| Basic Information | |
|---|---|
| Family ID | F056444 |
| Family Type | Metagenome |
| Number of Sequences | 137 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MRERRKKIDPIVRLIEAMLDFALITGLLAAVGFLISITARHVF |
| Number of Associated Samples | 72 |
| Number of Associated Scaffolds | 134 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 30.66 % |
| % of genes near scaffold ends (potentially truncated) | 10.22 % |
| % of genes from short scaffolds (< 2000 bps) | 77.37 % |
| Associated GOLD sequencing projects | 63 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (72.263 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (35.766 % of family members) |
| Environment Ontology (ENVO) | Unclassified (43.066 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (48.905 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.48% β-sheet: 0.00% Coil/Unstructured: 53.52% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 134 Family Scaffolds |
|---|---|---|
| PF00072 | Response_reg | 32.84 |
| PF00196 | GerE | 19.40 |
| PF02518 | HATPase_c | 4.48 |
| PF09865 | DUF2092 | 2.99 |
| PF03734 | YkuD | 2.99 |
| PF07929 | PRiA4_ORF3 | 2.24 |
| PF03781 | FGE-sulfatase | 2.24 |
| PF08447 | PAS_3 | 1.49 |
| PF01638 | HxlR | 0.75 |
| PF13340 | DUF4096 | 0.75 |
| PF00175 | NAD_binding_1 | 0.75 |
| PF14534 | DUF4440 | 0.75 |
| PF01841 | Transglut_core | 0.75 |
| PF04679 | DNA_ligase_A_C | 0.75 |
| PF00128 | Alpha-amylase | 0.75 |
| PF13411 | MerR_1 | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 134 Family Scaffolds |
|---|---|---|---|
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 2.99 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 2.99 |
| COG1262 | Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain | Posttranslational modification, protein turnover, chaperones [O] | 2.24 |
| COG0296 | 1,4-alpha-glucan branching enzyme | Carbohydrate transport and metabolism [G] | 0.75 |
| COG0366 | Glycosidase/amylase (phosphorylase) | Carbohydrate transport and metabolism [G] | 0.75 |
| COG1523 | Pullulanase/glycogen debranching enzyme | Carbohydrate transport and metabolism [G] | 0.75 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.75 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.75 |
| COG3280 | Maltooligosyltrehalose synthase | Carbohydrate transport and metabolism [G] | 0.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 72.26 % |
| Unclassified | root | N/A | 27.74 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_16693201 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1271 | Open in IMG/M |
| 2088090014|GPIPI_17006434 | All Organisms → cellular organisms → Bacteria | 1489 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_104467207 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 510 | Open in IMG/M |
| 3300000955|JGI1027J12803_101760074 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300000955|JGI1027J12803_102296680 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300000955|JGI1027J12803_102602892 | Not Available | 657 | Open in IMG/M |
| 3300000955|JGI1027J12803_103901351 | Not Available | 1381 | Open in IMG/M |
| 3300000955|JGI1027J12803_104124498 | All Organisms → cellular organisms → Bacteria | 1067 | Open in IMG/M |
| 3300000955|JGI1027J12803_104247511 | Not Available | 617 | Open in IMG/M |
| 3300000955|JGI1027J12803_107610956 | Not Available | 573 | Open in IMG/M |
| 3300000955|JGI1027J12803_109193819 | Not Available | 591 | Open in IMG/M |
| 3300001867|JGI12627J18819_10115775 | All Organisms → cellular organisms → Bacteria | 1103 | Open in IMG/M |
| 3300001867|JGI12627J18819_10158956 | Not Available | 919 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100475304 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1127 | Open in IMG/M |
| 3300002906|JGI25614J43888_10000965 | All Organisms → cellular organisms → Bacteria | 8281 | Open in IMG/M |
