Metagenome / Metatranscriptome Family F056384

Overview

Basic Information

• Family ID: F056384
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 137
• Average Sequence Length: 42 residues
• Representative Sequence: QGLARVLAHGFVAPLANIPDIGCGSLRALSQNRDSASRVSLC
• Number of Associated Samples: 91
• Number of Associated Scaffolds: 137

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Bacteria
• % of genes with valid RBS motifs: 26.47 %
• % of genes near scaffold ends (potentially truncated): 86.13 %
• % of genes from short scaffolds (< 2000 bps): 83.21 %
• Associated GOLD sequencing projects: 90
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.30

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Bacteria (71.533 % of family members)
• NCBI Taxonomy ID: 2
• Taxonomy: All Organisms → cellular organisms → Bacteria

Most Common Ecosystem

• GOLD Ecosystem: Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil (46.715 % of family members)
• Environment Ontology (ENVO): Unclassified (56.934 % of family members)
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Subsurface (non-saline) (64.964 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Fibrous
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 47.14%
  β-sheet: 0.00%
  Coil/Unstructured: 52.86%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 137 Family Scaffolds
PF03401	TctC	3.65
PF06808	DctM	2.19
PF03641	Lysine_decarbox	2.19
PF00034	Cytochrom_C	1.46
PF01066	CDP-OH_P_transf	1.46
PF13242	Hydrolase_like	1.46
PF06580	His_kinase	1.46
PF02777	Sod_Fe_C	1.46
PF02515	CoA_transf_3	1.46
PF03881	Fructosamin_kin	1.46
PF00076	RRM_1	1.46
PF00561	Abhydrolase_1	1.46
PF11412	DsbC	1.46
PF00175	NAD_binding_1	1.46
PF02844	GARS_N	0.73
PF14076	DUF4258	0.73
PF03061	4HBT	0.73
PF01206	TusA	0.73
PF07690	MFS_1	0.73
PF07726	AAA_3	0.73
PF07883	Cupin_2	0.73
PF02784	Orn_Arg_deC_N	0.73
PF12643	MazG-like	0.73
PF13742	tRNA_anti_2	0.73
PF00342	PGI	0.73
PF01565	FAD_binding_4	0.73
PF00180	Iso_dh	0.73
PF03992	ABM	0.73
PF08695	Coa1	0.73
PF02313	Fumarate_red_D	0.73
PF05199	GMC_oxred_C	0.73
PF00334	NDK	0.73
PF07681	DoxX	0.73
PF01257	2Fe-2S_thioredx	0.73
PF01300	Sua5_yciO_yrdC	0.73
PF07366	SnoaL	0.73
PF05157	T2SSE_N	0.73
PF07244	POTRA	0.73
PF02738	MoCoBD_1	0.73
PF00069	Pkinase	0.73
PF00990	GGDEF	0.73
PF16491	Peptidase_M48_N	0.73
PF00248	Aldo_ket_red	0.73
PF13478	XdhC_C	0.73
PF00033	Cytochrome_B	0.73
PF13292	DXP_synthase_N	0.73
PF00266	Aminotran_5	0.73
PF13247	Fer4_11	0.73
PF08207	EFP_N	0.73
PF00892	EamA	0.73
PF01042	Ribonuc_L-PSP	0.73
PF00581	Rhodanese	0.73
PF00795	CN_hydrolase	0.73
PF07072	ZapD	0.73
PF02852	Pyr_redox_dim	0.73
PF16177	ACAS_N	0.73
PF00497	SBP_bac_3	0.73
PF08282	Hydrolase_3	0.73
PF00216	Bac_DNA_binding	0.73
PF00009	GTP_EFTU	0.73
PF13366	PDDEXK_3	0.73
PF02817	E3_binding	0.73
PF03972	MmgE_PrpD	0.73
PF00174	Oxidored_molyb	0.73
PF00691	OmpA	0.73
PF04909	Amidohydro_2	0.73
PF02803	Thiolase_C	0.73
PF08502	LeuA_dimer	0.73
PF01494	FAD_binding_3	0.73
PF02540	NAD_synthase	0.73
PF00586	AIRS	0.73
PF13472	Lipase_GDSL_2	0.73
PF14492	EFG_III	0.73
PF08459	UvrC_RNaseH_dom	0.73
PF13489	Methyltransf_23	0.73
PF00293	NUDIX	0.73
PF02616	SMC_ScpA	0.73
PF04166	PdxA	0.73
PF02653	BPD_transp_2	0.73
PF08501	Shikimate_dh_N	0.73
PF02746	MR_MLE_N	0.73
PF04355	SmpA_OmlA	0.73
PF00406	ADK	0.73
PF14693	Ribosomal_TL5_C	0.73
PF04945	YHS	0.73
PF02776	TPP_enzyme_N	0.73
PF00313	CSD	0.73
PF06629	MipA	0.73
PF02780	Transketolase_C	0.73
PF13714	PEP_mutase	0.73
PF13549	ATP-grasp_5	0.73
PF00027	cNMP_binding	0.73

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 137 Family Scaffolds
COG3181	Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC	Energy production and conversion [C]	3.65
COG0515	Serine/threonine protein kinase	Signal transduction mechanisms [T]	2.92
COG1611	Nucleotide monophosphate nucleosidase PpnN/YdgH, Lonely Guy (LOG) family	Nucleotide transport and metabolism [F]	2.19
COG1183	Phosphatidylserine synthase	Lipid transport and metabolism [I]	1.46
COG5050	sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferases	Lipid transport and metabolism [I]	1.46
COG4948	L-alanine-DL-glutamate epimerase or related enzyme of enolase superfamily	Cell wall/membrane/envelope biogenesis [M]	1.46
COG3275	Sensor histidine kinase, LytS/YehU family	Signal transduction mechanisms [T]	1.46
COG3001	Fructosamine-3-kinase	Carbohydrate transport and metabolism [G]	1.46
COG2972	Sensor histidine kinase YesM	Signal transduction mechanisms [T]	1.46
COG1804	Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases	Lipid transport and metabolism [I]	1.46
COG0654	2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases	Energy production and conversion [C]	1.46
COG0605	Superoxide dismutase	Inorganic ion transport and metabolism [P]	1.46
COG0558	Phosphatidylglycerophosphate synthase	Lipid transport and metabolism [I]	1.46
COG0166	Glucose-6-phosphate isomerase	Carbohydrate transport and metabolism [G]	0.73
COG2041	Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases	Energy production and conversion [C]	0.73
COG2079	2-methylcitrate dehydratase PrpD	Carbohydrate transport and metabolism [G]	0.73
COG2217	Cation-transporting P-type ATPase	Inorganic ion transport and metabolism [P]	0.73
COG2259	Uncharacterized membrane protein YphA, DoxX/SURF4 family	Function unknown [S]	0.73
COG2303	Choline dehydrogenase or related flavoprotein	Lipid transport and metabolism [I]	0.73
COG2913	Outer membrane protein assembly factor BamE, lipoprotein component of the BamABCDE complex	Cell wall/membrane/envelope biogenesis [M]	0.73
COG0171	NH3-dependent NAD+ synthetase	Coenzyme transport and metabolism [H]	0.73
COG0169	Shikimate 5-dehydrogenase	Amino acid transport and metabolism [E]	0.73
COG3080	Fumarate reductase subunit D	Energy production and conversion [C]	0.73
COG1995	4-hydroxy-L-threonine phosphate dehydrogenase PdxA	Coenzyme transport and metabolism [H]	0.73
COG0151	Phosphoribosylamine-glycine ligase	Nucleotide transport and metabolism [F]	0.73
COG3713	Outer membrane scaffolding protein for murein synthesis, MipA/OmpV family	Cell wall/membrane/envelope biogenesis [M]	0.73
COG3769	Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamily	Carbohydrate transport and metabolism [G]	0.73
COG3915	Uncharacterized conserved protein	Function unknown [S]	0.73
COG4270	Uncharacterized membrane protein	Function unknown [S]	0.73
COG4582	Cell division protein ZapD, interacts with FtsZ	Cell cycle control, cell division, chromosome partitioning [D]	0.73
COG0119	Isopropylmalate/homocitrate/citramalate synthases	Amino acid transport and metabolism [E]	0.73
COG0105	Nucleoside diphosphate kinase	Nucleotide transport and metabolism [F]	0.73
COG0776	Bacterial nucleoid DNA-binding protein IHF-alpha	Replication, recombination and repair [L]	0.73
COG0425	Sulfur carrier protein TusA (tRNA thiolation, molybdenum cofactor biosynthesis)	Translation, ribosomal structure and biogenesis [J]	0.73
COG0560	Phosphoserine phosphatase	Amino acid transport and metabolism [E]	0.73
COG0561	Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases	Coenzyme transport and metabolism [H]	0.73
COG0563	Adenylate kinase or related kinase	Nucleotide transport and metabolism [F]	0.73
COG0578	Glycerol-3-phosphate dehydrogenase	Energy production and conversion [C]	0.73
COG0322	Excinuclease UvrABC, nuclease subunit	Replication, recombination and repair [L]	0.73
COG0644	Dehydrogenase (flavoprotein)	Energy production and conversion [C]	0.73
COG0251	Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family	Defense mechanisms [V]	0.73
COG0665	Glycine/D-amino acid oxidase (deaminating)	Amino acid transport and metabolism [E]	0.73
COG0508	Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component	Energy production and conversion [C]	0.73
COG1166	Arginine decarboxylase (spermidine biosynthesis)	Amino acid transport and metabolism [E]	0.73
COG0019	Diaminopimelate decarboxylase	Amino acid transport and metabolism [E]	0.73
COG1290	Cytochrome b subunit of the bc complex	Energy production and conversion [C]	0.73
COG1354	Chromatin segregation and condensation protein Rec8/ScpA/Scc1, kleisin family	Replication, recombination and repair [L]	0.73
COG0231	Translation elongation factor P (EF-P)/translation initiation factor 5A (eIF-5A)	Translation, ribosomal structure and biogenesis [J]	0.73
COG0183	Acetyl-CoA acetyltransferase	Lipid transport and metabolism [I]	0.73
COG1877	Trehalose-6-phosphate phosphatase	Carbohydrate transport and metabolism [G]	0.73
COG1905	NADH:ubiquinone oxidoreductase 24 kD subunit (chain E)	Energy production and conversion [C]	0.73

