| Basic Information | |
|---|---|
| Family ID | F056371 |
| Family Type | Metagenome |
| Number of Sequences | 137 |
| Average Sequence Length | 50 residues |
| Representative Sequence | MAGDIVVIEADPWDPSDVTVEMLQSLVDGGLLRPVTDPNRPEWIAPSGEPE |
| Number of Associated Samples | 69 |
| Number of Associated Scaffolds | 137 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 15.79 % |
| % of genes near scaffold ends (potentially truncated) | 86.86 % |
| % of genes from short scaffolds (< 2000 bps) | 97.08 % |
| Associated GOLD sequencing projects | 69 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (91.241 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (92.701 % of family members) |
| Environment Ontology (ENVO) | Unclassified (92.701 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (92.701 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 11.39% β-sheet: 0.00% Coil/Unstructured: 88.61% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 137 Family Scaffolds |
|---|---|---|
| PF04195 | Transposase_28 | 7.30 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 91.24 % |
| All Organisms | root | All Organisms | 8.76 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005840|Ga0068870_10994792 | Not Available | 598 | Open in IMG/M |
| 3300006881|Ga0068865_102211068 | Not Available | 501 | Open in IMG/M |
| 3300009148|Ga0105243_12487208 | Not Available | 557 | Open in IMG/M |
| 3300013296|Ga0157374_12248414 | Not Available | 572 | Open in IMG/M |
| 3300013297|Ga0157378_12874836 | Not Available | 534 | Open in IMG/M |
| 3300014969|Ga0157376_12053204 | Not Available | 610 | Open in IMG/M |
| 3300015267|Ga0182122_1023498 | Not Available | 686 | Open in IMG/M |
| 3300015267|Ga0182122_1050377 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 558 | Open in IMG/M |
| 3300015268|Ga0182154_1033126 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 629 | Open in IMG/M |
| 3300015269|Ga0182113_1066251 | Not Available | 567 | Open in IMG/M |
| 3300015274|Ga0182188_1052238 | Not Available | 528 | Open in IMG/M |
| 3300015276|Ga0182170_1045498 | Not Available | 588 | Open in IMG/M |
| 3300015277|Ga0182128_1025721 | Not Available | 693 | Open in IMG/M |
| 3300015279|Ga0182174_1015044 | Not Available | 821 | Open in IMG/M |
| 3300015279|Ga0182174_1026898 | Not Available | 703 | Open in IMG/M |
| 3300015281|Ga0182160_1044611 | Not Available | 605 | Open in IMG/M |
| 3300015281|Ga0182160_1052054 | Not Available | 579 | Open in IMG/M |
| 3300015281|Ga0182160_1062215 | Not Available | 550 | Open in IMG/M |
| 3300015282|Ga0182124_1059978 | Not Available | 553 | Open in IMG/M |
| 3300015282|Ga0182124_1061711 | Not Available | 548 | Open in IMG/M |
| 3300015285|Ga0182186_1016129 | Not Available | 805 | Open in IMG/M |
| 3300015287|Ga0182171_1017624 | Not Available | 792 | Open in IMG/M |
| 3300015288|Ga0182173_1015138 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 817 | Open in IMG/M |
| 3300015288|Ga0182173_1031410 | Not Available | 673 | Open in IMG/M |
| 3300015288|Ga0182173_1043158 | Not Available | 616 | Open in IMG/M |
| 3300015288|Ga0182173_1047934 | Not Available | 598 | Open in IMG/M |
| 3300015288|Ga0182173_1082263 | Not Available | 510 | Open in IMG/M |
| 3300015289|Ga0182138_1010750 | Not Available | 910 | Open in IMG/M |
| 3300015291|Ga0182125_1040650 | Not Available | 645 | Open in IMG/M |
| 3300015291|Ga0182125_1094564 | Not Available | 502 | Open in IMG/M |
| 3300015292|Ga0182141_1077356 | Not Available | 534 | Open in IMG/M |
| 3300015294|Ga0182126_1015929 | Not Available | 842 | Open in IMG/M |
| 3300015294|Ga0182126_1026756 | Not Available | 730 | Open in IMG/M |
| 3300015295|Ga0182175_1080573 | Not Available | 535 | Open in IMG/M |
| 3300015296|Ga0182157_1067326 | Not Available | 574 | Open in IMG/M |
| 3300015296|Ga0182157_1093182 | Not Available | 519 | Open in IMG/M |
| 3300015298|Ga0182106_1016333 | Not Available | 864 | Open in IMG/M |
| 3300015298|Ga0182106_1026798 | Not Available | 749 | Open in IMG/M |
| 3300015298|Ga0182106_1082736 | Not Available | 538 | Open in IMG/M |
| 3300015299|Ga0182107_1014389 | Not Available | 894 | Open in IMG/M |
| 3300015299|Ga0182107_1056344 | Not Available | 608 | Open in IMG/M |