| 3300002906|JGI25614J43888_10002779 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5438 | Open in IMG/M |
| 3300002906|JGI25614J43888_10004741 | All Organisms → cellular organisms → Bacteria | 4333 | Open in IMG/M |
| 3300002906|JGI25614J43888_10004741 | All Organisms → cellular organisms → Bacteria | 4333 | Open in IMG/M |
| 3300002906|JGI25614J43888_10007622 | All Organisms → cellular organisms → Bacteria | 3503 | Open in IMG/M |
| 3300002906|JGI25614J43888_10019959 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2142 | Open in IMG/M |
| 3300002906|JGI25614J43888_10041737 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1423 | Open in IMG/M |
| 3300002906|JGI25614J43888_10105244 | Not Available | 739 | Open in IMG/M |
| 3300002906|JGI25614J43888_10149903 | Not Available | 621 | Open in IMG/M |
| 3300002906|JGI25614J43888_10158972 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300002906|JGI25614J43888_10170690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Endozoicomonadaceae → Endozoicomonas → unclassified Endozoicomonas → Endozoicomonas sp. ONNA2 | 585 | Open in IMG/M |
| 3300002910|JGI25615J43890_1012695 | All Organisms → cellular organisms → Bacteria | 1368 | Open in IMG/M |
| 3300002917|JGI25616J43925_10051486 | All Organisms → cellular organisms → Bacteria | 1781 | Open in IMG/M |
| 3300002917|JGI25616J43925_10218287 | Not Available | 728 | Open in IMG/M |
| 3300002917|JGI25616J43925_10228447 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300002917|JGI25616J43925_10386793 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300005174|Ga0066680_10472729 | Not Available | 790 | Open in IMG/M |
| 3300005181|Ga0066678_10966039 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 554 | Open in IMG/M |
| 3300005434|Ga0070709_11575025 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300005445|Ga0070708_100122657 | All Organisms → cellular organisms → Bacteria | 2399 | Open in IMG/M |
| 3300005445|Ga0070708_101012946 | Not Available | 779 | Open in IMG/M |
| 3300005445|Ga0070708_101747001 | Not Available | 578 | Open in IMG/M |
| 3300005467|Ga0070706_100219955 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1773 | Open in IMG/M |
| 3300005467|Ga0070706_100277663 | All Organisms → cellular organisms → Bacteria | 1563 | Open in IMG/M |
| 3300005467|Ga0070706_100928276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 804 | Open in IMG/M |
| 3300005467|Ga0070706_101351986 | Not Available | 653 | Open in IMG/M |
| 3300005467|Ga0070706_101550579 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 605 | Open in IMG/M |
| 3300005536|Ga0070697_100219718 | All Organisms → cellular organisms → Bacteria | 1619 | Open in IMG/M |
| 3300005559|Ga0066700_10726608 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300005561|Ga0066699_11165845 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300006028|Ga0070717_10034318 | All Organisms → cellular organisms → Bacteria | 4100 | Open in IMG/M |
| 3300006028|Ga0070717_11064949 | Not Available | 736 | Open in IMG/M |
| 3300006797|Ga0066659_11321300 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidisarcina → Acidisarcina polymorpha | 602 | Open in IMG/M |
| 3300009143|Ga0099792_10256069 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
| 3300010159|Ga0099796_10326735 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300011120|Ga0150983_15279693 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 728 | Open in IMG/M |
| 3300012200|Ga0137382_10110789 | Not Available | 1823 | Open in IMG/M |
| 3300012202|Ga0137363_10473219 | Not Available | 1050 | Open in IMG/M |
| 3300012202|Ga0137363_10639831 | Not Available | 899 | Open in IMG/M |
| 3300012202|Ga0137363_11176748 | Not Available | 652 | Open in IMG/M |
| 3300012202|Ga0137363_11288089 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 619 | Open in IMG/M |
