832 | Open in IMG/M |
| 3300012224|Ga0134028_1093929 | All Organisms → cellular organisms → Archaea | 610 | Open in IMG/M |
| 3300012224|Ga0134028_1215042 | All Organisms → cellular organisms → Archaea | 543 | Open in IMG/M |
| 3300012353|Ga0137367_10562712 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 800 | Open in IMG/M |
| 3300012353|Ga0137367_10859584 | All Organisms → cellular organisms → Archaea → TACK group | 627 | Open in IMG/M |
| 3300012356|Ga0137371_10400904 | All Organisms → cellular organisms → Archaea | 1064 | Open in IMG/M |
| 3300012359|Ga0137385_10103923 | All Organisms → cellular organisms → Archaea | 2516 | Open in IMG/M |
| 3300012359|Ga0137385_10408244 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1157 | Open in IMG/M |
| 3300012374|Ga0134039_1162712 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 733 | Open in IMG/M |
| 3300012375|Ga0134034_1060783 | All Organisms → cellular organisms → Archaea | 694 | Open in IMG/M |
| 3300012379|Ga0134058_1111148 | All Organisms → cellular organisms → Archaea | 722 | Open in IMG/M |
| 3300012389|Ga0134040_1252195 | All Organisms → cellular organisms → Archaea → TACK group | 513 | Open in IMG/M |
| 3300012405|Ga0134041_1012673 | All Organisms → cellular organisms → Archaea | 544 | Open in IMG/M |
| 3300012410|Ga0134060_1287479 | All Organisms → cellular organisms → Archaea | 582 | Open in IMG/M |
| 3300012410|Ga0134060_1430330 | All Organisms → cellular organisms → Archaea → TACK group | 501 | Open in IMG/M |
| 3300012927|Ga0137416_10444621 | All Organisms → cellular organisms → Archaea | 1107 | Open in IMG/M |
| 3300014150|Ga0134081_10031925 | All Organisms → cellular organisms → Archaea | 1528 | Open in IMG/M |
| 3300014154|Ga0134075_10080899 | All Organisms → cellular organisms → Archaea | 1363 | Open in IMG/M |
| 3300017934|Ga0187803_10374481 | Not Available | 574 | Open in IMG/M |
| 3300018088|Ga0187771_11691661 | All Organisms → cellular organisms → Archaea | 537 | Open in IMG/M |
| 3300018088|Ga0187771_11761826 | All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → unclassified Thermoproteota → Crenarchaeota archaeon 13_1_40CM_2_52_14 | 526 | Open in IMG/M |
| 3300018431|Ga0066655_10638693 | All Organisms → cellular organisms → Archaea | 719 | Open in IMG/M |
| 3300018433|Ga0066667_10987568 | All Organisms → cellular organisms → Archaea | 726 | Open in IMG/M |
| 3300021046|Ga0215015_10173639 | All Organisms → cellular organisms → Archaea | 587 | Open in IMG/M |
| 3300021046|Ga0215015_10356236 | Not Available | 578 | Open in IMG/M |
| 3300021046|Ga0215015_10801286 | All Organisms → cellular organisms → Archaea | 557 | Open in IMG/M |
| 3300021307|Ga0179585_1147774 | All Organisms → cellular organisms → Archaea | 555 | Open in IMG/M |