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	72.99 %
Unclassified	root	N/A	27.01 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	72.99 %
Unclassified	root	N/A	27.01 %

Level 3

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	71.53 %
Unclassified	root	N/A	27.01 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	1.46 %

Level 4

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	52.55 %
Unclassified	root	N/A	27.01 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1.46 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	0.73 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	0.73 %

Level 5

Name	Rank	Taxonomy	Distribution
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	29.93 %
Unclassified	root	N/A	27.01 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	2.92 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	2.19 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2.19 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.73 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.73 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	0.73 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	0.73 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.01 %
unclassified Betaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria	8.76 %
Nitrosomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	3.65 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	2.19 %
Betaproteobacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis	1.46 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1.46 %
Neisseriales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales	0.73 %
unclassified Chloroflexi	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi	0.73 %
Chromatiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales	0.73 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	0.73 %
Acidiferrobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales	0.73 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	0.73 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.73 %
Enterobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales	0.73 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.01 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	5.11 %
Candidatus Accumulibacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter	1.46 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13	1.46 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_58	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_58	1.46 %
Nitrosomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae	0.73 %
Sulfuricellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae	0.73 %
Acidiferrobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae	0.73 %
Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_67_26	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_67_26	0.73 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.73 %
Chromobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae	0.73 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	0.73 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	0.73 %
Chromatiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	0.73 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	0.73 %
Myxococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	0.73 %
Streptomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales	0.73 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.73 %
unclassified Deltaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria	0.73 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.01 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	5.11 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13	1.46 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_58	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_58	1.46 %
Andreprevotia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Andreprevotia	0.73 %
unclassified Candidatus Accumulibacter	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter	0.73 %
Candidatus Tenderia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Candidatus Tenderia	0.73 %
Sulfurifustis	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Sulfurifustis	0.73 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.73 %
Sulfuricella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuricella	0.73 %
Protostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia	0.73 %
Streptomycetaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae	0.73 %
Sorangiineae	suborder	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae	0.73 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	0.73 %
Nitrosomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae	0.73 %
Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_67_26	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_67_26	0.73 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.73 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	0.73 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.73 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.01 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	5.11 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13	1.46 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_58	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_58	1.46 %
Sulfuricella denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuricella → Sulfuricella denitrificans	0.73 %
Andreprevotia chitinilytica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Andreprevotia → Andreprevotia chitinilytica	0.73 %
Ecdysozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa	0.73 %
Candidatus Tenderia electrophaga	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Candidatus Tenderia → Candidatus Tenderia electrophaga	0.73 %
Sulfurifustis variabilis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Sulfurifustis → Sulfurifustis variabilis	0.73 %
Candidatus Accumulibacter sp. SK-11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp. SK-11	0.73 %
Streptomyces	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces	0.73 %
Polyangiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae	0.73 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	0.73 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.73 %
Nitrosomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae	0.73 %
Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_67_26	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_67_26	0.73 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.73 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	0.73 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.73 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.01 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	5.11 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13	1.46 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_58	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_58	1.46 %
Streptomyces somaliensis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces somaliensis	0.73 %
Panarthropoda	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda	0.73 %
unclassified Polyangiaceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae	0.73 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	0.73 %
Sulfuricella denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuricella → Sulfuricella denitrificans	0.73 %
Andreprevotia chitinilytica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Andreprevotia → Andreprevotia chitinilytica	0.73 %
Candidatus Tenderia electrophaga	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Candidatus Tenderia → Candidatus Tenderia electrophaga	0.73 %
Sulfurifustis variabilis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Sulfurifustis → Sulfurifustis variabilis	0.73 %
Candidatus Accumulibacter sp. SK-11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp. SK-11	0.73 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.73 %
Nitrosomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae	0.73 %
Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_67_26	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_67_26	0.73 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.73 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	0.73 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.73 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.01 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	5.11 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13	1.46 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_58	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_58	1.46 %
Polyangiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium	0.73 %
Arthropoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda	0.73 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	0.73 %
Streptomyces somaliensis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces somaliensis	0.73 %
Sulfuricella denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuricella → Sulfuricella denitrificans	0.73 %
Andreprevotia chitinilytica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Andreprevotia → Andreprevotia chitinilytica	0.73 %
Candidatus Tenderia electrophaga	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Candidatus Tenderia → Candidatus Tenderia electrophaga	0.73 %
Sulfurifustis variabilis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Sulfurifustis → Sulfurifustis variabilis	0.73 %
Candidatus Accumulibacter sp. SK-11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp. SK-11	0.73 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.73 %
Nitrosomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae	0.73 %
Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_67_26	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_67_26	0.73 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.73 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	0.73 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.73 %

Level 12

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.01 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	5.11 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13	1.46 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_58	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_58	1.46 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	0.73 %
Chelicerata	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata	0.73 %
Polyangiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium	0.73 %
Streptomyces somaliensis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces somaliensis	0.73 %
Sulfuricella denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuricella → Sulfuricella denitrificans	0.73 %
Andreprevotia chitinilytica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Andreprevotia → Andreprevotia chitinilytica	0.73 %
Candidatus Tenderia electrophaga	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Candidatus Tenderia → Candidatus Tenderia electrophaga	0.73 %
Sulfurifustis variabilis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Sulfurifustis → Sulfurifustis variabilis	0.73 %
Candidatus Accumulibacter sp. SK-11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp. SK-11	0.73 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.73 %
Nitrosomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae	0.73 %
Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_67_26	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_67_26	0.73 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.73 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	0.73 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.73 %

Level 13

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.01 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	5.11 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13	1.46 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_58	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_58	1.46 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	0.73 %
Pycnogonida	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Pycnogonida	0.73 %
Polyangiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium	0.73 %
Streptomyces somaliensis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces somaliensis	0.73 %
Sulfuricella denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuricella → Sulfuricella denitrificans	0.73 %
Andreprevotia chitinilytica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Andreprevotia → Andreprevotia chitinilytica	0.73 %
Candidatus Tenderia electrophaga	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Candidatus Tenderia → Candidatus Tenderia electrophaga	0.73 %
Sulfurifustis variabilis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Sulfurifustis → Sulfurifustis variabilis	0.73 %
Candidatus Accumulibacter sp. SK-11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp. SK-11	0.73 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.73 %
Nitrosomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae	0.73 %
Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_67_26	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_67_26	0.73 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.73 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	0.73 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.73 %