| 3300012203|Ga0137399_10372602 | Not Available | 1188 | Open in IMG/M |
| 3300012203|Ga0137399_10524939 | Not Available | 994 | Open in IMG/M |
| 3300012205|Ga0137362_10475183 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
| 3300012205|Ga0137362_10740354 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 844 | Open in IMG/M |
| 3300012205|Ga0137362_11390395 | Not Available | 588 | Open in IMG/M |
| 3300012207|Ga0137381_10659104 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300012208|Ga0137376_11069718 | Not Available | 690 | Open in IMG/M |
| 3300012209|Ga0137379_11496398 | Not Available | 576 | Open in IMG/M |
| 3300012210|Ga0137378_11277758 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300012211|Ga0137377_10135255 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium LW23 | 2356 | Open in IMG/M |
| 3300012285|Ga0137370_10354181 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300012361|Ga0137360_10091374 | All Organisms → cellular organisms → Bacteria | 2308 | Open in IMG/M |
| 3300012361|Ga0137360_10737352 | Not Available | 847 | Open in IMG/M |
| 3300012362|Ga0137361_10540761 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1069 | Open in IMG/M |
| 3300012582|Ga0137358_10018019 | All Organisms → cellular organisms → Bacteria | 4512 | Open in IMG/M |
| 3300012582|Ga0137358_10018019 | All Organisms → cellular organisms → Bacteria | 4512 | Open in IMG/M |
| 3300012582|Ga0137358_10762400 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300012683|Ga0137398_11057879 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300012683|Ga0137398_11121840 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Phragmitibacter → Phragmitibacter flavus | 541 | Open in IMG/M |
| 3300012685|Ga0137397_10587884 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 828 | Open in IMG/M |
| 3300012922|Ga0137394_10708102 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 847 | Open in IMG/M |
| 3300012922|Ga0137394_10939533 | Not Available | 720 | Open in IMG/M |
| 3300012923|Ga0137359_10215976 | All Organisms → cellular organisms → Bacteria | 1713 | Open in IMG/M |
| 3300012923|Ga0137359_10388611 | All Organisms → cellular organisms → Bacteria | 1238 | Open in IMG/M |
| 3300012923|Ga0137359_11090857 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 683 | Open in IMG/M |
| 3300012923|Ga0137359_11198614 | Not Available | 647 | Open in IMG/M |
| 3300012925|Ga0137419_10150928 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1677 | Open in IMG/M |
| 3300012927|Ga0137416_10821608 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300012929|Ga0137404_11058552 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300015241|Ga0137418_10073514 | All Organisms → cellular organisms → Bacteria | 3110 | Open in IMG/M |
| 3300015241|Ga0137418_10300788 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1342 | Open in IMG/M |
| 3300015264|Ga0137403_10101153 | All Organisms → cellular organisms → Bacteria | 2890 | Open in IMG/M |
| 3300020199|Ga0179592_10026167 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2618 | Open in IMG/M |
| 3300020199|Ga0179592_10026167 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2618 | Open in IMG/M |
| 3300020199|Ga0179592_10026225 | All Organisms → cellular organisms → Bacteria | 2615 | Open in IMG/M |
| 3300020199|Ga0179592_10036789 | All Organisms → cellular organisms → Bacteria | 2215 | Open in IMG/M |
| 3300020199|Ga0179592_10333355 | Not Available | 670 | Open in IMG/M |
| 3300021180|Ga0210396_10493098 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
| 3300021432|Ga0210384_10348071 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1335 | Open in IMG/M |
| 3300023046|Ga0233356_1007124 | All Organisms → cellular organisms → Bacteria | 1161 | Open in IMG/M |
| 3300024288|Ga0179589_10598033 | Not Available | 517 | Open in IMG/M |