| 3300022525|Ga0242656_1112002 | All Organisms → cellular organisms → Archaea | 545 | Open in IMG/M |
| 3300022724|Ga0242665_10224594 | All Organisms → cellular organisms → Archaea | 629 | Open in IMG/M |
| 3300026301|Ga0209238_1231278 | All Organisms → cellular organisms → Archaea | 546 | Open in IMG/M |
| 3300026307|Ga0209469_1073121 | All Organisms → cellular organisms → Archaea | 1039 | Open in IMG/M |
| 3300026310|Ga0209239_1110863 | All Organisms → cellular organisms → Archaea | 1151 | Open in IMG/M |
| 3300026313|Ga0209761_1013759 | All Organisms → cellular organisms → Archaea | 5216 | Open in IMG/M |
| 3300026318|Ga0209471_1333342 | All Organisms → cellular organisms → Archaea | 503 | Open in IMG/M |
| 3300026324|Ga0209470_1340513 | All Organisms → cellular organisms → Archaea | 540 | Open in IMG/M |
| 3300026507|Ga0257165_1054579 | All Organisms → cellular organisms → Archaea | 721 | Open in IMG/M |
| 3300026514|Ga0257168_1070968 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 769 | Open in IMG/M |
| 3300026532|Ga0209160_1273488 | All Organisms → cellular organisms → Archaea | 573 | Open in IMG/M |
| 3300026542|Ga0209805_1003769 | All Organisms → cellular organisms → Archaea | 8572 | Open in IMG/M |
| 3300027846|Ga0209180_10515807 | All Organisms → cellular organisms → Archaea | 668 | Open in IMG/M |
| 3300027875|Ga0209283_10854339 | All Organisms → cellular organisms → Archaea | 554 | Open in IMG/M |
| 3300027882|Ga0209590_10765437 | All Organisms → cellular organisms → Archaea | 615 | Open in IMG/M |
| 3300028673|Ga0257175_1044832 | All Organisms → cellular organisms → Archaea | 800 | Open in IMG/M |
| 3300028673|Ga0257175_1065802 | All Organisms → cellular organisms → Archaea | 681 | Open in IMG/M |
| 3300031820|Ga0307473_10189094 | All Organisms → cellular organisms → Archaea | 1212 | Open in IMG/M |
| 3300031820|Ga0307473_10931497 | All Organisms → cellular organisms → Archaea | 629 | Open in IMG/M |
| 3300031962|Ga0307479_10358279 | All Organisms → cellular organisms → Archaea | 1442 | Open in IMG/M |
| 3300032180|Ga0307471_100443003 | All Organisms → cellular organisms → Archaea | 1436 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 37.96% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 24.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 13.87% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 7.