| Basic Information | |
|---|---|
| Family ID | F056421 |
| Family Type | Metagenome |
| Number of Sequences | 137 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MKDDEVENLFAYGWLDTAVAIVLALLALVALFFMAGYLT |
| Number of Associated Samples | 74 |
| Number of Associated Scaffolds | 136 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 94.16 % |
| % of genes near scaffold ends (potentially truncated) | 8.03 % |
| % of genes from short scaffolds (< 2000 bps) | 64.96 % |
| Associated GOLD sequencing projects | 69 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (59.124 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (32.847 % of family members) |
| Environment Ontology (ENVO) | Unclassified (70.073 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (59.854 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.27% β-sheet: 0.00% Coil/Unstructured: 53.73% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 136 Family Scaffolds |
|---|---|---|
| PF11753 | DUF3310 | 2.94 |
| PF00271 | Helicase_C | 2.94 |
| PF00959 | Phage_lysozyme | 2.21 |
| PF00476 | DNA_pol_A | 2.21 |
| PF13481 | AAA_25 | 1.47 |
| PF13662 | Toprim_4 | 1.47 |
| PF10926 | DUF2800 | 1.47 |
| PF03237 | Terminase_6N | 1.47 |
| PF04404 | ERF | 1.47 |
| PF15943 | YdaS_antitoxin | 1.47 |
| PF05037 | DUF669 | 0.74 |
| PF13479 | AAA_24 | 0.74 |
| PF08291 | Peptidase_M15_3 | 0.74 |
| PF13229 | Beta_helix | 0.74 |
| PF01612 | DNA_pol_A_exo1 | 0.74 |
| PF11351 | GTA_holin_3TM | 0.74 |
| PF01227 | GTP_cyclohydroI | 0.74 |
| PF03819 | MazG | 0.74 |
| PF07486 | Hydrolase_2 | 0.74 |
| PF00383 | dCMP_cyt_deam_1 | 0.74 |
| PF13203 | DUF2201_N | 0.74 |
| PF05866 | RusA | 0.74 |
| COG ID | Name | Functional Category | % Frequency in 136 Family Scaffolds |
|---|---|---|---|
| COG0749 | DNA polymerase I, 3'-5' exonuclease and polymerase domains | Replication, recombination and repair [L] | 2.21 |
| COG3773 | Cell wall hydrolase CwlJ, involved in spore germination | Cell cycle control, cell division, chromosome partitioning [D] | 0.74 |
| COG4570 | Holliday junction resolvase RusA (prophage-encoded endonuclease) | Replication, recombination and repair [L] | 0.74 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 83.21 % |
| Unclassified | root | N/A | 16.79 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002408|B570J29032_108880038 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
| 3300002408|B570J29032_109246494 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 653 | Open in IMG/M |
| 3300002408|B570J29032_109866587 | All Organisms → cellular organisms → Bacteria | 1780 | Open in IMG/M |
| 3300002408|B570J29032_109955899 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7706 | Open in IMG/M |
| 3300002835|B570J40625_100003299 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 30219 | Open in IMG/M |
| 3300002835|B570J40625_100170799 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2427 | Open in IMG/M |
| 3300002835|B570J40625_100289352 | All Organisms → Viruses → Predicted Viral | 1670 | Open in IMG/M |
| 3300004481|Ga0069718_14543430 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 794 | Open in IMG/M |
| 3300005581|Ga0049081_10016412 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2799 | Open in IMG/M |
| 3300006037|Ga0075465_10018492 | All Organisms → Viruses → Predicted Viral | 1358 | Open in IMG/M |
| 3300006805|Ga0075464_10029269 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2923 | Open in IMG/M |
| 3300006805|Ga0075464_10068561 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1994 | Open in IMG/M |
| 3300006805|Ga0075464_10078324 | All Organisms → Viruses → Predicted Viral | 1872 | Open in IMG/M |
| 3300006805|Ga0075464_10113698 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1566 | Open in IMG/M |
| 3300006805|Ga0075464_10119528 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1529 | Open in IMG/M |
| 3300006805|Ga0075464_10301835 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 964 | Open in IMG/M |