Level 14

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.01 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	5.11 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13	1.46 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_58	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_58	1.46 %
Pantopoda	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Pycnogonida → Pantopoda	0.73 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	0.73 %
Polyangiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium	0.73 %
Streptomyces somaliensis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces somaliensis	0.73 %
Sulfuricella denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuricella → Sulfuricella denitrificans	0.73 %
Andreprevotia chitinilytica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Andreprevotia → Andreprevotia chitinilytica	0.73 %
Candidatus Tenderia electrophaga	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Candidatus Tenderia → Candidatus Tenderia electrophaga	0.73 %
Sulfurifustis variabilis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Sulfurifustis → Sulfurifustis variabilis	0.73 %
Candidatus Accumulibacter sp. SK-11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp. SK-11	0.73 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.73 %
Nitrosomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae	0.73 %
Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_67_26	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_67_26	0.73 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.73 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	0.73 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.73 %

Level 15

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.01 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	5.11 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13	1.46 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_58	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_58	1.46 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	0.73 %
Nymphonidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Pycnogonida → Pantopoda → Nymphonidae	0.73 %
Polyangiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium	0.73 %
Streptomyces somaliensis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces somaliensis	0.73 %
Sulfuricella denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuricella → Sulfuricella denitrificans	0.73 %
Andreprevotia chitinilytica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Andreprevotia → Andreprevotia chitinilytica	0.73 %
Candidatus Tenderia electrophaga	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Candidatus Tenderia → Candidatus Tenderia electrophaga	0.73 %
Sulfurifustis variabilis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Sulfurifustis → Sulfurifustis variabilis	0.73 %
Candidatus Accumulibacter sp. SK-11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp. SK-11	0.73 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.73 %
Nitrosomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae	0.73 %
Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_67_26	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_67_26	0.73 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.73 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	0.73 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.73 %

Level 16

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.01 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	5.11 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13	1.46 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_58	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_58	1.46 %
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	0.73 %
Nymphon	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Pycnogonida → Pantopoda → Nymphonidae → Nymphon	0.73 %
Polyangiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium	0.73 %
Streptomyces somaliensis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces somaliensis	0.73 %
Sulfuricella denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuricella → Sulfuricella denitrificans	0.73 %
Andreprevotia chitinilytica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Andreprevotia → Andreprevotia chitinilytica	0.73 %
Candidatus Tenderia electrophaga	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Candidatus Tenderia → Candidatus Tenderia electrophaga	0.73 %
Sulfurifustis variabilis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Sulfurifustis → Sulfurifustis variabilis	0.73 %
Candidatus Accumulibacter sp. SK-11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp. SK-11	0.73 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.73 %
Nitrosomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae	0.73 %
Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_67_26	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_67_26	0.73 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.73 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	0.73 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.73 %

Level 17

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.01 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	5.11 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13	1.46 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_58	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_58	1.46 %
Nymphon striatum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Pycnogonida → Pantopoda → Nymphonidae → Nymphon → Nymphon striatum	0.73 %
fabids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids	0.73 %
Polyangiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium	0.73 %
Streptomyces somaliensis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces somaliensis	0.73 %
Sulfuricella denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuricella → Sulfuricella denitrificans	0.73 %
Andreprevotia chitinilytica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Andreprevotia → Andreprevotia chitinilytica	0.73 %
Candidatus Tenderia electrophaga	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Candidatus Tenderia → Candidatus Tenderia electrophaga	0.73 %
Sulfurifustis variabilis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Sulfurifustis → Sulfurifustis variabilis	0.73 %
Candidatus Accumulibacter sp. SK-11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp. SK-11	0.73 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.73 %
Nitrosomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae	0.73 %
Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_67_26	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_67_26	0.73 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.73 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	0.73 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.73 %

Level 18

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.01 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	5.11 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13	1.46 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_58	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_58	1.46 %
Fabales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales	0.73 %
Nymphon striatum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Pycnogonida → Pantopoda → Nymphonidae → Nymphon → Nymphon striatum	0.73 %
Polyangiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium	0.73 %
Streptomyces somaliensis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces somaliensis	0.73 %
Sulfuricella denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuricella → Sulfuricella denitrificans	0.73 %
Andreprevotia chitinilytica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Andreprevotia → Andreprevotia chitinilytica	0.73 %
Candidatus Tenderia electrophaga	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Candidatus Tenderia → Candidatus Tenderia electrophaga	0.73 %
Sulfurifustis variabilis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Sulfurifustis → Sulfurifustis variabilis	0.73 %
Candidatus Accumulibacter sp. SK-11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp. SK-11	0.73 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.73 %
Nitrosomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae	0.73 %
Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_67_26	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_67_26	0.73 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.73 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	0.73 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.73 %

Level 19

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.01 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	5.11 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13	1.46 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_58	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_58	1.46 %
Fabaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae	0.73 %
Nymphon striatum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Pycnogonida → Pantopoda → Nymphonidae → Nymphon → Nymphon striatum	0.73 %
Polyangiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium	0.73 %
Streptomyces somaliensis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces somaliensis	0.73 %
Sulfuricella denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuricella → Sulfuricella denitrificans	0.73 %
Andreprevotia chitinilytica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Andreprevotia → Andreprevotia chitinilytica	0.73 %
Candidatus Tenderia electrophaga	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Candidatus Tenderia → Candidatus Tenderia electrophaga	0.73 %
Sulfurifustis variabilis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Sulfurifustis → Sulfurifustis variabilis	0.73 %
Candidatus Accumulibacter sp. SK-11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp. SK-11	0.73 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.73 %
Nitrosomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae	0.73 %
Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_67_26	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_67_26	0.73 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.73 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	0.73 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.73 %

Level 20

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.01 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	5.11 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13	1.46 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_58	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_58	1.46 %
Papilionoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae	0.73 %
Nymphon striatum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Pycnogonida → Pantopoda → Nymphonidae → Nymphon → Nymphon striatum	0.73 %
Polyangiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium	0.73 %
Streptomyces somaliensis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces somaliensis	0.73 %
Sulfuricella denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuricella → Sulfuricella denitrificans	0.73 %
Andreprevotia chitinilytica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Andreprevotia → Andreprevotia chitinilytica	0.73 %
Candidatus Tenderia electrophaga	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Candidatus Tenderia → Candidatus Tenderia electrophaga	0.73 %
Sulfurifustis variabilis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Sulfurifustis → Sulfurifustis variabilis	0.73 %
Candidatus Accumulibacter sp. SK-11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp. SK-11	0.73 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.73 %
Nitrosomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae	0.73 %
Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_67_26	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_67_26	0.73 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.73 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	0.73 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.73 %

Level 21

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.01 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	5.11 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13	1.46 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_58	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_58	1.46 %
50 kb inversion clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade	0.73 %
Nymphon striatum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Pycnogonida → Pantopoda → Nymphonidae → Nymphon → Nymphon striatum	0.73 %
Polyangiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium	0.73 %
Streptomyces somaliensis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces somaliensis	0.73 %
Sulfuricella denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuricella → Sulfuricella denitrificans	0.73 %
Andreprevotia chitinilytica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Andreprevotia → Andreprevotia chitinilytica	0.73 %
Candidatus Tenderia electrophaga	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Candidatus Tenderia → Candidatus Tenderia electrophaga	0.73 %
Sulfurifustis variabilis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Sulfurifustis → Sulfurifustis variabilis	0.73 %
Candidatus Accumulibacter sp. SK-11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp. SK-11	0.73 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.73 %
Nitrosomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae	0.73 %
Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_67_26	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_67_26	0.73 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.73 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	0.73 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.73 %