| 3300025910|Ga0207684_10146758 | All Organisms → cellular organisms → Bacteria | 2029 | Open in IMG/M |
| 3300025910|Ga0207684_11301593 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300025910|Ga0207684_11529773 | Not Available | 542 | Open in IMG/M |
| 3300025915|Ga0207693_10852259 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 701 | Open in IMG/M |
| 3300025922|Ga0207646_10754919 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 868 | Open in IMG/M |
| 3300025939|Ga0207665_10475896 | Not Available | 962 | Open in IMG/M |
| 3300026285|Ga0209438_1092604 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
| 3300026304|Ga0209240_1016898 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2783 | Open in IMG/M |
| 3300026304|Ga0209240_1034171 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1935 | Open in IMG/M |
| 3300026304|Ga0209240_1117417 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 916 | Open in IMG/M |
| 3300026304|Ga0209240_1161674 | Not Available | 688 | Open in IMG/M |
| 3300026319|Ga0209647_1000746 | All Organisms → cellular organisms → Bacteria | 29714 | Open in IMG/M |
| 3300026319|Ga0209647_1001734 | All Organisms → cellular organisms → Bacteria | 18140 | Open in IMG/M |
| 3300026319|Ga0209647_1002908 | All Organisms → cellular organisms → Bacteria | 13611 | Open in IMG/M |
| 3300026319|Ga0209647_1003989 | All Organisms → cellular organisms → Bacteria | 11257 | Open in IMG/M |
| 3300026319|Ga0209647_1004870 | All Organisms → cellular organisms → Bacteria | 9969 | Open in IMG/M |
| 3300026319|Ga0209647_1087447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Endozoicomonadaceae → Endozoicomonas → unclassified Endozoicomonas → Endozoicomonas sp. ONNA2 | 1520 | Open in IMG/M |
| 3300026319|Ga0209647_1107829 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1312 | Open in IMG/M |
| 3300026319|Ga0209647_1233970 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 617 | Open in IMG/M |
| 3300026351|Ga0257170_1041797 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 630 | Open in IMG/M |
| 3300026356|Ga0257150_1071425 | Not Available | 525 | Open in IMG/M |
| 3300026369|Ga0257152_1027051 | Not Available | 616 | Open in IMG/M |
| 3300026508|Ga0257161_1035135 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 992 | Open in IMG/M |
| 3300026551|Ga0209648_10112851 | All Organisms → cellular organisms → Bacteria | 2207 | Open in IMG/M |
| 3300026555|Ga0179593_1060569 | All Organisms → cellular organisms → Bacteria | 2545 | Open in IMG/M |
| 3300026555|Ga0179593_1168145 | All Organisms → cellular organisms → Bacteria | 2330 | Open in IMG/M |
| 3300027050|Ga0209325_1023498 | Not Available | 725 | Open in IMG/M |
| 3300027071|Ga0209214_1009760 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1144 | Open in IMG/M |
| 3300027616|Ga0209106_1077165 | Not Available | 747 | Open in IMG/M |
| 3300027651|Ga0209217_1077369 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
| 3300027681|Ga0208991_1035816 | All Organisms → cellular organisms → Bacteria | 1504 | Open in IMG/M |
| 3300027738|Ga0208989_10292888 | Not Available | 522 | Open in IMG/M |
| 3300028536|Ga0137415_10016352 | All Organisms → cellular organisms → Bacteria | 7352 | Open in IMG/M |
| 3300028536|Ga0137415_10116862 | All Organisms → cellular organisms → Bacteria | 2514 | Open in IMG/M |
| 3300031754|Ga0307475_11027837 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 647 | Open in IMG/M |
| 3300031820|Ga0307473_10526608 | Not Available | 803 | Open in IMG/M |
| 3300031962|Ga0307479_10101363 | All Organisms → cellular organisms → Bacteria | 2798 | Open in IMG/M |
| 3300031962|Ga0307479_10209480 | All Organisms → cellular organisms → Bacteria | 1920 | Open in IMG/M |
| 3300031962|Ga0307479_10344604 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1473 | Open in IMG/M |