| 3300006920|Ga0070748_1044470 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1780 | Open in IMG/M |
| 3300006920|Ga0070748_1345088 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300007544|Ga0102861_1099318 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 777 | Open in IMG/M |
| 3300007708|Ga0102859_1196461 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 599 | Open in IMG/M |
| 3300007974|Ga0105747_1066694 | Not Available | 1084 | Open in IMG/M |
| 3300009039|Ga0105152_10116280 | Not Available | 1089 | Open in IMG/M |
| 3300009039|Ga0105152_10331609 | Not Available | 636 | Open in IMG/M |
| 3300009151|Ga0114962_10000693 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 29552 | Open in IMG/M |
| 3300009151|Ga0114962_10055127 | All Organisms → Viruses → Predicted Viral | 2602 | Open in IMG/M |
| 3300009151|Ga0114962_10070499 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2241 | Open in IMG/M |
| 3300009151|Ga0114962_10095075 | All Organisms → Viruses → Predicted Viral | 1865 | Open in IMG/M |
| 3300009158|Ga0114977_10022294 | All Organisms → Viruses → Predicted Viral | 3972 | Open in IMG/M |
| 3300009158|Ga0114977_10022939 | All Organisms → Viruses → Predicted Viral | 3911 | Open in IMG/M |
| 3300009158|Ga0114977_10224483 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1093 | Open in IMG/M |
| 3300009159|Ga0114978_10068555 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2391 | Open in IMG/M |
| 3300009159|Ga0114978_10299024 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 986 | Open in IMG/M |
| 3300009160|Ga0114981_10571858 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 601 | Open in IMG/M |
| 3300009161|Ga0114966_10010762 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7267 | Open in IMG/M |
| 3300009161|Ga0114966_10490905 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 701 | Open in IMG/M |
| 3300009164|Ga0114975_10015275 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4713 | Open in IMG/M |
| 3300009164|Ga0114975_10068519 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2071 | Open in IMG/M |
| 3300009164|Ga0114975_10269554 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 948 | Open in IMG/M |
| 3300009164|Ga0114975_10273622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → unclassified Methylocystis → Methylocystis sp. WRRC1 | 940 | Open in IMG/M |
| 3300009180|Ga0114979_10037084 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3080 | Open in IMG/M |
| 3300009183|Ga0114974_10051962 | All Organisms → Viruses → Predicted Viral | 2746 | Open in IMG/M |
| 3300010885|Ga0133913_11363733 | Not Available | 1806 | Open in IMG/M |
| 3300010885|Ga0133913_11397759 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1780 | Open in IMG/M |
| 3300011114|Ga0151515_10077 | Not Available | 38942 | Open in IMG/M |
| 3300011335|Ga0153698_1041 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 55456 | Open in IMG/M |
| 3300011335|Ga0153698_1041 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 55456 | Open in IMG/M |
| 3300011335|Ga0153698_1766 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12068 | Open in IMG/M |
| 3300011336|Ga0153703_1160 | Not Available | 24657 | Open in IMG/M |
| 3300011336|Ga0153703_1744 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10117 | Open in IMG/M |
| 3300011337|Ga0153702_1602 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 11758 | Open in IMG/M |
| 3300011339|Ga0153700_10151 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 34525 | Open in IMG/M |
| 3300013004|Ga0164293_10013686 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6823 | Open in IMG/M |
| 3300013004|Ga0164293_10078445 | All Organisms → Viruses → Predicted Viral | 2582 | Open in IMG/M |
| 3300013004|Ga0164293_10272441 | Not Available | 1185 | Open in IMG/M |
| 3300013004|Ga0164293_10288458 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1142 | Open in IMG/M |
| 3300013004|Ga0164293_10413630 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 905 | Open in IMG/M |