| 3300015299|Ga0182107_1077007 | Not Available | 553 | Open in IMG/M |
| 3300015299|Ga0182107_1104772 | Not Available | 502 | Open in IMG/M |
| 3300015300|Ga0182108_1014011 | Not Available | 911 | Open in IMG/M |
| 3300015300|Ga0182108_1031528 | Not Available | 725 | Open in IMG/M |
| 3300015300|Ga0182108_1049897 | Not Available | 635 | Open in IMG/M |
| 3300015302|Ga0182143_1082372 | Not Available | 541 | Open in IMG/M |
| 3300015302|Ga0182143_1083315 | Not Available | 539 | Open in IMG/M |
| 3300015303|Ga0182123_1010714 | Not Available | 931 | Open in IMG/M |
| 3300015303|Ga0182123_1031906 | Not Available | 695 | Open in IMG/M |
| 3300015304|Ga0182112_1021526 | Not Available | 801 | Open in IMG/M |
| 3300015304|Ga0182112_1046937 | Not Available | 642 | Open in IMG/M |
| 3300015305|Ga0182158_1061067 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 593 | Open in IMG/M |
| 3300015305|Ga0182158_1077189 | Not Available | 552 | Open in IMG/M |
| 3300015305|Ga0182158_1079266 | Not Available | 548 | Open in IMG/M |
| 3300015305|Ga0182158_1102734 | Not Available | 505 | Open in IMG/M |
| 3300015307|Ga0182144_1065005 | Not Available | 590 | Open in IMG/M |
| 3300015307|Ga0182144_1078979 | Not Available | 556 | Open in IMG/M |
| 3300015307|Ga0182144_1107926 | Not Available | 503 | Open in IMG/M |
| 3300015308|Ga0182142_1052567 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 640 | Open in IMG/M |
| 3300015314|Ga0182140_1033066 | Not Available | 733 | Open in IMG/M |
| 3300015314|Ga0182140_1108415 | Not Available | 513 | Open in IMG/M |
| 3300015322|Ga0182110_1020258 | Not Available | 866 | Open in IMG/M |
| 3300015322|Ga0182110_1058689 | Not Available | 636 | Open in IMG/M |
| 3300015322|Ga0182110_1092469 | Not Available | 553 | Open in IMG/M |
| 3300015322|Ga0182110_1118803 | Not Available | 510 | Open in IMG/M |
| 3300015322|Ga0182110_1126033 | Not Available | 500 | Open in IMG/M |
| 3300015323|Ga0182129_1092948 | Not Available | 539 | Open in IMG/M |
| 3300015341|Ga0182187_1182485 | Not Available | 520 | Open in IMG/M |
| 3300015342|Ga0182109_1175778 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 551 | Open in IMG/M |
| 3300015342|Ga0182109_1203302 | Not Available | 521 | Open in IMG/M |
| 3300015343|Ga0182155_1094163 | Not Available | 690 | Open in IMG/M |
| 3300015343|Ga0182155_1115084 | Not Available | 644 | Open in IMG/M |
| 3300015343|Ga0182155_1147208 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 589 | Open in IMG/M |
| 3300015344|Ga0182189_1150703 | Not Available | 590 | Open in IMG/M |
| 3300015344|Ga0182189_1178373 | Not Available | 554 | Open in IMG/M |
| 3300015345|Ga0182111_1136794 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 630 | Open in IMG/M |
| 3300015345|Ga0182111_1173779 | Not Available | 575 | Open in IMG/M |
| 3300015345|Ga0182111_1227146 | Not Available | 517 | Open in IMG/M |
| 3300015346|Ga0182139_1105570 | Not Available | 695 | Open in IMG/M |
| 3300015346|Ga0182139_1215377 | Not Available | 529 | Open in IMG/M |
| 3300015351|Ga0182161_1128606 | Not Available | 673 | Open in IMG/M |
| 3300015351|Ga0182161_1222622 | Not Available | 541 | Open in IMG/M |
| 3300015351|Ga0182161_1233684 | Not Available | 531 | Open in IMG/M |
| 3300015355|Ga0182159_1275848 | Not Available | 559 | Open in IMG/M |
| 3300015355|Ga0182159_1319208 | Not Available | 524 | Open in IMG/M |
| 3300015361|Ga0182145_1053166 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 774 | Open in IMG/M |
| 3300015361|Ga0182145_1118099 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 595 | Open in IMG/M |
| 3300017404|Ga0182203_1161823 | Not Available | 504 | Open in IMG/M |
| 3300017409|Ga0182204_1081902 | Not Available | 566 | Open in IMG/M |
| 3300017410|Ga0182207_1111961 | Not Available | 588 | Open in IMG/M |
| 3300017410|Ga0182207_1126711 | Not Available | 563 | Open in IMG/M |
| 3300017411|Ga0182208_1029359 | Not Available | 788 | Open in IMG/M |
| 3300017413|Ga0182222_1037097 | Not Available | 664 | Open in IMG/M |
| 3300017413|Ga0182222_1059651 | Not Available | 588 | Open in IMG/M |
| 3300017415|Ga0182202_1104019 | Not Available | 553 | Open in IMG/M |
| 3300017415|Ga0182202_1132138 | Not Available | 511 | Open in IMG/M |