| 3300031962|Ga0307479_10371828 | All Organisms → cellular organisms → Bacteria | 1413 | Open in IMG/M |
| 3300032180|Ga0307471_102729055 | Not Available | 627 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 35.77% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 21.90% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 13.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.68% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.11% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.11% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002906 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm | Environmental | Open in IMG/M |
| 3300002910 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300023046 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026351 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-B | Environmental | Open in IMG/M |
| 3300026356 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-A | Environmental | Open in IMG/M |
| 3300026369 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-A | Environmental | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300027050 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027071 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027616 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_00080250 | 2088090014 | Soil | MRERRKKIEPIARCIEVALDLALITGPLSAVGFLISITARHVF |
| GPIPI_00533230 | 2088090014 | Soil | MRERREKIDPIARLIEAVLDRALISALLTAAGFLVSNTARLVF |
| INPhiseqgaiiFebDRAFT_1044672072 | 3300000364 | Soil | MKRRKKIDPIARLIEVALDLALISGLLSAVAILMPITSRVVF* |
| JGI1027J12803_1017600743 | 3300000955 | Soil | MRERRKKIDPIARIIEAILDFALITGLLSAVGFLISITARGVF* |
| JGI1027J12803_1022966802 | 3300000955 | Soil | MRERRKKINSIVRLIEVVLDFAVITGFLAAVGFLISIISRVVF* |
| JGI1027J12803_1026028921 | 3300000955 | Soil | MNAETKIGRIACLIEAMLDFALIVGFLSAGGLLISNAARGVF* |
| JGI1027J12803_1039013514 | 3300000955 | Soil | MRERRKKIDPIARLIEAILDLVLISGRLSAVGFIISITSRYVF* |
| JGI1027J12803_1041244982 | 3300000955 | Soil | MRERRKKIGPIVRLVEAILDFALITVLLTAVGFLISITAHLVF* |
| JGI1027J12803_1042475112 | 3300000955 | Soil | MRERRKKIDAIARLTEAILDFALITGLLAAVGFLISITARGVF* |
| JGI1027J12803_1076109561 | 3300000955 | Soil | MKHRKKIDPIVRLVEAMLDFALITGLLSAVVFLVSITARVVF*PGQD |
| JGI1027J12803_1091938192 | 3300000955 | Soil | MRERRNKIGTIVRLIEVMLDFALITGLLAAVGFLILITSHLVF* |
| JGI12627J18819_101157753 | 3300001867 | Forest Soil | MRERRKKIGPIVRLIEAMLDFALITGRLAALGFLVS |
| JGI12627J18819_101589563 | 3300001867 | Forest Soil | MRERRKKIVPTMRLIEALLDFLSIAGFLSAIEFLISITSRVVF* |
| JGIcombinedJ26739_1004753042 | 3300002245 | Forest Soil | MRERRKKIDPIARLIEVALDCALITGLLSAVGFLISITARHVF* |
| JGI25614J43888_1000096512 | 3300002906 | Grasslands Soil | MRERRKKIDPIARLIEAILDLALITGLLSAVGFLISITARLVF* |
| JGI25614J43888_100027796 | 3300002906 | Grasslands Soil | MKFGNRADLNMKRRKKIPPIVRLIEALLDFALITSFLSAIGLLISITSRVVF* |
| JGI25614J43888_100047411 | 3300002906 | Grasslands Soil | MRERRKKIVPTMRLIEALLDFSLIAGFLSAIEFLISITSRVVF* |
| JGI25614J43888_100047415 | 3300002906 | Grasslands Soil | MRERRKKIGPLVRLIKAMLXFASITGLLAALGFLVSITAXHVF* |
| JGI25614J43888_100076224 | 3300002906 | Grasslands Soil | MNAEKIGPIARLIEAILDFALIVGXLSAVGLLISIAARGVF* |
| JGI25614J43888_100199593 | 3300002906 | Grasslands Soil | MRERRKKIEPIARCIEVALDLALITGVLSAVGFLISITARHVF* |
| JGI25614J43888_100417372 | 3300002906 | Grasslands Soil | MRERRKKIGPIVRLIEAMLDFALITGLLAAVGFLISITARAAF* |
| JGI25614J43888_101052442 | 3300002906 | Grasslands Soil | MKRRKKIDPIARLIESMLDFALITGLLAAAVFLVSTTARLVF* |
| JGI25614J43888_101499031 | 3300002906 | Grasslands Soil | MKRRKKIDPIVRLIEAMLDFALITGLLAAAVFLVSNTARLAF* |
| JGI25614J43888_101589722 | 3300002906 | Grasslands Soil | MKRRKKIGPIARLIEAMLDFALIVDFLSPVGLLISIAARGVF* |
| JGI25614J43888_101706902 | 3300002906 | Grasslands Soil | MRERRKKIDPIARLIEAILDLALISGLLSAVGFIISITARGVF* |