| 3300013004|Ga0164293_10530683 | Not Available | 773 | Open in IMG/M |
| 3300013004|Ga0164293_10569336 | Not Available | 739 | Open in IMG/M |
| 3300013005|Ga0164292_10017246 | Not Available | 5910 | Open in IMG/M |
| 3300017707|Ga0181363_1057730 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 686 | Open in IMG/M |
| 3300017747|Ga0181352_1018200 | All Organisms → Viruses → Predicted Viral | 2194 | Open in IMG/M |
| 3300017747|Ga0181352_1110669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax | 747 | Open in IMG/M |
| 3300017747|Ga0181352_1174074 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 561 | Open in IMG/M |
| 3300017754|Ga0181344_1025136 | All Organisms → Viruses → Predicted Viral | 1833 | Open in IMG/M |
| 3300017754|Ga0181344_1126270 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 736 | Open in IMG/M |
| 3300017754|Ga0181344_1143191 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 683 | Open in IMG/M |
| 3300017766|Ga0181343_1023161 | All Organisms → Viruses → Predicted Viral | 1908 | Open in IMG/M |
| 3300018416|Ga0181553_10412398 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 732 | Open in IMG/M |
| 3300018420|Ga0181563_10570721 | Not Available | 631 | Open in IMG/M |
| 3300019784|Ga0181359_1088878 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1148 | Open in IMG/M |
| 3300020161|Ga0211726_10379198 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5212 | Open in IMG/M |
| 3300020506|Ga0208091_1018618 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 815 | Open in IMG/M |
| 3300020530|Ga0208235_1017654 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 883 | Open in IMG/M |
| 3300020549|Ga0207942_1003596 | All Organisms → Viruses → Predicted Viral | 2390 | Open in IMG/M |
| 3300020549|Ga0207942_1018873 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 885 | Open in IMG/M |
| 3300020549|Ga0207942_1051553 | Not Available | 505 | Open in IMG/M |
| 3300020550|Ga0208600_1064532 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
| 3300022179|Ga0181353_1057663 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1007 | Open in IMG/M |
| 3300022179|Ga0181353_1068825 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 907 | Open in IMG/M |
| 3300022179|Ga0181353_1071497 | Not Available | 886 | Open in IMG/M |
| 3300023184|Ga0214919_10000479 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 68272 | Open in IMG/M |
| 3300023184|Ga0214919_10007591 | Not Available | 14571 | Open in IMG/M |
| 3300023184|Ga0214919_10653658 | Not Available | 607 | Open in IMG/M |
| 3300024348|Ga0244776_10229420 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1303 | Open in IMG/M |
| 3300025075|Ga0209615_100902 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2329 | Open in IMG/M |
| 3300025451|Ga0208426_1006924 | All Organisms → Viruses → Predicted Viral | 1610 | Open in IMG/M |
| 3300025896|Ga0208916_10133684 | All Organisms → Viruses → Predicted Viral | 1061 | Open in IMG/M |
| 3300025896|Ga0208916_10297921 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 702 | Open in IMG/M |
| 3300027734|Ga0209087_1157896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae | 905 | Open in IMG/M |
| 3300027734|Ga0209087_1313799 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 554 | Open in IMG/M |
| 3300027741|Ga0209085_1190620 | Not Available | 839 | Open in IMG/M |
| 3300027749|Ga0209084_1000514 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 36414 | Open in IMG/M |
| 3300027749|Ga0209084_1104655 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1241 | Open in IMG/M |
| 3300027754|Ga0209596_1279274 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 672 | Open in IMG/M |
| 3300027754|Ga0209596_1284008 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 664 | Open in IMG/M |
| 3300027759|Ga0209296_1005358 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8223 | Open in IMG/M |
| 3300027759|Ga0209296_1098180 | All Organisms → Viruses → Predicted Viral | 1404 | Open in IMG/M |