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.38% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.19% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.19% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.46% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.73% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.73% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.73% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.73% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300010068 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010069 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010071 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010073 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010078 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010084 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010085 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010086 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010087 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010088 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010091 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010092 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010093 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010099 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010102 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010103 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010107 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010108 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010109 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010112 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010113 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010115 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010117 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010122 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010124 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010127 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010130 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010132 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010140 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010142 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012224 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012374 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012375 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012379 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012389 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012405 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012410 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021307 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022525 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026507 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-B | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25384J37096_102377022 | 3300002561 | Grasslands Soil | MKAIRKYLHDKKGIDTILAALLMVVIVVVASVMVYAWSTGLLGTL |
| JGI25382J37095_101744601 | 3300002562 | Grasslands Soil | MKSLRWVRKDKKGINTILASLLMVVIVVVAAVMVYAWSTGLLSSLLVQNPV |
| JGI25390J43892_100008831 | 3300002911 | Grasslands Soil | MRKIRKITRDKKGIDTILAALLMVVIVVVAAVMVYAWATGLLSALLVQ |
| JGI25386J43895_100274961 | 3300002912 | Grasslands Soil | MRKIRKITRDKKGIDTILAALLMVVIVVVAAVMVYAWSTGLLSALLVQNPV |
| JGI25386J43895_101964512 | 3300002912 | Grasslands Soil | MTSLHRIRRDKKGINTILASLLMVVIVVVAAVMVYAWSTGLLSSLLVQNPVPK |
| Ga0066677_105459172 | 3300005171 | Soil | MKSLRRIRRDRKGINTILASLLMVVIVVVAAVMVYAWSTGLLS |
| Ga0066679_107033011 | 3300005176 | Soil | LKMTSLHKIRRDKKGINTILASLLMVVIVVVAAVMVYAWSTGLLSS |
| Ga0066684_103320731 | 3300005179 | Soil | MRKIRKITRDKKGIDTILAALLMVVIVVVAAVMVYAWSTGLLSSLLVQNP |
| Ga0066678_107192832 | 3300005181 | Soil | MKSLRRIRRDKKAINTILASLLMVVIVVVAAVMVYAWSTG |
| Ga0066676_100262645 | 3300005186 | Soil | MNPVRKYLKSKKGINTILASLLMVVIVVVASVMVYAWSTGLLGTLLV |
| Ga0066676_106444782 | 3300005186 | Soil | MRTLRRYIKERKGINTILASLLMVVIVVVASVMVYAWSTGLLGTLLVQPN |
| Ga0066675_113909821 | 3300005187 | Soil | MKSLRRIRRNKKGINTILASLLMVVIVVVAAVMVYAWSTGLLSS |
| Ga0066692_105445921 | 3300005555 | Soil | MKSLRRIRRDKKGINTILAALLMVVIVVVAAVMVYAWSTG |
| Ga0066692_108514392 | 3300005555 | Soil | MKSLRWVRKDKKGINTILASLLMVVIVVVAAVMVYAWSTGLLSALLVQNPV |
| Ga0066700_100426031 | 3300005559 | Soil | MKSIRKCLNNKKGIDTILAALLMVVIVVVASVMVYAWSTGLLGTLLVH |
| Ga0066702_104837112 | 3300005575 | Soil | MKSLRRIRRDKKGINTILASLLMVVIVVVAAVMVYAWSTGLLS |
| Ga0066691_106072012 | 3300005586 | Soil | MKSLRRIRRDKKGINTILASLLMVVIVVVAAVMVYAWS |
| Ga0066903_1022745343 | 3300005764 | Tropical Forest Soil | MKPIKKLFKNKKGIDTILAALLMVVIVVVASVMVYAWSTGLL |
| Ga0066696_102040503 | 3300006032 | Soil | MKSLRRVRKDKKGINTILASLLMVVIVVVAAVMVYAWSTGLLS |
| Ga0066665_116657281 | 3300006796 | Soil | LTNLHQIRRDKKGIDTILAALLMVVIVVVAAVMVYA |
| Ga0066659_118842691 | 3300006797 | Soil | MKSINRYLKHRKGINTILASLLMVVIVVVASVMVYAWSTG |
| Ga0099791_103589362 | 3300007255 | Vadose Zone Soil | MNPVRKYLKNKKGINTILASLLMVVIVVVASVMVYAWSTGLLGTLLVQPN |
| Ga0099791_106840651 | 3300007255 | Vadose Zone Soil | MKSLRRIRRDKKGINTILAALLMVVIVVVAAVMVYAWST |
| Ga0099793_101530891 | 3300007258 | Vadose Zone Soil | MKSLRRIRRDKKGINTILASLLMVVIVVVAAVMVY |
| Ga0099793_103936562 | 3300007258 | Vadose Zone Soil | MKAIRRYLNDKKGIDTILAALLMVVIVVVASVMVYAWSTG |
| Ga0099794_105047121 | 3300007265 | Vadose Zone Soil | MKSLRRIRRDKKGINTILASLLMVVIVVVAAVMVYAW |
| Ga0099829_110142002 | 3300009038 | Vadose Zone Soil | MNPVRKYLKNKKGINTILASLLMVVIVVVAAVMVYAWSTGLLGTLLVQP |
| Ga0099829_114769591 | 3300009038 | Vadose Zone Soil | MKSPLQIRRDKKGINTILAALLMVVIVVVAAVMVYAWSTGLLSS |