| 3300017420|Ga0182228_1053548 | Not Available | 695 | Open in IMG/M |
| 3300017420|Ga0182228_1077076 | Not Available | 607 | Open in IMG/M |
| 3300017420|Ga0182228_1079232 | Not Available | 600 | Open in IMG/M |
| 3300017420|Ga0182228_1100695 | Not Available | 551 | Open in IMG/M |
| 3300017424|Ga0182219_1038008 | Not Available | 754 | Open in IMG/M |
| 3300017424|Ga0182219_1060465 | Not Available | 653 | Open in IMG/M |
| 3300017424|Ga0182219_1092432 | Not Available | 574 | Open in IMG/M |
| 3300017424|Ga0182219_1124301 | Not Available | 522 | Open in IMG/M |
| 3300017430|Ga0182192_1068599 | Not Available | 693 | Open in IMG/M |
| 3300017430|Ga0182192_1087971 | Not Available | 636 | Open in IMG/M |
| 3300017433|Ga0182206_1089324 | Not Available | 606 | Open in IMG/M |
| 3300017436|Ga0182209_1106264 | Not Available | 590 | Open in IMG/M |
| 3300017436|Ga0182209_1123969 | Not Available | 562 | Open in IMG/M |
| 3300017438|Ga0182191_1082786 | Not Available | 656 | Open in IMG/M |
| 3300017438|Ga0182191_1126925 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 570 | Open in IMG/M |
| 3300017438|Ga0182191_1164542 | Not Available | 521 | Open in IMG/M |
| 3300017438|Ga0182191_1173950 | Not Available | 511 | Open in IMG/M |
| 3300017442|Ga0182221_1080124 | Not Available | 636 | Open in IMG/M |
| 3300017442|Ga0182221_1111801 | Not Available | 574 | Open in IMG/M |
| 3300017442|Ga0182221_1113574 | Not Available | 571 | Open in IMG/M |
| 3300017443|Ga0182193_1197475 | Not Available | 502 | Open in IMG/M |
| 3300017680|Ga0182233_1050861 | Not Available | 732 | Open in IMG/M |
| 3300017680|Ga0182233_1106984 | Not Available | 520 | Open in IMG/M |
| 3300017683|Ga0182218_1115443 | Not Available | 550 | Open in IMG/M |
| 3300017683|Ga0182218_1136677 | Not Available | 521 | Open in IMG/M |
| 3300017683|Ga0182218_1149819 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 506 | Open in IMG/M |
| 3300017684|Ga0182225_1042745 | Not Available | 733 | Open in IMG/M |
| 3300017684|Ga0182225_1097098 | Not Available | 569 | Open in IMG/M |
| 3300017684|Ga0182225_1124834 | Not Available | 527 | Open in IMG/M |
| 3300017686|Ga0182205_1066998 | Not Available | 689 | Open in IMG/M |
| 3300017689|Ga0182231_1082317 | Not Available | 614 | Open in IMG/M |
| 3300017690|Ga0182223_1092564 | Not Available | 546 | Open in IMG/M |
| 3300025942|Ga0207689_11515069 | Not Available | 560 | Open in IMG/M |
| 3300025942|Ga0207689_11618296 | Not Available | 538 | Open in IMG/M |
| 3300025960|Ga0207651_10827985 | Not Available | 822 | Open in IMG/M |
| 3300026089|Ga0207648_11604205 | Not Available | 611 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Miscanthus Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere | 92.70% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.19% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.73% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.73% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015267 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015268 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015269 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015274 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015276 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015277 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015279 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015281 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015282 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015285 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015287 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015288 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015289 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015291 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015292 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015294 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015295 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015296 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015298 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015299 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015300 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015302 