| 3300027759|Ga0209296_1276953 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 677 | Open in IMG/M |
| 3300027764|Ga0209134_10081636 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1096 | Open in IMG/M |
| 3300027805|Ga0209229_10006331 | Not Available | 4943 | Open in IMG/M |
| 3300027899|Ga0209668_10132933 | All Organisms → Viruses → Predicted Viral | 1490 | Open in IMG/M |
| 3300027969|Ga0209191_1144523 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 975 | Open in IMG/M |
| 3300028025|Ga0247723_1122846 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 632 | Open in IMG/M |
| 3300033992|Ga0334992_0064991 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2029 | Open in IMG/M |
| 3300033992|Ga0334992_0093384 | Not Available | 1621 | Open in IMG/M |
| 3300033992|Ga0334992_0281263 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 788 | Open in IMG/M |
| 3300033993|Ga0334994_0002899 | Not Available | 12411 | Open in IMG/M |
| 3300033993|Ga0334994_0111423 | All Organisms → Viruses → Predicted Viral | 1591 | Open in IMG/M |
| 3300033993|Ga0334994_0422442 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 638 | Open in IMG/M |
| 3300033995|Ga0335003_0015886 | Not Available | 4015 | Open in IMG/M |
| 3300033995|Ga0335003_0461056 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
| 3300033996|Ga0334979_0008964 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6937 | Open in IMG/M |
| 3300033996|Ga0334979_0033748 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3391 | Open in IMG/M |
| 3300033996|Ga0334979_0103011 | Not Available | 1774 | Open in IMG/M |
| 3300033996|Ga0334979_0196436 | All Organisms → Viruses → Predicted Viral | 1192 | Open in IMG/M |
| 3300033996|Ga0334979_0269928 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 976 | Open in IMG/M |
| 3300033996|Ga0334979_0420238 | Not Available | 735 | Open in IMG/M |
| 3300034012|Ga0334986_0024240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 4078 | Open in IMG/M |
| 3300034022|Ga0335005_0017272 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5091 | Open in IMG/M |
| 3300034060|Ga0334983_0120698 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1675 | Open in IMG/M |
| 3300034068|Ga0334990_0072893 | All Organisms → Viruses → Predicted Viral | 1846 | Open in IMG/M |
| 3300034082|Ga0335020_0021558 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3637 | Open in IMG/M |
| 3300034082|Ga0335020_0452957 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 613 | Open in IMG/M |
| 3300034093|Ga0335012_0217116 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1006 | Open in IMG/M |
| 3300034093|Ga0335012_0239316 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 945 | Open in IMG/M |
| 3300034093|Ga0335012_0470935 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 601 | Open in IMG/M |
| 3300034095|Ga0335022_0044558 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2925 | Open in IMG/M |
| 3300034095|Ga0335022_0121500 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1645 | Open in IMG/M |
| 3300034104|Ga0335031_0132736 | All Organisms → Viruses → Predicted Viral | 1733 | Open in IMG/M |
| 3300034104|Ga0335031_0135267 | All Organisms → cellular organisms → Bacteria | 1714 | Open in IMG/M |
| 3300034107|Ga0335037_0169176 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1196 | Open in IMG/M |
| 3300034117|Ga0335033_0034861 | Not Available | 3171 | Open in IMG/M |
| 3300034167|Ga0335017_0003249 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8447 | Open in IMG/M |
| 3300034200|Ga0335065_0420718 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 815 | Open in IMG/M |
| 3300034283|Ga0335007_0182602 | All Organisms → Viruses → Predicted Viral | 1473 | Open in IMG/M |
| 3300034356|Ga0335048_0443075 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