| Ga0099830_107899072 | 3300009088 | Vadose Zone Soil | MKTIKRLFKNKKGIDTILAALLMVVIVVVASVMVY |
| Ga0099828_112842752 | 3300009089 | Vadose Zone Soil | MTSLHKIRRDKKAINTILASLLMVVIVVVAAVMVYAW |
| Ga0099827_116492132 | 3300009090 | Vadose Zone Soil | MKAIRKCLNDKKGIDTILAALLMVVIVVVAAVMVYAWSTGLLGTL |
| Ga0099827_117178291 | 3300009090 | Vadose Zone Soil | VKKLRKIIGNKKGINTILASLLMVVIVVVAAVMVY |
| Ga0127442_1182152 | 3300010068 | Grasslands Soil | MRKITRDKKGIDTILAALLMVVIVVVAAVMVYAWSTGLLSALLVQNPV |
| Ga0127442_1352913 | 3300010068 | Grasslands Soil | MNPFRRYLKNKKGINTILASLLMVVIVVVASVMVYAWSTGLLGTLLVQPNVGKE |
| Ga0127467_1125832 | 3300010069 | Grasslands Soil | MRKITRNKKGIDTILAALLMVVIVVVAAVMVYAWSTGLLS |
| Ga0127477_1203502 | 3300010071 | Grasslands Soil | MNPFRRYLKNKKGINTILASLLMVVIVVVASVMVYAWSTGLLGTLLV |
| Ga0127429_1038642 | 3300010073 | Grasslands Soil | MRKIRKITRDKKGIDTILAALLMVVIVVVAAVMVY |
| Ga0127487_1127061 | 3300010078 | Grasslands Soil | MTSLHKIRRHKIRRDKKGINTILASLLMVVIVVVAAVMVYAWSTGLLSSL |
| Ga0127487_1137152 | 3300010078 | Grasslands Soil | MTSLHKIRRDKKGINTILASLLMVVIVVVAAVMVYAWSTGLLSSL |
| Ga0127461_10148242 | 3300010084 | Grasslands Soil | MKSLRRIRRDKKGINTILAALLMVVIVVVASVMVYAWSTGLLGTLLVT |
| Ga0127445_10260921 | 3300010085 | Grasslands Soil | MKAIRKYLKDKKGIDTILAALLMVVIVVVASVMVYAWSTGLLGTLLVHPTT |
| Ga0127496_10948782 | 3300010086 | Grasslands Soil | MQPIKRLFKNKKGIDTILAALLMVVIVVVASVMVY |
| Ga0127492_10921051 | 3300010087 | Grasslands Soil | MTSLHKIRRDKKGINTILASLLMVVIVVVAAVMVYA |
| Ga0127476_10040152 | 3300010088 | Grasslands Soil | MTSLHKIRRDKKGINTILASLLMVVIVVVAAVMVYAWSTG |
| Ga0127485_10326182 | 3300010091 | Grasslands Soil | MKSLRRIRRNKKGINTILASLLMVVIVVVAAVMVYAWS |
| Ga0127485_10837632 | 3300010091 | Grasslands Soil | MRKIRKITRDKKGIDTILAALLMVVIVVVAAVMVYAWSTGLLSALLVQNPVPKESM |
| Ga0127468_10603962 | 3300010092 | Grasslands Soil | MRKITRNKKGIDTILAALLMVVIVVVAAVMVYAWSTGLL |
| Ga0127490_10736022 | 3300010093 | Grasslands Soil | MKAIRKYLKDKKGIDTILAALLMVVIVVVASVMVYAWSTGLLGTLLV |
| Ga0127450_10425763 | 3300010099 | Grasslands Soil | MTSLHKIRRHKIRRDKKGINTILASLLMVVIVVVAAVMVY |
| Ga0127453_10222103 | 3300010102 | Grasslands Soil | MKAIRKYLKDKKGIDTILAALLMVVIVVVASVMVYAWSTGLLGTLLVHPTTG |
| Ga0127453_10449192 | 3300010102 | Grasslands Soil | MRKIGKITRDKKGIDTILAALLMVVIVVVAAVMVYAWATGLLSALLVQNPV |
| Ga0127500_10541793 | 3300010103 | Grasslands Soil | MKAIRKYLKDKKGIDTILAALLMVVIVVVASVMVYAWSTGLLGT |
| Ga0127500_10844432 | 3300010103 | Grasslands Soil | MQTIKRLFKNKKGIDTILAALLMVVIVVVASVMVYA |
| Ga0127494_10868731 | 3300010107 | Grasslands Soil | MNPFRRYLKNKKGINTILASLLMVVIVVVASVMVYAWSTG |
| Ga0127474_11403792 | 3300010108 | Grasslands Soil | MKSLRRIRRDKKGINTILAALLMVVIVVVAAVMVYAWS |