| JGI25615J43890_10126953 | 3300002910 | Grasslands Soil | MTRRERRKKIGPIVRLIEAILDFALISGLLAALGFLISIIARAVF* |
| JGI25616J43925_100514864 | 3300002917 | Grasslands Soil | MRERRKKIGPLVRLIKAMLDFASITGLLAALGFXXSITARHVF* |
| JGI25616J43925_102182871 | 3300002917 | Grasslands Soil | MKXRKKXDPIVRLIXAMLXFALITGLLXAAVFLVSTTARLVF* |
| JGI25616J43925_102284472 | 3300002917 | Grasslands Soil | MRERRQKIGSIVRLIEAILGFALITGLLAAVGFLISITARAAF* |
| JGI25616J43925_103867932 | 3300002917 | Grasslands Soil | MKRRKKLDPIARLIEAMLDFALITGFLAAVVFLVSTTARLVF* |
| Ga0066680_104727291 | 3300005174 | Soil | MNRRKKIDPIARLIEAMLDFALITGLLAAVVFLVSTTARLVF*LGEK* |
| Ga0066678_109660392 | 3300005181 | Soil | MRERRKKIGPIVRLIEAILDFALITVLLTAVGFLISITAHLVF* |
| Ga0070709_115750251 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MRERRKKIDPIAGLIEAILDLALMTGLLAAVGFLISITARL |
| Ga0070708_1001226577 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRRKKIDPIGRLIEAMLDFALITGFLAAVVFLVSINSRLVF* |
| Ga0070708_1010129461 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRRNKIDPVVRLIEVMLDFALITGFLSAVGFLISITAHLVF* |
| Ga0070708_1017470012 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MRERRKKIDPIAGLIEAILDLALMTGLLAAVGFLISITARLVF* |
| Ga0070706_1002199552 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MRERRKKIGPIVRLIEAMLDFALITGLLAAVGFLVSINSRLVF* |
| Ga0070706_1002776634 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRRKKIDPIARLIEAMLDFALITGLLSAVGFLISITARGVS* |
| Ga0070706_1009282762 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MRERRKKIDPIARLIEAMLDFALITGLLAAVGFLISITARHLF* |
| Ga0070706_1013519861 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MRERRKKIEPIARCIEVALDLALITGLLSAVGFLISITARHVF* |
| Ga0070706_1015505792 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MKPRKKIDPIGRLIETVLDFALITGFLSAMGFLISIVSRPVF* |
| Ga0070697_1002197181 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MRERRKKIDPIARLIEAMLDCALIAGLLAAVGFLISITARHVF* |
| Ga0066700_107266082 | 3300005559 | Soil | MKRRKKIDPIARLIEAMLDFALITGLLAAVGLLISITSRVVF* |
| Ga0066699_111658452 | 3300005561 | Soil | MRERRKKIEPITRCIEVALDLAFITGLLSAVGFLISITARHVF* |
| Ga0070717_100343185 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MRERRKKIGPIARLIEAILDLALITGLLAAVGFLISLSARLVV* |
| Ga0070717_110649492 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MKSRNKIDPVVRLIEVMLDFALITGFLSAVGFLISITAHLVF* |
| Ga0066659_113213001 | 3300006797 | Soil | MKRRKKIDPIARLIDALLDFALITGLLAAVVFLVSTTARLVF* |
| Ga0099792_102560692 | 3300009143 | Vadose Zone Soil | APSNMKRRKKIDPIVRLIEAMLDFALITGLLAAVVFLVSTTARLVF* |
| Ga0099796_103267352 | 3300010159 | Vadose Zone Soil | MKRRNKIDPIVRLIEVMLDFASITGFLSAIRFLISITAHLVF* |
| Ga0150983_152796931 | 3300011120 | Forest Soil | ERRKKIDPIVRLIEAMLDFALITGLLAALGFLVSITARHVF* |
| Ga0137382_101107894 | 3300012200 | Vadose Zone Soil | MRERRKKIDPIARLIEAILDLALISGLLSAVGFIISITARYVF* |
| Ga0137363_104732192 | 3300012202 | Vadose Zone Soil | MKRRKKIDPIARLIEAMLDLVLITGLLASVVFLVSTTARLVF* |
| Ga0137363_106398312 | 3300012202 | Vadose Zone Soil | MKCRKKIDPIVRLIEAMLDFALITGLLAAAVFLVSTTARLAF* |
| Ga0137363_111767482 | 3300012202 | Vadose Zone Soil | MRERRKKIDPIARLVETMLDFALITGVLFTVGFLISITGRLVF* |
| Ga0137363_112880892 | 3300012202 | Vadose Zone Soil | MRERRKKIDPIARLIEVALDCAVITGFLAAVGFLISITSRVVF* |
| Ga0137399_103726023 | 3300012203 | Vadose Zone Soil | MKCRKKIDPIARLIEAMLDFALITGLLAAVVFLVSTTARLVF* |
| Ga0137399_105249393 | 3300012203 | Vadose Zone Soil | MRERRKKIVPTKRLIEALLDFSLIAGLLSAIEFLIPITSRVVF* |
| Ga0137362_104751833 | 3300012205 | Vadose Zone Soil | MRERRKKIGPIVRLIEAILDFALISGLLAALGFLISITARAVF* |
| Ga0137362_107403542 | 3300012205 | Vadose Zone Soil | MKRRKKIDPIVRLIEAMLDFALITGLLAAAVFLVSTTARLVF* |
| Ga0137362_113903952 | 3300012205 | Vadose Zone Soil | MKRRKKIDPIVRLIEVMLDFALITGLRSAVGLPISITSRVVF* |
| Ga0137381_106591042 | 3300012207 | Vadose Zone Soil | MRERRKKIDAIARLIEAILDFALITGLLAAVGFLISITARLVF* |