| 3300034357|Ga0335064_0024026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 3244 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 32.85% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 22.63% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 9.49% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 8.76% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 6.57% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 5.11% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 2.92% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.19% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.46% |
| Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment | 1.46% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.46% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.73% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.73% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.73% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.73% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.73% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.73% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.73% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300006037 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
| 3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300009039 | Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cm | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011114 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2016Feb | Environmental | Open in IMG/M |
| 3300011335 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Guman | Environmental | Open in IMG/M |
| 3300011336 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Paldang | Environmental | Open in IMG/M |
| 3300011337 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Ilsan | Environmental | Open in IMG/M |
| 3300011339 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Hannam | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020530 | Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020549 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020550 | Freshwater microbial communities from Lake Mendota, WI - 08OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300025075 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - 4B3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025451 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
| 3300034060 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16May2013-rr0016 | Environmental | Open in IMG/M |
| 3300034068 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031 | Environmental | Open in IMG/M |
| 3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034095 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034107 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Apr2017-rr0133 | Environmental | Open in IMG/M |
| 3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
| 3300034167 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Apr2015-rr0082 | Environmental | Open in IMG/M |
| 3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| 3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
| 3300034357 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME12May2017-rr0187 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J29032_1088800382 | 3300002408 | Freshwater | MKDDDVEDLFAYGWLDTSIAIVLALLALVALSFFAGYLL* |
| B570J29032_1092464942 | 3300002408 | Freshwater | MKDDEVEDLFAYGWLDTSIAIVLALLAIAALFFMAGYLT* |
| B570J29032_1098665873 | 3300002408 | Freshwater | MKDDEVEGLFAWGWLDLALAVILTLLAIAALFFAAGYLL* |
| B570J29032_10995589912 | 3300002408 | Freshwater | MKDDEVENLFAYGWLDTALAIVLALLAIAALFFMAGYLS* |
| B570J40625_10000329931 | 3300002835 | Freshwater | MKDDDVEDLFAYGWLDTGIAIVLALLAIAALSFFAGYLT* |
| B570J40625_1001707995 | 3300002835 | Freshwater | MNDDEVEGLFAWGWLDLALAVILTLLAIAALFFAAGYLT* |
| B570J40625_1002893524 | 3300002835 | Freshwater | MKDDEVEGLFAWGWFDLALAVILTLLAIAALFFAAGYLI* |
| Ga0069718_145434303 | 3300004481 | Sediment | VKDDDEDQFLFAYGWLDTAIAIILALCTLAAVFFALGYLL* |
| Ga0049081_100164126 | 3300005581 | Freshwater Lentic | DMKDDEVENLFKYGWLDTCIAIVLALLAVAALFFMAGYLT* |
| Ga0075465_100184926 | 3300006037 | Aqueous | MKDDEVENLFAYGWIDAAVAIAIALLALVALFFMAGYLT* |