| Ga0127497_11448922 | 3300010109 | Grasslands Soil | MRKIRKIKRDKKGIDTILAALLMVVIVVVAAVMVYAWATGLLSALLVQNPV |
| Ga0127458_11284311 | 3300010112 | Grasslands Soil | MNPFRRYLKNKKGINTILASLLMVVIVVVASVMVYAWSTGLLGTLLVQPN |
| Ga0127458_11493762 | 3300010112 | Grasslands Soil | LKKIIGNKKGIDTILAALLMVVIVVVASVMVYAWSTGLL |
| Ga0127444_11555341 | 3300010113 | Grasslands Soil | MRKIRKITRDKKGIDTILAALLMVVIVVVAAVMVYAWSTGLLSA |
| Ga0127495_10468891 | 3300010115 | Grasslands Soil | MRKIRKIKRDKKGIDTILAALLMVVIVVVAAVMVYAWAT |
| Ga0127449_10248992 | 3300010117 | Grasslands Soil | MKSLRRIRRNKKGINTILASLLMVVIVVVAAVMVYAWSTGLLS |
| Ga0127488_10589231 | 3300010122 | Grasslands Soil | MTSLHKIRRHKIRRDKKGINTILASLLMVVIVVVAAVMVYAWSTG |
| Ga0127488_11348751 | 3300010122 | Grasslands Soil | MKSLRRIRRDRKGINTILASLLMVVIVVVAAVMVYAWSTGLL |
| Ga0127498_11522681 | 3300010124 | Grasslands Soil | MQPIKRLFKNKKGIDTILAALLMVVIVVVASVMVYAWSTGL |
| Ga0127489_11684452 | 3300010127 | Grasslands Soil | MKSLRRIRRNKKGINTILASLLMVVIVVVAAVMVYAWSTGLL |
| Ga0127493_11227141 | 3300010130 | Grasslands Soil | MNPVRKYLKSKKGINTILASLLMVVIVVVASVMVYAWSTGLL |
| Ga0127455_11216411 | 3300010132 | Grasslands Soil | MKTIKRLFKNKKGIDTILAALLMVVIVVVASVMVYAWSTGLLG |
| Ga0127456_10099323 | 3300010140 | Grasslands Soil | MMKTIKRLFKNKKGIDTILAALLMVVIVVVASVMVYAWS |
| Ga0127456_10480112 | 3300010140 | Grasslands Soil | MKSLRRIRRDKKGINTILAALLMVVIVVVAAVMVYAWSTGLLSSLLVQN |
| Ga0127483_12206251 | 3300010142 | Grasslands Soil | MKAIRKYLKDKKGIDTILAALLMVVIVVVASVMVYAWSTG |
| Ga0134070_100106415 | 3300010301 | Grasslands Soil | MRKIRKITRDKKGIDTILAALLMVVIVVVAAVMV* |
| Ga0134088_103347952 | 3300010304 | Grasslands Soil | MNPFRRYLKNKKGINTILASLLMVVIVVVASVMVYAWSTGLLGTLLVQP |
| Ga0126383_119614832 | 3300010398 | Tropical Forest Soil | MKPIKKLFKNKKGIDTILAALLMVVIVVVASVMVYAWS |
| Ga0150983_107087592 | 3300011120 | Forest Soil | MKNIRRYLKDKKGINTILAALLMVVIVVVASVMVYAWSTGLLGTLLVTPNV |
| Ga0150983_116283932 | 3300011120 | Forest Soil | MRTIKNIRRSVKDKKGINTILAALLMVVIVVVAAVMVYAWSTGLLS |
| Ga0150983_146878832 | 3300011120 | Forest Soil | MNPIRKYLKNKKGINTILASLLMVVIVVVASVMVYAWSTGLL |
| Ga0137392_102164523 | 3300011269 | Vadose Zone Soil | VKKLRKIMKNKKGIDTILAALLMVVIVVVAAVMVYA |
| Ga0137389_109933171 | 3300012096 | Vadose Zone Soil | MNPVRKYLRNRKGINTILASLLMVVIVVVAAVMVYA |
| Ga0137388_108831161 | 3300012189 | Vadose Zone Soil | MNPVRKYLKNKKGINTILASLLMVVIVVVAAVMVYAWSTG |
| Ga0137383_105192672 | 3300012199 | Vadose Zone Soil | MNPVRKYLKNKKGINTILASLLMVVIVVVASVMVYAWSTGLLGTLLVQPNVGKEA |
| Ga0137383_106930082 | 3300012199 | Vadose Zone Soil | MKSLRRIRKDKKAINTILASLLMVVIVVVAAVMVYAWSTGLLSSLLVQNPVPK |
| Ga0137382_107574452 | 3300012200 | Vadose Zone Soil | MKIPRRSLREKKGINTILASLLMVVIVVVAAVMVYAWSTGLLSTL |