Level 22

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.01 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	5.11 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13	1.46 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_58	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_58	1.46 %
genistoids sensu lato	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato	0.73 %
Nymphon striatum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Pycnogonida → Pantopoda → Nymphonidae → Nymphon → Nymphon striatum	0.73 %
Polyangiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium	0.73 %
Streptomyces somaliensis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces somaliensis	0.73 %
Sulfuricella denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuricella → Sulfuricella denitrificans	0.73 %
Andreprevotia chitinilytica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Andreprevotia → Andreprevotia chitinilytica	0.73 %
Candidatus Tenderia electrophaga	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Candidatus Tenderia → Candidatus Tenderia electrophaga	0.73 %
Sulfurifustis variabilis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Sulfurifustis → Sulfurifustis variabilis	0.73 %
Candidatus Accumulibacter sp. SK-11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp. SK-11	0.73 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.73 %
Nitrosomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae	0.73 %
Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_67_26	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_67_26	0.73 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.73 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	0.73 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.73 %

Level 23

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.01 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	5.11 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13	1.46 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_58	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_58	1.46 %
core genistoids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids	0.73 %
Nymphon striatum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Pycnogonida → Pantopoda → Nymphonidae → Nymphon → Nymphon striatum	0.73 %
Polyangiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium	0.73 %
Streptomyces somaliensis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces somaliensis	0.73 %
Sulfuricella denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuricella → Sulfuricella denitrificans	0.73 %
Andreprevotia chitinilytica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Andreprevotia → Andreprevotia chitinilytica	0.73 %
Candidatus Tenderia electrophaga	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Candidatus Tenderia → Candidatus Tenderia electrophaga	0.73 %
Sulfurifustis variabilis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Sulfurifustis → Sulfurifustis variabilis	0.73 %
Candidatus Accumulibacter sp. SK-11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp. SK-11	0.73 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.73 %
Nitrosomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae	0.73 %
Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_67_26	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_67_26	0.73 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.73 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	0.73 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.73 %

Level 24

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.01 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	5.11 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13	1.46 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_58	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_58	1.46 %
Genisteae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae	0.73 %
Nymphon striatum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Pycnogonida → Pantopoda → Nymphonidae → Nymphon → Nymphon striatum	0.73 %
Polyangiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium	0.73 %
Streptomyces somaliensis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces somaliensis	0.73 %
Sulfuricella denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuricella → Sulfuricella denitrificans	0.73 %
Andreprevotia chitinilytica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Andreprevotia → Andreprevotia chitinilytica	0.73 %
Candidatus Tenderia electrophaga	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Candidatus Tenderia → Candidatus Tenderia electrophaga	0.73 %
Sulfurifustis variabilis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Sulfurifustis → Sulfurifustis variabilis	0.73 %
Candidatus Accumulibacter sp. SK-11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp. SK-11	0.73 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.73 %
Nitrosomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae	0.73 %
Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_67_26	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_67_26	0.73 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.73 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	0.73 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.73 %

Level 25

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.01 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	5.11 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13	1.46 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_58	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_58	1.46 %
Lupinus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus	0.73 %
Nymphon striatum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Pycnogonida → Pantopoda → Nymphonidae → Nymphon → Nymphon striatum	0.73 %
Polyangiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium	0.73 %
Streptomyces somaliensis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces somaliensis	0.73 %
Sulfuricella denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuricella → Sulfuricella denitrificans	0.73 %
Andreprevotia chitinilytica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Andreprevotia → Andreprevotia chitinilytica	0.73 %
Candidatus Tenderia electrophaga	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Candidatus Tenderia → Candidatus Tenderia electrophaga	0.73 %
Sulfurifustis variabilis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Sulfurifustis → Sulfurifustis variabilis	0.73 %
Candidatus Accumulibacter sp. SK-11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp. SK-11	0.73 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.73 %
Nitrosomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae	0.73 %
Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_67_26	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_67_26	0.73 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.73 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	0.73 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.73 %