| Ga0075464_100292695 | 3300006805 | Aqueous | MKDDEVENLFAYGWIDAAVAIAIALIALVALFFMAGYLI* |
| Ga0075464_100685618 | 3300006805 | Aqueous | MKDDDVEDLFKYGWLDAAVAIAIALLAIVALFFMAGYLT* |
| Ga0075464_100783242 | 3300006805 | Aqueous | MKDDEIENLFKYSWLDAALAIALALLALVSLFFLEGYLI* |
| Ga0075464_101136985 | 3300006805 | Aqueous | MKDDEVENLFAYGWIDAAVAIVIALLALVALFFMAGYLT* |
| Ga0075464_101195284 | 3300006805 | Aqueous | MKDDEVENLFAYSWLDAAVAIAIALLAIVALFFFARQLT* |
| Ga0075464_103018353 | 3300006805 | Aqueous | MKDDEIENLFKYGWIDASIAIAIALLALVALFFFAGYLT* |
| Ga0070748_10444701 | 3300006920 | Aqueous | MKDDEVENLFAYSWLDAAVAIAIALLAIVALFFFAGYLT* |
| Ga0070748_13450881 | 3300006920 | Aqueous | MKDDEVENLFAYGWLDTCIAIVLALLAIAALFFVAGYLT* |
| Ga0102861_10993181 | 3300007544 | Estuarine | MKDDEIEDLFKYGWLDTAVAIVLALLAIAALFFMAGYLI* |
| Ga0102859_11964613 | 3300007708 | Estuarine | MKDDEIENLFKYSWLDAALAIALALIAMVSLFFLAGYLT* |
| Ga0105747_10666941 | 3300007974 | Estuary Water | MKDDEIEDLFKYGWLDTAVAIVLALLAIAALFFMAG |
| Ga0105152_101162802 | 3300009039 | Lake Sediment | MKDDDEDKFLFAYGWIDTALTIFLTLLALAALFFLAGYLI* |
| Ga0105152_103316093 | 3300009039 | Lake Sediment | MKDDEEDQFLFAYGWIDTAIAIILALCTLAALFFLA |
| Ga0114962_1000069315 | 3300009151 | Freshwater Lake | MNDDNEEGLFAYSWMDFALAIVLTLLALAALFFLAGYLI* |
| Ga0114962_100551275 | 3300009151 | Freshwater Lake | MQLAITGESDMKDDEVENLFDYSWLDAAVAIVIALLALVALFFFARQLT* |
| Ga0114962_100704996 | 3300009151 | Freshwater Lake | MKDDEVENLFAYGWLDAAISIAIALLAMVALFFFAGYLT* |
| Ga0114962_100950754 | 3300009151 | Freshwater Lake | MKDDEVENLFAYGWLDAAISIAIALLALVALFFFARYLT* |
| Ga0114977_100222941 | 3300009158 | Freshwater Lake | MKDDEIENLFAYGWLDAAISIAIALLAMVALFFFAGYLT* |
| Ga0114977_100229391 | 3300009158 | Freshwater Lake | EGTEMKDDEVENLFAYGWLDAAVAIAIALLALVALFFFAGYLT* |
| Ga0114977_102244832 | 3300009158 | Freshwater Lake | MKDDEVENLFAYGWIDAAVAIAIALLAIVALFFMAGYLT* |
| Ga0114978_100685555 | 3300009159 | Freshwater Lake | MKDDEVEDLFKYGWIDASIAIVIALLALVALFFLAGYLT* |
| Ga0114978_102990244 | 3300009159 | Freshwater Lake | MKDDEIEDLFKYGWIDASIAIAIALLALVALFFFARYLT* |
| Ga0114981_105718582 | 3300009160 | Freshwater Lake | MKDDEVENLFAYGWLDAAVAIAIALLALVALFFFAGYLT* |
| Ga0114966_100107627 | 3300009161 | Freshwater Lake | MKDDDVEDLFKYGWLDATVAIVIALLAIVALFFFAGYLT* |
| Ga0114966_104909052 | 3300009161 | Freshwater Lake | MKDDEIENLFAYGWLDSGIAIVIALLAIVALFFFARYLT* |
| Ga0114975_100152755 | 3300009164 | Freshwater Lake | MKDDEVENLFAYSWLDAAVAIAIALLAIAALFFFAGYLT* |
| Ga0114975_100685194 | 3300009164 | Freshwater Lake | MKDDEVEDLFKYGWIDASIAIAIALLALVALFFLAGYLT* |
| Ga0114975_102695543 | 3300009164 | Freshwater Lake | MKDDEVEDLFAWGWIKASIAIVIALLALVALFFAAGYLT* |
| Ga0114975_102736223 | 3300009164 | Freshwater Lake | MKDDEIENLFKYGWLDAAVAIAIALLALVALFFAARYLT* |
| Ga0114979_100370844 | 3300009180 | Freshwater Lake | MKDDEVEDLFKYGWIDASIAIVIALLALVALFFMAGYLT* |
| Ga0114974_100519623 | 3300009183 | Freshwater Lake | MKDDEIENLFAYGWIDAAVAIAIALLALVALFFMAGYLT* |
| Ga0133913_113637335 | 3300010885 | Freshwater Lake | MKDDNEEGLFAYGWMDCALAIVLTLLALAALFFLAGYLI* |
| Ga0133913_113977591 | 3300010885 | Freshwater Lake | MKDDDVEDLFAYGWLDTALAIVLALLALVALFFMAGYLT* |
| Ga0151515_1007736 | 3300011114 | Freshwater | MKDDEVEGLFAYGWLDLALAVILTLLAVAALFFAAGYLI* |
| Ga0153698_104115 | 3300011335 | Freshwater | MKDDEIEDLFKYGWIDTAVAIVLALLALVALFFMVGYLT* |
| Ga0153698_104165 | 3300011335 | Freshwater | MKDDEVENLFKYGWLDTSIAIAIALLAMVALFFFAGYLT* |
| Ga0153698_176612 | 3300011335 | Freshwater | MKDDDVEDLFAYGWLDTALAIVLALVALVALSFFAGYLT* |
| Ga0153703_116015 | 3300011336 | Freshwater | MKDDDENLFAYGWLDTAIAIILALCTLAALFFALGYLL* |
| Ga0153703_174415 | 3300011336 | Freshwater | MKDDDEDKFLFAYGWLDTALAIVLTLLAMAALFFLAGYLL* |
| Ga0153702_160216 | 3300011337 | Freshwater | MKDDEVENLFAYGWLDSAVAIVLALLALVALSFFAGYLT* |
| Ga0153700_101519 | 3300011339 | Freshwater | MKDDEVENLFAYGWLDTAVAIALALLAIAALFFMAGYLT* |
| Ga0164293_1001368620 | 3300013004 | Freshwater | MKDDDVEDLFAYGWLDTALAIVLALVALVALSFFAGYLI* |
| Ga0164293_100784459 | 3300013004 | Freshwater | MKDDEIEDLFAYGWLDTALAIVLALLALVALSFFAGYLT* |