| Ga0137376_110697182 | 3300012208 | Vadose Zone Soil | MRERRKKIDPIARLVETMLDFALITGFLSTVGFLISITGRLVF* |
| Ga0137379_114963982 | 3300012209 | Vadose Zone Soil | MKRRKKIDPIARLIEAMLDFALITGLLAAVVFLVSTTA |
| Ga0137378_112777582 | 3300012210 | Vadose Zone Soil | MKRRKKIDPIARLIDAMLDFALITGLLAAVVFLVSTTARLVF* |
| Ga0137377_101352552 | 3300012211 | Vadose Zone Soil | MRERRKKIDPIARLIEAILDLALITGLLSAVGFFISITARLVF* |
| Ga0137370_103541812 | 3300012285 | Vadose Zone Soil | MERRKKIDPIARLIEAMLDFALITGLLAAVVFLVSTTARLVF* |
| Ga0137360_100913742 | 3300012361 | Vadose Zone Soil | MKRRKKIDPIARLIEAMLDLVLITGLLAAVVFLVSTTARLVF* |
| Ga0137360_107373522 | 3300012361 | Vadose Zone Soil | MKRRKKIDPIVRLIEAMLDFALITGLLAAVVFLVSTTARGVS* |
| Ga0137361_105407612 | 3300012362 | Vadose Zone Soil | MKSRKKIDPIVRLIEVMLDFALIAGFLSAVGFLISITAHLVF* |
| Ga0137358_100180192 | 3300012582 | Vadose Zone Soil | MRERRKKIDPIVRLIEAMLDFALITGLLATLGFVISITARHVF* |
| Ga0137358_100180195 | 3300012582 | Vadose Zone Soil | MHERRKKIVPTKRLIEALLDFALIAGLLSAIEFLIPITSRVVF* |
| Ga0137358_107624001 | 3300012582 | Vadose Zone Soil | MKRRKKIDPIARLIEAMLDFALITGLLAAVVFLVSTTARGVS* |
| Ga0137398_110578792 | 3300012683 | Vadose Zone Soil | MKRRKKIDPIARLIEAILDFALITGFLSAVGFLISITGRLVF* |
| Ga0137398_111218401 | 3300012683 | Vadose Zone Soil | MRERRKKIGPVVRLIEAILDFTLITGLLAAVGFLISIMARGVL* |
| Ga0137397_105878841 | 3300012685 | Vadose Zone Soil | MKRRKKIDPIVRLIETMLDFALITGLLSAVGLLISITSRVVF* |
| Ga0137394_107081022 | 3300012922 | Vadose Zone Soil | MKRRKKIDPIARLIEAMLDFALITGLLAAAVFLVSTTARLVF* |
| Ga0137394_109395332 | 3300012922 | Vadose Zone Soil | MRERRKKIDPIARLIEAILDLALITGLLSAVGFIISITARYVF* |
| Ga0137359_102159762 | 3300012923 | Vadose Zone Soil | MRERRKKIDPIVRLIEALLDFALIAGFLSAIGFLISITSRVGL* |
| Ga0137359_103886113 | 3300012923 | Vadose Zone Soil | MKRRKKIDPIARLIEAMLDFALITGLLAAVGFLVSTTARLVF* |
| Ga0137359_110908571 | 3300012923 | Vadose Zone Soil | MRERRKKIDPIVRLIEAMLDFALITGLLAALGFVISITARHVF* |
| Ga0137359_111986142 | 3300012923 | Vadose Zone Soil | RRKKIGPIARLIEAMLDFALIVGFLSPVGLLISIAARGVF* |
| Ga0137419_101509284 | 3300012925 | Vadose Zone Soil | MKRRNKIDPIVRLIEVMLDFASITGFLSAIRFLISITAHLVFDPEKN* |
| Ga0137416_108216081 | 3300012927 | Vadose Zone Soil | CRKKIDPIARLIEAMLDFALITGLLAAVGFLVSTTARLVF* |
| Ga0137404_110585522 | 3300012929 | Vadose Zone Soil | MKRRKKIDPIARLIEAMLDFALITGLLAAVVFLVSTTARLVF* |
| Ga0137418_100735141 | 3300015241 | Vadose Zone Soil | MRERRKKIDPIARLIEVVLDFAVITGFLAAVGFLISITSRVVF* |
| Ga0137418_103007882 | 3300015241 | Vadose Zone Soil | MRERRKKIVPTKRLIEALLAFALIAGLLSAIEFLIPITSRVVF* |
| Ga0137403_101011533 | 3300015264 | Vadose Zone Soil | MRERRKKIHPIARLIEAILDLALISGLLSAVGFIISITARYVF* |
| Ga0179592_100261673 | 3300020199 | Vadose Zone Soil | MRERRKKIVPTKRLIEALLDFSLIAGLLSAIEFLIPITSRVVF |
| Ga0179592_100261677 | 3300020199 | Vadose Zone Soil | MRERRKKIDPIVRLIEAMLDFALITGLLAALGFVISITARHVF |
| Ga0179592_100262255 | 3300020199 | Vadose Zone Soil | MRERRKKIDPIARLIEVVLDFAVITGLLAAVVFLVSTTSRYVF |
| Ga0179592_100367893 | 3300020199 | Vadose Zone Soil | MKRRNKIDPIVRLIEVMLDFASITGFLSAIRFLISITAHLVF |
| Ga0179592_103333552 | 3300020199 | Vadose Zone Soil | MKRRKKTDPIARLIEAMLDFALITGLLAAVVFLVSTTARLVF |
| Ga0210396_104930983 | 3300021180 | Soil | KIGPIVRLIEAILDFALISGLLAALGFLISITARAVF |
| Ga0210384_103480713 | 3300021432 | Soil | MRERRKKIDPIVRLIEAMLDFALITGLLAAFVISITARHVF |
| Ga0233356_10071243 | 3300023046 | Soil | MRERQKKINPIGRLIEVVLDFAVITGFLAAVGFLISINSRVVF |
| Ga0179589_105980331 | 3300024288 | Vadose Zone Soil | MRERRKKIGPIVGLIEAILDFALITGLLAAVGFLISIMARGVL |
| Ga0207684_101467583 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MRERRKKIGPIVRLIEAMLDFALITGLLAAVGFLVSINSRLVF |
| Ga0207684_113015931 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | KRRKKIDPIVRIIEVMLDFALITGFLSAVGLLISITARGVF |
| Ga0207684_115297732 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MNAETKIGRIACLIEAMLDFALIVGFLSAGGLLISNAARGVF |