| Ga0137365_111406652 | 3300012201 | Vadose Zone Soil | MQTIRKYLKGKKGIDTILAALLMVVIVVVASVMVYAWS |
| Ga0137363_106121213 | 3300012202 | Vadose Zone Soil | VKKLKKIIGNKKGIDTILAALLMVVIVVVASVMVYAW |
| Ga0137362_105122951 | 3300012205 | Vadose Zone Soil | MKSLRRIRRDKKGINTILASLLMVVIVVVAAVMVYA |
| Ga0137380_109747672 | 3300012206 | Vadose Zone Soil | MNPVRKYLKNKKGINTILASLLMVVIVVVAAVMVY |
| Ga0137381_116991571 | 3300012207 | Vadose Zone Soil | MQTIKRLFKNKKGIDTILAALLMVVIVVVASVMVYAWSTGLL |
| Ga0137376_103905973 | 3300012208 | Vadose Zone Soil | MNPFRRYLKNKKGINTILASLLMVVIVVVASVMVYAWSTGL |
| Ga0137379_108253171 | 3300012209 | Vadose Zone Soil | MQSIRKYLKGKKGIDTILAALILVAIVVVASVMVYAWSTGLLGTL |
| Ga0134028_10939292 | 3300012224 | Grasslands Soil | MKSLRRIRRDKKGINTILAALLMVVIVVVAAVMVYAWSTGLL |
| Ga0134028_12150422 | 3300012224 | Grasslands Soil | VKKLKKIIGNKKGIDTILAALLMVVIVVVASVMVYAWS |
| Ga0137367_105627121 | 3300012353 | Vadose Zone Soil | MKAIRKYLKDKKGIDTILAALLMVVSVVVASVMVYAWSTGLLGTLLVHP |
| Ga0137367_108595842 | 3300012353 | Vadose Zone Soil | MNPVRKYLRNKKGINTILASLLMVVIVVVASVMVYAWSTGLLGTLLV |
| Ga0137371_104009043 | 3300012356 | Vadose Zone Soil | MENMQTIRKYLKGKKGIDTILAALLMVVIVVVASV |
| Ga0137385_101039235 | 3300012359 | Vadose Zone Soil | VITMKTIKRLFKNKKGIDTILAALLMVVIVVVASVMVYAWSTGLLGTLLVTP |
| Ga0137385_104082443 | 3300012359 | Vadose Zone Soil | MKAIRKCLNDKKGIDTILAALLMVVIVVVASVMVYAWS |
| Ga0134039_11627122 | 3300012374 | Grasslands Soil | MNPVRKYLKSKKGINTILASLLMVVIVVVASVMVYAWSTGLLGTLLVQPNVG |
| Ga0134034_10607832 | 3300012375 | Grasslands Soil | MKSLRRIRRNKKGINTILASLLMVVIVVVAAVMVYAWSTGLLSSLLVQNPVPKE |
| Ga0134058_11111481 | 3300012379 | Grasslands Soil | MRTIKNIRRSIKDRKGINTILAALLMVVIVVVAAVMVYAWST |
| Ga0134058_12096853 | 3300012379 | Grasslands Soil | MTSLHKIRRHKIRRDKKGINTILASLLMVVIVVVAAVMVYAWST |
| Ga0134040_12521952 | 3300012389 | Grasslands Soil | MKNIRRYLKDKKGINTILASLLMVVIVVVASVMVYAWSTGLLGTLLVQPNVGKEAI |
| Ga0134041_10126732 | 3300012405 | Grasslands Soil | MKSLRRIRRNKKGINTILASLLMVVIVVVAAVMVY |
| Ga0134060_12874792 | 3300012410 | Grasslands Soil | MRKIRKIKRDKKGIDTILAALLMVVIVVVAAVMVYAWSTGLLSALLVQN |
| Ga0134060_14303302 | 3300012410 | Grasslands Soil | MKTIKRLFKNKKGIDTILAALLMVVIVVVASVMVYAWSTGLLGTLLVTPTA |
| Ga0137416_104446211 | 3300012927 | Vadose Zone Soil | MKSLRRIRRDKKGINTILAALLMVVIVVVAAVMVYAW |
| Ga0134081_100319251 | 3300014150 | Grasslands Soil | MRKIRKITRDKKGIDTILAALLMVVIVVVAAVMVYAW |
| Ga0134075_100808993 | 3300014154 | Grasslands Soil | MKSLRRIRRDKKGINTILAALLMVVIVVVAAVMVYAWSTGLLSSLLVQNPVPKETLNY |
| Ga0187803_103744811 | 3300017934 | Freshwater Sediment | MNPIRAYRKNKKGINTILAALLMVVIVVVAAVMVYAWATGLLSTLLVQNP |
| Ga0187771_116916611 | 3300018088 | Tropical Peatland | MRKTRKIRENKKGIDTILAALLMVVIVVVAAVMVYAWATGLLGTLLVNPNKVGNEAIN |