| Ga0164293_102724412 | 3300013004 | Freshwater | MKDDEVENLFAYGWLDTGIAIVLALLALVSLFFLEGYLT* |
| Ga0164293_102884582 | 3300013004 | Freshwater | MKDDEVENLFAYGWLDTAVAIVLALLALVALSFFAGYLI* |
| Ga0164293_104136301 | 3300013004 | Freshwater | MKDDEVENLFAYGWLDTALAIVLALLALVALSFFAGYLT* |
| Ga0164293_105306832 | 3300013004 | Freshwater | MKDDEIEDLFKYGWLDTGIAIVLALLALVSLFFLEGYLT* |
| Ga0164293_105693364 | 3300013004 | Freshwater | MKDDDVEDLFAYGWLDTGIAIVLALAALVALSFFAGYLI* |
| Ga0164292_100172469 | 3300013005 | Freshwater | MKDDEIEDLFAYGWIDTALAIVLALLALVALSFFAGYLI* |
| Ga0181363_10577301 | 3300017707 | Freshwater Lake | DMKDDEIEDLFKYGWLDTAVAIVLALLAIAALFFMAGYLT |
| Ga0181352_10182003 | 3300017747 | Freshwater Lake | MKDDEVEDLFAYGWLDTAVAIILALLALVALSFFAGYLI |
| Ga0181352_11106691 | 3300017747 | Freshwater Lake | MKDDDVEDLFAYGWLDTALAIVLALLALVALSFFAGYLI |
| Ga0181352_11740743 | 3300017747 | Freshwater Lake | MKDDDVEDLFKYGWLDTAVAIAIALLAIAALFFMAGYLI |
| Ga0181344_10251363 | 3300017754 | Freshwater Lake | MKDDEIEDLFKYGWLDTALAIVLALVALVALSFFAGYLT |
| Ga0181344_11262703 | 3300017754 | Freshwater Lake | MKDDEIEDLFKYGWLDTAVAIAIALLAIAALFFMAGYLI |
| Ga0181344_11431913 | 3300017754 | Freshwater Lake | MKDDEIEDLFEYGWLDTGIAIVLALLAIAALSFFAGYLS |
| Ga0181343_10231616 | 3300017766 | Freshwater Lake | MKDDDVEDLFAYGWLDTAVAILLALLALVALSFFAGYLI |
| Ga0181553_104123983 | 3300018416 | Salt Marsh | GMKDDEVENLFAYSWLDAAVAIAIALLAIVALFFMAGYLT |
| Ga0181563_105707213 | 3300018420 | Salt Marsh | MKDDEVENLFAYSWLDAAVAIAIALLAIVALFFMAGYLT |
| Ga0181359_10888781 | 3300019784 | Freshwater Lake | MKDDEIEDLFKYGWLDTSIAIVLALVALVALSFFAGYLT |
| Ga0211726_1037919814 | 3300020161 | Freshwater | MKDDDENLFAYGWLDTAIAIILALCTLAAVFFALGYLL |
| Ga0208091_10186183 | 3300020506 | Freshwater | MKDDDVEDLFAYGWLDTGIAIVLALLAIAALSFFAGYLT |
| Ga0208235_10176542 | 3300020530 | Freshwater | MKDDEVENLFAYGWLDTALAIVLALLAIAALFFMAGYLS |
| Ga0207942_10035966 | 3300020549 | Freshwater | MKDDEVEDLFAYGWLDTSIAIVLALLAIAALFFMAGYLT |
| Ga0207942_10188732 | 3300020549 | Freshwater | MKDDEVEGLFAWGWLDLALAVILTLLAIAALFFAAGYLL |
| Ga0207942_10515531 | 3300020549 | Freshwater | MKDDEVEGLFAWGWFDLALAVILTLLAIAALFFAAGYLI |
| Ga0208600_10645323 | 3300020550 | Freshwater | MKDDEVENLFAYGWLDTALAIVLALLAIAALFFMAG |
| Ga0181353_10576633 | 3300022179 | Freshwater Lake | MKDDDVEDLFKYGWLDTALAIVLALVALVALSFFAGYLT |
| Ga0181353_10688251 | 3300022179 | Freshwater Lake | MKDDEIEDLFKYGWLDTAVAIVLALLAIAALFFMAGYLT |
| Ga0181353_10714971 | 3300022179 | Freshwater Lake | MKDDEVENLFAYGWLDTSIAIVLALVALVALSFFAGYLT |
| Ga0214919_1000047951 | 3300023184 | Freshwater | MKDDEVEDLFAYGWLDTAIAIVLALLAIAALFFFAGYLT |
| Ga0214919_1000759115 | 3300023184 | Freshwater | MKDDEIENLFAYGWIDAAVAIAIALLALVALFFFAGYLT |
| Ga0214919_106536582 | 3300023184 | Freshwater | MKDDEVENLFAYGWLDAAVAIVIALLAIVALFFMAGYLT |
| Ga0244776_102294203 | 3300024348 | Estuarine | MKDDEIENLFKYSWLDAALAIALALIAMVSLFFLAGYLT |
| Ga0209615_10090210 | 3300025075 | Freshwater | MKDDDEDLFKYGWLDTAISIILALCTLAAVFFALGYLL |
| Ga0208426_10069246 | 3300025451 | Aqueous | MKDDEVENLFAYGWIDAAVAIAIALLALVALFFMAGYLT |
| Ga0208916_101336842 | 3300025896 | Aqueous | MKDDEIENLFKYSWLDAALAIALALLALVSLFFLEGYLI |
| Ga0208916_102979212 | 3300025896 | Aqueous | MKDDEIENLFKYGWIDASIAIAIALLALVALFFFAGYLT |
| Ga0209087_11578962 | 3300027734 | Freshwater Lake | MKDDEVENLFAYSWLDAAVAIAIALLALVALFFMAGYLT |
| Ga0209087_13137991 | 3300027734 | Freshwater Lake | MKDDEVEDLFKYGWIDASIAIAIALLALVALFFLAGYLT |
| Ga0209085_11906203 | 3300027741 | Freshwater Lake | MKDDEVENLFAYGWLDAAISIAIALLALVALFFFARYLT |
| Ga0209084_100051415 | 3300027749 | Freshwater Lake | MNDDNEEGLFAYSWMDFALAIVLTLLALAALFFLAGYLI |
| Ga0209084_11046552 | 3300027749 | Freshwater Lake | MKDDEVENLFDYSWLDAAVAIVIALLALVALFFFARQLT |
| Ga0209596_12792743 | 3300027754 | Freshwater Lake | MKDDDVEDLFKYGWLDATVAIVIALLAIVALFFFAGYLT |
| Ga0209596_12840083 | 3300027754 | Freshwater Lake | MKDDEIENLFAYGWLDSGIAIVIALLAIVALFFFARYLT |
| Ga0209296_10053584 | 3300027759 | Freshwater Lake | MKDDEVENLFAYSWLDAAVAIAIALLAIAALFFFAGYLT |