Level 26

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.01 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	5.11 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13	1.46 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_58	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_58	1.46 %
Lupinus albus	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus	0.73 %
Nymphon striatum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Pycnogonida → Pantopoda → Nymphonidae → Nymphon → Nymphon striatum	0.73 %
Polyangiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium	0.73 %
Streptomyces somaliensis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces somaliensis	0.73 %
Sulfuricella denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuricella → Sulfuricella denitrificans	0.73 %
Andreprevotia chitinilytica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Andreprevotia → Andreprevotia chitinilytica	0.73 %
Candidatus Tenderia electrophaga	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Candidatus Tenderia → Candidatus Tenderia electrophaga	0.73 %
Sulfurifustis variabilis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Sulfurifustis → Sulfurifustis variabilis	0.73 %
Candidatus Accumulibacter sp. SK-11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp. SK-11	0.73 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.73 %
Nitrosomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae	0.73 %
Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_67_26	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_67_26	0.73 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.73 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	0.73 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.73 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300002122|C687J26623_10030944	Not Available	1427
3300005829|Ga0074479_10303547	All Organisms → cellular organisms → Bacteria → Proteobacteria	2492
3300005829|Ga0074479_10313667	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	7437
3300005829|Ga0074479_10529621	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuricella → Sulfuricella denitrificans	8246
3300006853|Ga0075420_100393581	Not Available	1198
3300009091|Ga0102851_10074642	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2840
3300009609|Ga0105347_1000138	All Organisms → cellular organisms → Bacteria → Proteobacteria	34923
3300009609|Ga0105347_1001461	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	10144
3300009609|Ga0105347_1197084	All Organisms → cellular organisms → Bacteria	808
3300009609|Ga0105347_1394093	All Organisms → cellular organisms → Bacteria	595
3300009610|Ga0105340_1015227	All Organisms → cellular organisms → Bacteria	3020
3300009610|Ga0105340_1128412	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1034
3300009678|Ga0105252_10041076	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1726
3300009678|Ga0105252_10041104	All Organisms → cellular organisms → Bacteria → Proteobacteria	1725
3300009678|Ga0105252_10395744	Not Available	632
3300009805|Ga0105079_1042417	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	521
3300009807|Ga0105061_1054335	All Organisms → cellular organisms → Bacteria	619
3300009808|Ga0105071_1084511	Not Available	558
3300009813|Ga0105057_1022326	Not Available	932
3300009816|Ga0105076_1072005	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13	645
3300010391|Ga0136847_12524045	All Organisms → cellular organisms → Bacteria	1827
3300011395|Ga0137315_1000110	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4605
3300011398|Ga0137348_1012772	All Organisms → cellular organisms → Bacteria	1271
3300011398|Ga0137348_1024604	Not Available	958
3300011402|Ga0137356_1104981	Not Available	534
3300011403|Ga0137313_1002986	All Organisms → cellular organisms → Bacteria → Proteobacteria	3437
3300011403|Ga0137313_1003712	All Organisms → cellular organisms → Bacteria → Proteobacteria	2930
3300011405|Ga0137340_1004585	All Organisms → cellular organisms → Bacteria → Proteobacteria	2518
3300011409|Ga0137323_1010613	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Sulfurifustis → Sulfurifustis variabilis	2133
3300011415|Ga0137325_1027675	Not Available	1148
3300011415|Ga0137325_1069345	All Organisms → cellular organisms → Bacteria	772
3300011416|Ga0137422_1089273	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	738
3300011420|Ga0137314_1038356	All Organisms → cellular organisms → Bacteria → Proteobacteria	1163
3300011422|Ga0137425_1024685	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	1280
3300011427|Ga0137448_1025245	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	1398
3300011427|Ga0137448_1079531	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	867
3300011428|Ga0137456_1106830	Not Available	728
3300011430|Ga0137423_1037344	All Organisms → cellular organisms → Bacteria → Proteobacteria	1470
3300011430|Ga0137423_1040088	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1411
3300011432|Ga0137428_1061240	All Organisms → cellular organisms → Bacteria	1013
3300011433|Ga0137443_1160563	Not Available	668
3300011437|Ga0137429_1045614	All Organisms → cellular organisms → Bacteria	1276
3300011437|Ga0137429_1107871	All Organisms → cellular organisms → Bacteria → Proteobacteria	849
3300011437|Ga0137429_1293725	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	501
3300011439|Ga0137432_1068794	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1081
3300011440|Ga0137433_1067732	Not Available	1081
3300011441|Ga0137452_1217883	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	648
3300011445|Ga0137427_10070975	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1388
3300011445|Ga0137427_10317037	All Organisms → cellular organisms → Bacteria → Proteobacteria	657
3300012035|Ga0137445_1131287	Not Available	512
3300012038|Ga0137431_1154962	All Organisms → cellular organisms → Bacteria → Proteobacteria	655
3300012039|Ga0137421_1044523	All Organisms → cellular organisms → Bacteria	1188
3300012143|Ga0137354_1028156	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	865
3300012146|Ga0137322_1081655	All Organisms → cellular organisms → Bacteria	504
3300012157|Ga0137353_1049466	Not Available	762
3300012160|Ga0137349_1086102	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	580
3300012161|Ga0137336_1049965	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	766
3300012164|Ga0137352_1110240	All Organisms → cellular organisms → Bacteria → Proteobacteria	544
3300012175|Ga0137321_1068334	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	786
3300012175|Ga0137321_1107212	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Candidatus Tenderia → Candidatus Tenderia electrophaga	630
3300012179|Ga0137334_1165401	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Pycnogonida → Pantopoda → Nymphonidae → Nymphon → Nymphon striatum	501
3300012672|Ga0137317_1029728	All Organisms → cellular organisms → Bacteria	543
3300012931|Ga0153915_10748136	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_58	1131
3300012931|Ga0153915_11504573	Not Available	787
3300012931|Ga0153915_11507046	All Organisms → cellular organisms → Bacteria	786
3300012931|Ga0153915_11703149	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13	738
3300014315|Ga0075350_1136233	All Organisms → cellular organisms → Bacteria	609
3300014324|Ga0075352_1097809	Not Available	766
3300014324|Ga0075352_1118120	All Organisms → cellular organisms → Bacteria → Proteobacteria	715
3300014861|Ga0180061_1078172	Not Available	556
3300014865|Ga0180078_1018057	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1042
3300014870|Ga0180080_1040814	Not Available	742
3300014873|Ga0180066_1005136	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_67_26	2046
3300014873|Ga0180066_1091952	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	624
3300014874|Ga0180084_1059079	All Organisms → cellular organisms → Bacteria	771
3300015254|Ga0180089_1052952	Not Available	803
3300015256|Ga0180073_1048148	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	865
3300015256|Ga0180073_1108033	Not Available	600
3300015259|Ga0180085_1082788	Not Available	937
3300017939|Ga0187775_10200579	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	740
3300017966|Ga0187776_11090149	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium	592
3300018031|Ga0184634_10003731	All Organisms → cellular organisms → Bacteria → Proteobacteria	4920
3300018063|Ga0184637_10129350	All Organisms → cellular organisms → Bacteria → Proteobacteria	1557
3300018063|Ga0184637_10222172	All Organisms → cellular organisms → Bacteria	1155
3300018063|Ga0184637_10235819	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_58	1117
3300018063|Ga0184637_10387535	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	834
3300018063|Ga0184637_10598294	Not Available	624
3300018063|Ga0184637_10644665	All Organisms → cellular organisms → Bacteria	589
3300018077|Ga0184633_10040423	All Organisms → cellular organisms → Bacteria → Proteobacteria	2359
3300018077|Ga0184633_10083865	All Organisms → cellular organisms → Bacteria	1640
3300018077|Ga0184633_10207852	Not Available	1011
3300018077|Ga0184633_10286726	Not Available	841
3300018077|Ga0184633_10341223	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Andreprevotia → Andreprevotia chitinilytica	758
3300018082|Ga0184639_10633564	Not Available	520
3300018469|Ga0190270_10099223	All Organisms → cellular organisms → Bacteria → Proteobacteria	2225
3300018469|Ga0190270_10173245	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1786
3300021332|Ga0210339_1697272	Not Available	563
3300022226|Ga0224512_10440740	All Organisms → cellular organisms → Bacteria → Proteobacteria	639
3300025159|Ga0209619_10063155	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2289
3300025159|Ga0209619_10428084	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	673
3300025165|Ga0209108_10095651	All Organisms → cellular organisms → Bacteria	1605
3300025173|Ga0209824_10141054	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	871
3300025311|Ga0209343_10297512	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1120
3300025318|Ga0209519_10497487	Not Available	684
3300025325|Ga0209341_10339382	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces somaliensis	1229
3300025957|Ga0210089_1039245	All Organisms → cellular organisms → Bacteria	595
3300025959|Ga0210116_1074267	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	661
3300025985|Ga0210117_1004882	All Organisms → cellular organisms → Bacteria → Proteobacteria	1600
3300026452|Ga0256821_1039874	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter	540
3300027573|Ga0208454_1003348	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	5015
3300027573|Ga0208454_1004987	All Organisms → cellular organisms → Bacteria → Proteobacteria	3810
3300027573|Ga0208454_1030488	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1264
3300027876|Ga0209974_10437916	All Organisms → cellular organisms → Bacteria	517
3300031965|Ga0326597_10214165	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2248
3300031965|Ga0326597_10575371	Not Available	1210
3300032144|Ga0315910_11177538	All Organisms → cellular organisms → Bacteria	598
3300032144|Ga0315910_11375869	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	551
3300033004|Ga0335084_10605110	Not Available	1121
3300033233|Ga0334722_11119839	Not Available	552
3300033233|Ga0334722_11330627	Not Available	502
3300033407|Ga0214472_11185502	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus	666
3300033408|Ga0316605_11471677	All Organisms → cellular organisms → Bacteria	661
3300033483|Ga0316629_10826602	Not Available	714
3300033513|Ga0316628_101214631	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1004
3300033513|Ga0316628_103948757	Not Available	530
3300033813|Ga0364928_0006474	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	2072
3300033813|Ga0364928_0024870	Not Available	1217
3300033814|Ga0364930_0002268	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	6721
3300033815|Ga0364946_057617	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp. SK-11	815
3300033815|Ga0364946_135069	Not Available	564
3300034148|Ga0364927_0040446	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1190
3300034165|Ga0364942_0024113	All Organisms → cellular organisms → Bacteria → Proteobacteria	1938
3300034165|Ga0364942_0147700	All Organisms → cellular organisms → Bacteria	765
3300034178|Ga0364934_0038320	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae	1765
3300034178|Ga0364934_0193639	Not Available	770
3300034178|Ga0364934_0338883	Not Available	569

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Environmental	Environmental	98.54%
Host-Associated	Host-Associated	1.46%

Class

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	70.07%
Terrestrial	Environmental → Terrestrial	28.47%
Plants	Host-Associated → Plants	1.46%

Category

Habitat	Taxonomy	Distribution
Sediment	Environmental → Aquatic → Sediment	58.39%
Soil	Environmental → Terrestrial → Soil	20.44%
Freshwater	Environmental → Aquatic → Freshwater	8.03%
Floodplain	Environmental → Terrestrial → Floodplain	8.03%
Marine	Environmental → Aquatic → Marine	3.65%
Rhizoplane	Host-Associated → Plants → Rhizoplane	0.73%
Rhizosphere	Host-Associated → Plants → Rhizosphere	0.73%

Type

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Sediment → Unclassified	58.39%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	8.03%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	8.03%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	7.30%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	4.38%
Sand	Environmental → Terrestrial → Soil → Sand	3.65%
Lake	Environmental → Aquatic → Freshwater → Lake	2.19%
Wetlands	Environmental → Aquatic → Marine → Wetlands	2.19%
Loam	Environmental → Terrestrial → Soil → Loam	1.46%
Drinking Water	Environmental → Aquatic → Freshwater → Drinking Water	0.73%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	0.73%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	0.73%
Sediment	Environmental → Aquatic → Marine → Sediment	0.73%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	0.73%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	0.73%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	58.39%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	8.03%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	7.30%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	7.30%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	3.65%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	3.65%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	2.19%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	2.19%
Unclassified	Environmental → Terrestrial → Soil → Loam → Unclassified	1.46%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	0.73%
Unchlorinated	Environmental → Aquatic → Freshwater → Drinking Water → Unchlorinated	0.73%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	0.73%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	0.73%
Unclassified	Environmental → Aquatic → Marine → Sediment → Unclassified	0.73%
Uranium Contaminated	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated	0.73%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	0.73%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	0.73%