| Ga0207693_108522592 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRKRRKKIDPIARLIEAMLDFALITGLLAAVVFLVSTTARLVF |
| Ga0207646_107549193 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRRKKIDPIGRLIEAMLDFALITGFLAAVVFLVSINSRLVF |
| Ga0207665_104758961 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRRKKIDRIARLIEAMLDFALIAGLLAAAVFLVSTTARLVF |
| Ga0209438_10926042 | 3300026285 | Grasslands Soil | MRERRKKIDPIARLIEAILDLALISGLLSSVGFIISITARYVF |
| Ga0209240_10168983 | 3300026304 | Grasslands Soil | MHERRKKIVPTKRLIEALLDFALIAGLLSAIEFLIPITSRVVF |
| Ga0209240_10341713 | 3300026304 | Grasslands Soil | MRERRKKIGPLVRLIKAMLDFASITGLLAALGFLVSITARHVF |
| Ga0209240_11174171 | 3300026304 | Grasslands Soil | MKRRKKIDPIARLIEAMLDFALITGLLAAAVFLVSTTARLVF |
| Ga0209240_11616742 | 3300026304 | Grasslands Soil | MKRRKKIGPIARLIEAMLDFALIVDFLSPVGLLISIAARGVF |
| Ga0209647_10007462 | 3300026319 | Grasslands Soil | MRERRKKIVPTMRLIEALLDFSLIAGFLSAIEFLISITSRVVF |
| Ga0209647_100173420 | 3300026319 | Grasslands Soil | MKFGNRADLNMKRRKKIPPIVRLIEALLDFALITSFLSAIGLLISITSRVVF |
| Ga0209647_100290819 | 3300026319 | Grasslands Soil | MKRRKKFDPIVRLIDAMLDFALITGLLVAAVFLVSTTARLVF |
| Ga0209647_10039895 | 3300026319 | Grasslands Soil | MRERRKKIDPIARLIEAILDLALITGLLSAVGFLISITARLVF |
| Ga0209647_100487010 | 3300026319 | Grasslands Soil | MRERRKKIEPIARCIEVALDLALITGVLSAVGFLISITARHVF |
| Ga0209647_10874472 | 3300026319 | Grasslands Soil | MRERRKKIDPIARLIEAILDLALISGLLSAVGFIISITARGVF |
| Ga0209647_11078292 | 3300026319 | Grasslands Soil | MKHRKKIDPIVRLIEAMLGFALITGLLAAAVFLVSTTARLVF |
| Ga0209647_12339702 | 3300026319 | Grasslands Soil | MKRRKKIDPIARLIESMLDFALITGLLAAAVFLVSTTARLVF |
| Ga0257170_10417972 | 3300026351 | Soil | MRERRKKIDPIARLIEVALDCALITGFLAAVGFLISITSRVVF |
| Ga0257150_10714251 | 3300026356 | Soil | MRERRKEIGPIVRLIEAILDFTLITGLLAAVGFLISITARGVF |
| Ga0257152_10270512 | 3300026369 | Soil | MRERRKKIVPTKRLIEALLAFALIAGLLSAIEFLIPITSRVVF |
| Ga0257161_10351352 | 3300026508 | Soil | MRERRKKIGPIARLIEAMLDCALIAGLVAAIGFLISNTARVVF |
| Ga0209648_101128512 | 3300026551 | Grasslands Soil | MKRRKKIDPIVRLIEAMLGFALITGLLAAAVFLVSTTARLVF |
| Ga0179593_10605692 | 3300026555 | Vadose Zone Soil | LHPIQHETPNKIDPIVRLIEVMLDFASITGFLSAIRFLISITAHLVF |
| Ga0179593_11681453 | 3300026555 | Vadose Zone Soil | MRKRRKKIGPIARLIEAILDFALITGLLAAAVFLVSTTAHLVFDSEKNGR |
| Ga0209325_10234981 | 3300027050 | Forest Soil | MRERRKKIVPTMRLIEALLDFLSIAGFLSAIEFLISITSRVVF |
| Ga0209214_10097602 | 3300027071 | Forest Soil | MRERRNKIGPIVRLIEVMLDFALITGLLPAVGFLISITSHLVF |
| Ga0209106_10771652 | 3300027616 | Forest Soil | MKRRKKIDPIARLIEAMLDLVLITGLLASVVFLVSTTARLVF |
| Ga0209217_10773692 | 3300027651 | Forest Soil | MRERRKKIDPIVRLIEAMLDFALITGLLAAVGFLISITARHVF |
| Ga0208991_10358162 | 3300027681 | Forest Soil | MRERRKKINPIVRLIEVVLDFAVITGFLAAVGFLISITSRVVF |
| Ga0208989_102928882 | 3300027738 | Forest Soil | MKRKRRKKIDPIARLIEGILDCALIAGLVAAVGFLISITTRVVF |
| Ga0137415_100163527 | 3300028536 | Vadose Zone Soil | MKRRKKIDRIVRLIEAMLGFALITGLLAAAVFLVSTTARLVF |
| Ga0137415_101168624 | 3300028536 | Vadose Zone Soil | MRERRKKIDPIARLVETMLDFALITGFLSTVEFLI |
| Ga0307475_110278371 | 3300031754 | Hardwood Forest Soil | MRERRKKIDPIVRLTEAMLDFALITGLLAALGFVISITARHVF |
| Ga0307473_105266082 | 3300031820 | Hardwood Forest Soil | MRERRKKIDPIVRLIEAMLDFALITGLLAAVGFLISTIGRHVF |
| Ga0307479_101013635 | 3300031962 | Hardwood Forest Soil | MHERRKKIGSIVRLIEAILDFALITGLLAAVGFLISITARASF |
| Ga0307479_102094804 | 3300031962 | Hardwood Forest Soil | MRERRKKIDPIVRLIEAMLDFALITGLLAALGFLVSITARHVF |
| Ga0307479_103446043 | 3300031962 | Hardwood Forest Soil | MRERRKKIVPTKRPIEALLDFSLIAGLLSAIEFLIPITSRVVF |
| Ga0307479_103718282 | 3300031962 | Hardwood Forest Soil | MKRRKKIDPIVRLIEALLDFALITGFLAAAGFLISITSRVSFDPEKNGC |
| Ga0307471_1027290552 | 3300032180 | Hardwood Forest Soil | MRERRKKIVPTMRLIEALLDFSLIAVLLSAIEFLISITSRVVF |
| ⦗Top⦘ |