| Ga0209296_10981805 | 3300027759 | Freshwater Lake | MKDDEIENLFKYGWLDAAVAIAIALLALVALFFAARYLT |
| Ga0209296_12769531 | 3300027759 | Freshwater Lake | MKDDEVENLFAYGWIDAAVAIAIALLAIVALFFMAGYLT |
| Ga0209134_100816363 | 3300027764 | Freshwater Lake | MKDDDVEDLFAYGWRDTGIAIVLALLAIAALFFMAGYLS |
| Ga0209229_100063316 | 3300027805 | Freshwater And Sediment | MKDDEIEDLFKYGWLDTGIAIVLALLALVSLFFLEGYLT |
| Ga0209668_101329332 | 3300027899 | Freshwater Lake Sediment | MKDDEVENLFAYGWLDTCIAIVLALLAIAALFFVAGYLT |
| Ga0209191_11445233 | 3300027969 | Freshwater Lake | MKDDEVEDLFAWGWIKASIAIVIALLALVALFFAAGYLT |
| Ga0247723_11228462 | 3300028025 | Deep Subsurface Sediment | MKDDDEDLFKYGWIDTALAIILTLLAMAALFFLAGYLI |
| Ga0334992_0064991_500_619 | 3300033992 | Freshwater | MKDDDVEDLFAYGWIDTALAIVLALVALVALSFFAGYLT |
| Ga0334992_0093384_775_894 | 3300033992 | Freshwater | MKDDEIEDLFKYGWIDASVAIGIALLAIVALFFAAGYLT |
| Ga0334992_0281263_581_700 | 3300033992 | Freshwater | MKDDEVEDLFAYGWIDTSIAIVLALVALVALSFFAGYLI |
| Ga0334994_0002899_8350_8469 | 3300033993 | Freshwater | MNDDEVEGLFAWGWLDLALAVILTLLAIAALFFAAGYLT |
| Ga0334994_0111423_1412_1531 | 3300033993 | Freshwater | MKDDEVEGLFAWGWLDLALAVILTLLAIAALFFAAGYLT |
| Ga0334994_0422442_207_326 | 3300033993 | Freshwater | MKDDDVEDLFAYGWLDTSIAIVLALLALVALSFFAGYLL |
| Ga0335003_0015886_1124_1243 | 3300033995 | Freshwater | MKDDEVENLFAYGWLDTAVAIAIALLALVALFFMVGYLT |
| Ga0335003_0461056_329_448 | 3300033995 | Freshwater | MKDDEIEDLFAYGWIDTALAIVLALLALVALSFFAGYLI |
| Ga0334979_0008964_6734_6853 | 3300033996 | Freshwater | MKDDDVEDLFAYGWLDTALAIVLALVALVALSFFAGYLI |
| Ga0334979_0033748_3247_3366 | 3300033996 | Freshwater | MKDDEVENLFAYGWLDTAVAIVLALLALVALSFFAGYLI |
| Ga0334979_0103011_662_781 | 3300033996 | Freshwater | MKDDEVENLFAYGWLDTGIAIVLALLALVSLFFLEGYLT |
| Ga0334979_0196436_250_369 | 3300033996 | Freshwater | MKDDEIEDLFAYGWLDTALAIVLALLALVALSFFAGYLT |
| Ga0334979_0269928_807_926 | 3300033996 | Freshwater | MKDDEVENLFAYGWLDTALAIVLALLALVALSFFAGYLT |
| Ga0334979_0420238_532_651 | 3300033996 | Freshwater | MKDDDVEDLFAYGWLDTGIAIVLALAALVALSFFAGYLI |
| Ga0334986_0024240_247_366 | 3300034012 | Freshwater | MKDDEVENLFAYGWLDTAVAIVLALLALVALSFFAGYLT |
| Ga0335005_0017272_422_541 | 3300034022 | Freshwater | MKDDEVENLFAYGWIDTALAIVLALLAIAAIFFMAGYLT |
| Ga0334983_0120698_1011_1130 | 3300034060 | Freshwater | MKDDEVEDLFAYGWLDTALAIVLALLALVALSFFAGYLT |
| Ga0334990_0072893_1065_1184 | 3300034068 | Freshwater | MKDDDVENLFKYGWLDTSIAIVLALLALVALFFMAGYLT |
| Ga0335020_0021558_2396_2515 | 3300034082 | Freshwater | MKDDEVENLFAYGWLDTAIAIVLALLAIAALFFMAGYLT |
| Ga0335020_0452957_55_174 | 3300034082 | Freshwater | MKDDDVEDLFAYGWIDTALAIVLALVALVALSFFAGYLI |
| Ga0335012_0217116_791_910 | 3300034093 | Freshwater | MKDDEIEDLFKYGWLDTGIAIVLALVALVALSFFAGYLT |
| Ga0335012_0239316_536_655 | 3300034093 | Freshwater | MKDDDVEDLFAYGWLDTAVAIVLALLALVALSFFAGYLI |
| Ga0335012_0470935_75_194 | 3300034093 | Freshwater | MKDDEVENLFKYSWLDAALAIALALLAIAALFFMAGYLI |
| Ga0335022_0044558_871_990 | 3300034095 | Freshwater | MKDDDVEDLFAYGWIDTAVAIVLALLALVALFFMAGYLT |
| Ga0335022_0121500_1537_1644 | 3300034095 | Freshwater | DVEDLFAYGWLDTSIAIVLALLAIAALFFMAGYLT |
| Ga0335031_0132736_1445_1564 | 3300034104 | Freshwater | MKDDEIEDLFAYGWLDTAVAIFLALLALVALFFMAGYLT |
| Ga0335031_0135267_125_241 | 3300034104 | Freshwater | MKDDEVGLFAWGWLDLALAVILTLLAIAALFFAAGYLL |
| Ga0335037_0169176_259_378 | 3300034107 | Freshwater | MKDDDVEDLFAYGWIDTSVAIAVALLALVALFFMVGYLT |
| Ga0335033_0034861_3065_3169 | 3300034117 | Freshwater | MKDDEIEDLFKYGWIDASVAIGIALLAIVALFFAA |
| Ga0335017_0003249_5655_5774 | 3300034167 | Freshwater | MKDDDVEDLFKYGWIDASIAIAIALLAIAAIFFMAGYLT |
| Ga0335065_0420718_701_814 | 3300034200 | Freshwater | DDEVEDLFAYGWLDTALAIVLALLALVALSFFAGYLT |
| Ga0335007_0182602_228_347 | 3300034283 | Freshwater | MKDDEIEDLFKYGWIDTALAIVLALVAIAAIFFMAGYLT |
| Ga0335048_0443075_117_236 | 3300034356 | Freshwater | MKDDDVEDLFAYGWLDTAVAIVLALLAIAALFFMAGYLL |
| Ga0335064_0024026_3091_3210 | 3300034357 | Freshwater | MKDDEVENLFAYGWLDTAVAIVLALLALVALFFMAGYLT |
| ⦗Top⦘ |