Habitat

Habitat	Taxonomy	Distribution
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	46.72%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	9.49%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	8.03%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	4.38%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	3.65%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	3.65%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	2.92%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	2.92%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	2.19%
Sediment (Intertidal)	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)	2.19%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	2.19%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	1.46%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	1.46%
Soil	Environmental → Terrestrial → Soil → Loam → Unclassified → Soil	1.46%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment	0.73%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	0.73%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment	0.73%
Wastewater	Environmental → Aquatic → Freshwater → Drinking Water → Unchlorinated → Wastewater	0.73%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater	0.73%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	0.73%
Sediment	Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment	0.73%
Soil	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil	0.73%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	0.73%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	0.73%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300002122	Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_2	Environmental
3300005829	Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC	Environmental
3300006853	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4	Host-Associated
3300009091	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly)	Environmental
3300009609	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890	Environmental
3300009610	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700	Environmental
3300009678	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100	Environmental
3300009805	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_0_10	Environmental
3300009807	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10	Environmental
3300009808	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50	Environmental
3300009813	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20	Environmental
3300009816	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10	Environmental
3300010391	Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406	Environmental
3300011395	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT200_2	Environmental
3300011398	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT600_2	Environmental
3300011402	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT830_2	Environmental
3300011403	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT166_2	Environmental
3300011405	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT400_2	Environmental
3300011409	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT423_2	Environmental
3300011415	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT469_2	Environmental
3300011416	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT551_2	Environmental
3300011420	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT199_2	Environmental
3300011422	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT640_2	Environmental
3300011427	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT418_2	Environmental
3300011428	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT615_2	Environmental
3300011430	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2	Environmental
3300011432	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2	Environmental
3300011433	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT300_2	Environmental
3300011437	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT736_2	Environmental
3300011439	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2	Environmental
3300011440	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2	Environmental
3300011441	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT513_2	Environmental
3300011445	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2	Environmental
3300012035	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT338_2	Environmental
3300012038	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2	Environmental
3300012039	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT534_2	Environmental
3300012143	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT790_2	Environmental
3300012146	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT400_2	Environmental
3300012157	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT760_2	Environmental
3300012160	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT630_2	Environmental
3300012161	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT300_2	Environmental
3300012164	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT730_2	Environmental
3300012175	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT399_2	Environmental
3300012179	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT262_2	Environmental
3300012672	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT266_2	Environmental
3300012931	Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG	Environmental
3300014315	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D1	Environmental
3300014324	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1	Environmental
3300014861	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT27_16_10D	Environmental
3300014865	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT499_16_10D	Environmental
3300014870	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT560_16_10D	Environmental
3300014873	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200B_16_10D	Environmental
3300014874	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_2_16_10D	Environmental
3300015254	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT860_16_10D	Environmental
3300015256	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT333_16_10D	Environmental
3300015259	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_10D	Environmental
3300017939	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG	Environmental
3300017966	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG	Environmental
3300018031	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1	Environmental
3300018063	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2	Environmental
3300018077	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1	Environmental
3300018082	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2	Environmental
3300018469	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T	Environmental
3300021332	Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.384 (Metagenome Metatranscriptome)	Environmental
3300022226	Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_13	Environmental
3300025159	Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 3	Environmental
3300025165	Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1	Environmental
3300025173	Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking water (SPAdes)	Environmental
3300025311	Groundwater microbial communities from Rifle, Colorado - Rifle CSP2_plank lowO2_0.2 (SPAdes)	Environmental
3300025318	Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1	Environmental
3300025325	Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes)	Environmental
3300025957	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 (SPAdes)	Environmental
3300025959	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2 (SPAdes)	Environmental
3300025985	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2 (SPAdes)	Environmental
3300026452	Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 PU4	Environmental
3300027573	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 (SPAdes)	Environmental
3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes)	Host-Associated
3300031965	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185	Environmental
3300032144	Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil	Environmental
3300033004	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4	Environmental
3300033233	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom	Environmental
3300033407	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175	Environmental
3300033408	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT	Environmental
3300033483	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A	Environmental
3300033513	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C	Environmental
3300033813	Sediment microbial communities from East River floodplain, Colorado, United States - 30_j17	Environmental
3300033814	Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17	Environmental
3300033815	Sediment microbial communities from East River floodplain, Colorado, United States - 31_s17	Environmental
3300034148	Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17	Environmental
3300034165	Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17	Environmental
3300034178	Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17	Environmental