| Ga0187771_117618262 | 3300018088 | Tropical Peatland | MMNPIRAYRKNKKGINTILAALLMVVIVVVAAVMVYAWATGLLGTLLVNPNKVG |
| Ga0066655_106386932 | 3300018431 | Grasslands Soil | MKSLRWVRKDKKGINTILASLLMVVIVVVAAVMVYAWSTGLLSSLL |
| Ga0066667_109875681 | 3300018433 | Grasslands Soil | LTNLHQIRRDKKGINTILASLLMVVIVVVAAVMVYAWST |
| Ga0215015_101736391 | 3300021046 | Soil | MKSLRRIRRDKKGINTILAALLMVVIVVVAAVMVY |
| Ga0215015_103562361 | 3300021046 | Soil | MKAIRKYLKDKKGIDTILAALLMVVIVVVAAVMVYAW |
| Ga0215015_108012861 | 3300021046 | Soil | MNPFRRYLKNKKGINTILASLLMVVIVVVASVMVYAWSTGLLGTLL |
| Ga0179585_11477742 | 3300021307 | Vadose Zone Soil | MRKIRKITRDKKGIDTILAALLMVVIVVVAAVMVYAWSTGL |
| Ga0242656_11120022 | 3300022525 | Soil | MRKMRKITRDKKGIDTILAALLMVVIVVVAAVMVYAWATGLLS |
| Ga0242665_102245942 | 3300022724 | Soil | MKTIKNIRRSVKDKKGINTILAALLMVVIVVVAAVM |
| Ga0209238_12312781 | 3300026301 | Grasslands Soil | MKSLRRIRRDKKGINTILASLLMVVIVVVAAVMVYAWSTGLLSSLLVQNPVPKET |
| Ga0209469_10731213 | 3300026307 | Soil | LKMTSLHKIRRDKKGINTILASLLMVVIVVVAAVM |
| Ga0209239_11108633 | 3300026310 | Grasslands Soil | MRKIRKITRDKKGIDTILAALLMVVIVVVAAVMVYAWSTGLLS |
| Ga0209761_10137591 | 3300026313 | Grasslands Soil | MRKIRKITRDKKGIDTILAALLMVVIVVVAAVMVYAWATGLLSALLVQNPVPKESMNFES |
| Ga0209471_13333421 | 3300026318 | Soil | MKSLRRIRRNKKGINTILASLLMVVIVVVAAVMVYAWST |
| Ga0209470_13405131 | 3300026324 | Soil | MISLHKIRRDKKGINTILASLLMVVIVVAAAVMVYA |
| Ga0257165_10545791 | 3300026507 | Soil | MRKMRKITRDKKGIDTILAALLMVVIVVVAAVMVYA |
| Ga0257168_10709682 | 3300026514 | Soil | MNPVRKYLKNKKGINTILASLLMVVIVVVASVMVYAWSTGLLGTLLVQ |
| Ga0209160_12734881 | 3300026532 | Soil | MKSLRWVRKDKKGINTILASLLMVVIVVVAAVMVY |
| Ga0209805_100376911 | 3300026542 | Soil | MRKIRKITRDKKGIDTILAALLMVVIVVVAAVMVYAWSTGLLSALLVQN |
| Ga0209180_105158071 | 3300027846 | Vadose Zone Soil | MTNLHQIRRDKKAINTILASLLMVVIVVVAAVMVY |
| Ga0209283_108543392 | 3300027875 | Vadose Zone Soil | MNPVRKYLKNKKGINTILASLLMVVIVVVASVMVYAW |
| Ga0209590_107654371 | 3300027882 | Vadose Zone Soil | MTSLHKIRRDKKGINTILASLLMVVIVVVAAVMVYAWSTGLLSSLVVQ |
| Ga0257175_10448322 | 3300028673 | Soil | MRKIRKITRDKKGIDTILAALLMVVIVVVAAVMVYAWS |
| Ga0257175_10658022 | 3300028673 | Soil | MKSLRRIRRDKKGINTILAALLMVVIVVVAAVMVYAWSTGLLS |
| Ga0307473_101890943 | 3300031820 | Hardwood Forest Soil | MKAIRKYFHDKKGIDTILAALLMVVIVVVASVMVYAWSTGLLGTLLVHPTT |
| Ga0307473_109314971 | 3300031820 | Hardwood Forest Soil | MKSLRRIRRDKKGINTILAALLMVVIVVVAAVMVYAWATGLLSALLVQNPVPKES |
| Ga0307479_103582791 | 3300031962 | Hardwood Forest Soil | MRKMRKITRDKKGIDTILAALLMVVIVVVAAVMVYAWATGLLSALLVQN |
| Ga0307471_1004430034 | 3300032180 | Hardwood Forest Soil | MKSLRRIRRDKKGINTILAALLMVVIVVVAAVMVYAWSTGLLSSLLVQ |
| ⦗Top⦘ |