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
C687J26623_100309444	3300002122	Soil	QGFVAPLANIPDIGCGSLRALSQNRDSASRVSLG*
Ga0074479_103035471	3300005829	Sediment (Intertidal)	AHGFVAPLANIRDIGGGSLRALSQNRDSASRVSLC*
Ga0074479_103136671	3300005829	Sediment (Intertidal)	MKIQGLARILAQGFVAPLANIRDIGGGSLRALSQNRDSASRVSLC*
Ga0074479_105296218	3300005829	Sediment (Intertidal)	LAQGFVAPLANIRDIGGGSLRALSQNRDSASRVSLC*
Ga0075420_1003935811	3300006853	Populus Rhizosphere	AHGFVARLANIAYMGCGSLRALSQNRDSASCVSLC*
Ga0102851_100746421	3300009091	Freshwater Wetlands	QPFGLARVLAHDIVAPLANIRDIGCGKLRVLSQNRASASRVSLCYGL*
Ga0105347_10001381	3300009609	Soil	MTTQGLARVLAHGFVAPLANIPDIGCGSLRALSQNRDSASRVS
Ga0105347_10014611	3300009609	Soil	QGLARVLAHGFVAPLANIPDIGCGSLRALSQNRDSASRVSSC*
Ga0105347_11970842	3300009609	Soil	GLARILAHGIVANLVNIPDIHCGPLRALSQNRASAARESLC*
Ga0105347_13940931	3300009609	Soil	QGLARVLAHGFVAPLANIPDIGCGSLRALSQNRDSASRVSLC*
Ga0105340_10152271	3300009610	Soil	MEYPMIIQGLARVLAHGFVARLANMAYMGCGSLRALSQNRDSAARV
Ga0105340_11284121	3300009610	Soil	MEYPMFIQGLARVLAHGFVARLANMAYMGCGSLRALSQNRDSAARV
Ga0105252_100410761	3300009678	Soil	IQGLARVLAHGFVARLANIAYMGCGSLRALSQNRDSAARVSLC*
Ga0105252_100411041	3300009678	Soil	QAMEYPMTIQGLARVLAHGFVARLANMAYMGRGSLRALSQNRDSAARVSLC*
Ga0105252_103957441	3300009678	Soil	VLAHGFVAHLTNIPDIGCGSLRALSQNRDSASRVSLC*
Ga0105079_10424171	3300009805	Groundwater Sand	MLIQGLARILAQGFVAPLANIRDIGGGSLRALSQNRDSASRVSL
Ga0105061_10543351	3300009807	Groundwater Sand	GLARVLAHGFVAHLANIRDIGCGSLRALSQNRDSASRVSSCQGL*
Ga0105071_10845111	3300009808	Groundwater Sand	AFEYPMLIQGLARVLAQGFVAPLANIPDIGYGSLRALSQNRDSASRVSLC*
Ga0105057_10223263	3300009813	Groundwater Sand	MVIQGLARILAQGFVAPLANIPDIGGGSLRALSQNRDSASRVSSC*
Ga0105076_10720051	3300009816	Groundwater Sand	MAIQGLARVLAHGFVAHLANIRDIGCGSLRALSQNR
Ga0136847_125240451	3300010391	Freshwater Sediment	MLIQGLARVLAQSFVAHLANIRDIGGGSLRALSQNRDSASRVSSC
Ga0137315_10001101	3300011395	Soil	MTTQGLARVLAHGFVAHLTNIPDIGCGSLRALSQNRDSASR
Ga0137348_10127721	3300011398	Soil	MASQGLARVLAHGFVAPLANIPDIGCGSLRALSQNRDSASRVS
Ga0137348_10246041	3300011398	Soil	VLAHGFVAPLAHIPDMGCGSLRALSQNRDSASRVSLC*
Ga0137356_11049812	3300011402	Soil	VLAHGFVARLANIPDIGCGSLRALSQNRDSASRVSLC*
Ga0137313_10029863	3300011403	Soil	MTTQELARVLAHGFVAPLANIPDIGCGSLRALSQNRDSASR
Ga0137313_10037121	3300011403	Soil	MTTQELARVLAHGFVAPLANIPDIGCGSLRALSQNRDSASRISLC*
Ga0137340_10045851	3300011405	Soil	IQGLARILAHGFVASLANIPDIGCGSLRALSQNRDSASRVSSC*
Ga0137323_10106135	3300011409	Soil	RILAHGFVAHLTNIPDIGCGSLRALSQNRDSASRVSLC*
Ga0137325_10276751	3300011415	Soil	VLAHGFVAHLTNIPDMGCGSLRALSQNRDSASRVSLC*
Ga0137325_10693451	3300011415	Soil	MTTQGLARVLAHGFVAHLTNIPDIGCGSLRALSQNRDSASRVS
Ga0137422_10892731	3300011416	Soil	MSSQGLAEVLAHGFVAHLTNIPDIGCGSLRALSQNRDSASRV
Ga0137314_10383561	3300011420	Soil	IQGLARVLAHGFVARLANMAYMGCGSLRALSQNRDSAARVSLC*
Ga0137425_10246851	3300011422	Soil	SEYPRAAQGLARVLAQGFVAHLANMAYMGCGSLRALSQNRDSASRVSLC*
Ga0137448_10233713	3300011427	Soil	VLAQGFVARLANIRDIVCVALRALSQNRASAARVSF*
Ga0137448_10252452	3300011427	Soil	VLAQGFVARLANIRDIVCVALRALSQNRASAARVSLC*
Ga0137448_10795311	3300011427	Soil	MKPGGLARVLAQGFVARLANIRDIVCVALRALSQNRASAARV
Ga0137456_11068301	3300011428	Soil	ARVLAQGFVARLANIRDIVCVALRALSQNRASAAWVSF*
Ga0137423_10373443	3300011430	Soil	AHGFVAPLANIPDIGCGSLRALSQNRDSASRVSLC*
Ga0137423_10400881	3300011430	Soil	QGLARVLAHGFVAPLAHIPDMGCGSLRALSQNRDSASRVSLC*
Ga0137428_10612401	3300011432	Soil	LARVLAHGFVAPLANIPDIGCGSLRALSQNRDSASRVSLC*
Ga0137443_11605631	3300011433	Soil	QPGGLARVLAQGFVARLANIRDIVCVALRALSQNRASAARVLSR*
Ga0137429_10456144	3300011437	Soil	LAHGFVAHLTNIPDIGCGSLRALSQNRDSASRVSLC*
Ga0137429_11078712	3300011437	Soil	YLMIIQGLARVLAHGFVARLANMTYMGCSSLRALSQNRDSASCVSLC*
Ga0137429_12937252	3300011437	Soil	EYSTAIQGLARVLAHGFVARLANIAYMGCGSLRALSQNRDSASCVSLC*
Ga0137432_10687941	3300011439	Soil	IQGLARVLAHGFVARLANMAYMGCGSLRALSQNRDSASCVSLC*
Ga0137433_10677321	3300011440	Soil	ILAHGFVAPLANIPDIGCGSLRALSQNRDSASRVSLC*
Ga0137452_12178832	3300011441	Soil	PMIIQGLTRVLAHGFVARLANMAYMGCGSLRALSQNRDSAARVSLC*
Ga0137427_100709751	3300011445	Soil	MITQGLARVLAHGFVARLANMAYMGCGSLRALSQNRDSASCVS
Ga0137427_103170371	3300011445	Soil	MATQGLARVLAQGFVAHLTNIPDMGCGSLRALSQNRDSASRVSL
Ga0137445_11312872	3300012035	Soil	RFWPQPGGLARVLAQGFVARLANIRDIVCVALRALSQNRASAARVSF*
Ga0137431_11549622	3300012038	Soil	EYPMATQGLARVLAQGFVAHLANIPDIGCGSLRALSQNRDSASRVSLC*
Ga0137421_10445231	3300012039	Soil	HGFVAHLTNIPDIGCGSLRALSQNRDSASRVSLC*
Ga0137354_10281561	3300012143	Soil	MAIQGLARVLAHGFVAPLAHIPDMGCGSLRALSQNRDSASRVS
Ga0137322_10816551	3300012146	Soil	MTTQGLARVLAHGFVAPLANIPDIGCGSLRALSQNRDSAS
Ga0137353_10494661	3300012157	Soil	IQGLARVLAHGFVAHLTNIPDIGCGSLRALSQNRDSASRVSLC*
Ga0137349_10861021	3300012160	Soil	MSRGLARVLAQGFVAHLTNIPDIGCGSLRALSQNRDSA
Ga0137336_10499651	3300012161	Soil	ILAHGFVAPLAHIPDIGRGSLRALSQNRDSASRVSLC*
Ga0137352_11102401	3300012164	Soil	HGFVARLANIPDIGCGSLRTLSQNRDSASRVSWR*
Ga0137321_10683341	3300012175	Soil	MIVRGLARVLAHGFVARPANIAYMGCGSLRALSQNRDSASCVSLC*
Ga0137321_11072122	3300012175	Soil	LAHGFVAPLANIPDIGCGSLRALSQNRDSASRVSLC*
Ga0137334_11654011	3300012179	Soil	HGFVAPLANIPDIGCGSLRALSQNRDSASRVSLS*
Ga0137317_10297281	3300012672	Soil	HGFVARLANIAYMGCGSLRALSQNRDSASCVSLC*
Ga0153915_107481362	3300012931	Freshwater Wetlands	GLARILAHGFVAHLVNIRDIHCGELRALSQNRDSASRGSLCQAL*
Ga0153915_115045731	3300012931	Freshwater Wetlands	ARILAHGFVASLVNIRDIHCGQLRALSQNRDSASRVSLC*
Ga0153915_115070462	3300012931	Freshwater Wetlands	GLARILAHGFVAHLVNIRDIHCGELRALSQNRDSASRGSLC*
Ga0153915_117031492	3300012931	Freshwater Wetlands	RRFWLQPFGLARVLAHGIVASLANIRDIGCGQLRALSQNRASASRVSLGYGLL*
Ga0075350_11362331	3300014315	Natural And Restored Wetlands	FGLARVLAHGIVAPLANIRDIDCGELRALSQNRASASRVSLC*
Ga0075352_10978092	3300014324	Natural And Restored Wetlands	MAIQGLARVLAQGFVAPLANIRDIGGGSLRALSQNRDSASRV
Ga0075352_11181201	3300014324	Natural And Restored Wetlands	MVIQGLARILAQGFVAPLANIRDIGGGSLRALSQNRDSASRVSLC*
Ga0180061_10781721	3300014861	Soil	MVIQGLARVLAHGFVARLANIAYMGCGSLRALSQNRDSASC
Ga0180078_10180571	3300014865	Soil	QGLARVLAQGFVAPLANIPDIGCGSLRALSQNRDSALRVSLC*
Ga0180080_10408141	3300014870	Soil	MVIQGLARVLAQGFVAPLANIPDIGCGSLRALSHNRDSALR
Ga0180066_10051361	3300014873	Soil	IQGLARVLAQGFVAPLANIPDIGCGSLRALSQNRDSASRVSLC*
Ga0180066_10919523	3300014873	Soil	MVIQGLARILAQSFVAPLANIPDIGCGSLRALSQNR
Ga0180084_10590792	3300014874	Soil	LAQGFVASLANIPDIGCGSLRALSQNRDSASRVSLC*
Ga0180089_10529521	3300015254	Soil	YPMVIQGLARVLAQGFVAPLANIPDIGCGSLRALSQNRDSALRVSLC*
Ga0180073_10481481	3300015256	Soil	ILAQGFVAPLANIPDIGCGSLRALSQNRDSASRVSSC*
Ga0180073_11080331	3300015256	Soil	RILAQGFVAPLANIPDIGCGSLRALSQNRDSASRVSLS*
Ga0180085_10827881	3300015259	Soil	MVIQGLARVLAQGFVAPLANIPDIGCGSLRALSQNRDSALRVSLC
Ga0187775_102005791	3300017939	Tropical Peatland	ASEQPTPMRGLARILAHGFVARLDHIPDMACGSLGALSQNRDSASRVSLC
Ga0187776_110901491	3300017966	Tropical Peatland	MRGLARILAHGFVARLDHIPDMACGSLGALSQNRDSASRVSLC
Ga0184634_100037311	3300018031	Groundwater Sediment	VLAQGFVAPLANIPDIGGGSLRALSQNRDSASRVSLC
Ga0184637_101293501	3300018063	Groundwater Sediment	VLAQGFVAPLANIPDIGCGSLRALSQNRDSASRVSLC
Ga0184637_102221721	3300018063	Groundwater Sediment	FQGLARVLAHGFVAHLAHIPDMGGGSLRALSQNRDSASRVSLC
Ga0184637_102358191	3300018063	Groundwater Sediment	MLIQGLARVLAQGFVAPLANIPDIGCGSLRALSQNRDSASRV
Ga0184637_103875353	3300018063	Groundwater Sediment	QGLARVLAHGFVARLANIAYMGCGSLRALSQNRDSASRVSSC
Ga0184637_105982943	3300018063	Groundwater Sediment	MIIQGLARVLAHGFVAHLADIPDMGGGSLRALSQNRDSASRVSLC
Ga0184637_106446652	3300018063	Groundwater Sediment	MIIQGLARVLAQGFVARLAYIPDMGGGSLRALSQNRDSASRVSSC
Ga0184633_100404231	3300018077	Groundwater Sediment	VLAQGFVAPLANIPDIGCGSLRALSQNRDSASRVSSC
Ga0184633_100838651	3300018077	Groundwater Sediment	MIIQGLARILAQGFVAPLANIPDIGCGSLRALSQNRDSASRV
Ga0184633_102078523	3300018077	Groundwater Sediment	MLIQGLARVLAQGFVAPLANIPDIGCGSLRALSQNRDSAS
Ga0184633_102867261	3300018077	Groundwater Sediment	ILAQSFVAPLANIPDIGGGSLRALSQNRDSASRVSSC
Ga0184633_103412233	3300018077	Groundwater Sediment	AQSFVAHLANILDMGGGSLRALSQNRDSASRVSLC
Ga0184639_106335641	3300018082	Groundwater Sediment	IQGLARVLAQGFVAPLANIPDIGGGSLRALSQNRDSALRVSLC
Ga0190270_100992231	3300018469	Soil	IFEYQTTFQGLARVLAQGFVASLANIPDMGCGSLRALSQNRDSASRVSWC
Ga0190270_101732451	3300018469	Soil	IQGLARVLAHGFVARLANMTYMGCGSLRALSQNRDSAARVSSC
Ga0210339_16972722	3300021332	Estuarine	WLQPFGLARILAHGFVAHLVNIRDIHCGELRALSQNRASASRVSLC
Ga0224512_104407401	3300022226	Sediment	GLARILAHGFVAHLANIRDIGCGELRALSQNRASASRVSLCYGL
Ga0209619_100631553	3300025159	Soil	VLAQGFVAPLANIPDIGCGSLRALSQNRDSASRVS
Ga0209619_104280843	3300025159	Soil	MAIQGLARVLAQGFVAPLANIPDIGCGSLRALSQNRDSAS
Ga0209108_100956511	3300025165	Soil	MLIQGLARVLAQSFVAPLANIPDIGCGSLRALSQNRDSASRVS
Ga0209824_101410542	3300025173	Wastewater	RFWPQPGGLARVLAQGFVARLANIRDIVCVALRALSQNRASVARVSF
Ga0209343_102975121	3300025311	Groundwater	RPLWLQPFGLARILAHDFVAHLVNIRDIHRGSLRVLSQNRASAARGSLC
Ga0209519_104974871	3300025318	Soil	RVLAQGFVAPLANIPDIGCGSLRALSQNRDSASRVSLC
Ga0209341_103393821	3300025325	Soil	EGLARVFAHGFVAHLANIRDIGCGELRALSENRDSASRVSLC
Ga0210089_10392451	3300025957	Natural And Restored Wetlands	AKVFEYSIIIQGLARILAHSFVAPLANIRDIGGGSLRALSQNRDSASRVSSC
Ga0210116_10742672	3300025959	Natural And Restored Wetlands	EYPNAKQGLARILAHGFVARLANIPDIGGGSLRALSQNRDSASRVSLC
Ga0210117_10048822	3300025985	Natural And Restored Wetlands	MVIQGLARILAQGFVAPLANIRDIGGGSLRALSQNRDSASRVSSC
Ga0256821_10398741	3300026452	Sediment	LARVLAQDFVAHLANIRDIGCGSLRALSQNRDSASRVSLC
Ga0208454_10033481	3300027573	Soil	LAHGFVAHLTNIPDIGCGSLRALSQNRDSASRVSLC
Ga0208454_10049871	3300027573	Soil	MITQGLARVLAHGFVARLANMAYMGCGSLRALSQN
Ga0208454_10304883	3300027573	Soil	MIIQGLARVLAHGFVARLANMAYMGCGSLRALSQNRDSASC
Ga0209974_104379161	3300027876	Arabidopsis Thaliana Rhizosphere	ASEYLTIFLGLARVLAHGFVARLANIAYMGCGSLRALSQNRDSASRVSLC
Ga0326597_102141651	3300031965	Soil	LAQGFVAPLANIPDIGCGSLRALSQNRDSASRVSSC
Ga0326597_105753711	3300031965	Soil	GLARILAHGFVAPLANIRDIGCGELRALSQNRDSASRVSLCYRL
Ga0315910_111775381	3300032144	Soil	AGLARILAHGFVARLANMGYMGCGSLRALSQNRDSASRVSLC
Ga0315910_113758692	3300032144	Soil	MGLARIFAHGFVARLANMGYMGCGSLRALSKNRDSASRVSL
Ga0335084_106051103	3300033004	Soil	YRPVLPLPEGLARIFAHGIVARLAKVTYLGCAELRTLGKNRDSASRVSLC
Ga0334722_111198392	3300033233	Sediment	MLIQGLARVLAQGFVAHLANIRDIGGGSLRALSQNRDSASRVSLC
Ga0334722_113306271	3300033233	Sediment	VLAHGFVTHLANIRDIGGGSLRALSQNRDSASRVSSCLGLWVAGESGLRL
Ga0214472_111855022	3300033407	Soil	IQGLARILAQGIVAPLANIPDIGCGSLRALSQNRDSASRVSLC
Ga0316605_114716771	3300033408	Soil	ARVLAHGIVAPLANIRDIGCGELRALSQNRDSASRVSLC
Ga0316629_108266021	3300033483	Soil	FWLQPFGLARILAHGIVAPLANIRDIGCGELRALSQNRDSALRVSSC
Ga0316628_1012146311	3300033513	Soil	FAHGFVANLAHIRDMGCGSLRALSENRDSASRVSLC
Ga0316628_1039487572	3300033513	Soil	AHGFVANLAHIRDMGCGSLRALSENRDSASRVSLC
Ga0364928_0006474_1913_2050	3300033813	Sediment	MLIQGLARVLAQSFVAPLANIPDIGGGSLRALSQNRDSASRVSLC
Ga0364928_0024870_1002_1139	3300033813	Sediment	MVIQGLARVLAQGFVAPLANIPDIGCGSLRALSQNRDSASRVSSC
Ga0364930_0002268_174_305	3300033814	Sediment	MLIQGLARVLAQGFVAPLANIPDIGCGSLRALSQNRDSASRVS
Ga0364946_057617_7_144	3300033815	Sediment	MAIQGLARVLAQGFVAHLTNIPDIGCGSLRALSQNRDSASRVSLG
Ga0364946_135069_407_544	3300033815	Sediment	MTSQGLARILAQGFVARLTNIPDIGCGSLRALSQNRDSASRVSLC
Ga0364927_0040446_60_197	3300034148	Sediment	MSSQGLAEVLAHGFVAHLTNIPDIGCGSLRALSQNRDSASRVSLC
Ga0364942_0024113_1658_1795	3300034165	Sediment	MVIQGLARILAQGFVAPLANIPDIGCGSLRALSQNRDSASRVSLC
Ga0364942_0147700_465_602	3300034165	Sediment	MAIQGLARILAHGFVARLANIPDIGGGSLRALSQNRDSASRVSSC
Ga0364934_0038320_20_157	3300034178	Sediment	MAIQGLARVLAQGFVAPLANIPDIGGGSLRALSQNRDSASRVSSC
Ga0364934_0193639_565_702	3300034178	Sediment	MAIQGLARVLAQSFVAPLANIPDIGCGSLRALSQNRDSASRISLC
Ga0364934_0338883_347_484	3300034178	Sediment	MVIQGLARVLAQGFVAHLANIRDIGCGSLRALSQNRDSASRVSSC