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015303 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015304 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015305 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015307 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015308 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015314 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015322 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015323 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015341 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015342 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015343 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015344 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015345 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015346 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015347 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015351 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015355 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015361 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017404 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017409 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017410 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017411 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017413 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017415 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017420 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017424 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017430 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017433 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017436 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017438 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017442 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017443 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017680 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017683 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017684 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017686 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017689 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017690 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0068870_109947922 | 3300005840 | Miscanthus Rhizosphere | MAGGPPVILPADPWEPSDVSVEVLQSLVDDGLLRPVTDPDRPEWIAPLGEPEPRP |
| Ga0068865_1022110682 | 3300006881 | Miscanthus Rhizosphere | MAGDIIVIKVDPWGPSDVTMEMLQSLVDGGLLRPVTNPNRPEWIALLGELEPRPHDGYVV |
| Ga0105243_124872081 | 3300009148 | Miscanthus Rhizosphere | MAGGPVILQADPWGPSDVTAEMLQSLVDGGLLRPVTDPNRPEWITLSGEPELRPRDGYVM |
| Ga0157374_122484141 | 3300013296 | Miscanthus Rhizosphere | MAGDIVVIEADPWDPSDVTVEMLQSLVDDGLLCPVTDPNRPEWIAPSGEPE |
| Ga0157378_128748361 | 3300013297 | Miscanthus Rhizosphere | MAGGAVVIQADPWGPSDVSAETLQSLVDDGLLRPVTDPNRLEWIAPGSRS* |
| Ga0157376_120532041 | 3300014969 | Miscanthus Rhizosphere | MAGDIVVIEADPWDPSDVTVEMLQSLVDGGLLRPVTDPNRPEWIAPLGEPELRPRDGY |
| Ga0182122_10234982 | 3300015267 | Miscanthus Phyllosphere | MAGDIVVIEVDPWDPSNVTVETLESLVDGGLLRPVMDPNRPEW |
| Ga0182122_10503771 | 3300015267 | Miscanthus Phyllosphere | MAGGAVVLQADPWDPSDVSAAMLQSLVDDSLLRLVTDPNRPEWIAPGN* |
| Ga0182154_10331261 | 3300015268 | Miscanthus Phyllosphere | APMAGTVVVEADSWGQSDVIVEMLQSLIDGGLLRPVTDPNRPEWIAPSGEPEPRHTMATS |
| Ga0182113_10662511 | 3300015269 | Miscanthus Phyllosphere | MAGDIVVIEADPWDPSDVTVEMLQSLIDGRLLRPVTDPNRPEWITPLGEPELRPRDGYVVSFVS |
| Ga0182188_10522381 | 3300015274 | Miscanthus Phyllosphere | MAGGPPVILPADPWGPSDVSVETLQSLVDDGFLRPITDPDRPDWIAPLGEP |
| Ga0182170_10454981 | 3300015276 | Miscanthus Phyllosphere | MAGAVVVEVDSWGQSDVIVETLQSLVDGGLLPPVTDPNRPEWIAPSGEL |
| Ga0182128_10257212 | 3300015277 | Miscanthus Phyllosphere | MASDIVVIEVDPWDPSDVTVEMLQSLIDGGLLRSVTDPNRPEWIAPLGEPEPR |
| Ga0182174_10150441 | 3300015279 | Miscanthus Phyllosphere | MAGAVVIEVDPWGQSDVSVEMLQSLVDDGLLHPVTDPNRPEWIAPSGEPEPRPYDGYVV |
| Ga0182174_10268981 | 3300015279 | Miscanthus Phyllosphere | MAGGPPVILPVDPWEPSDVSVEVLQSLVDDDLLRSITDPDRLEW |
| Ga0182160_10446111 | 3300015281 | Miscanthus Phyllosphere | MAGDIVVVEADPWDPSDVTEEMLQSLVDGGLLHPVTDSTRPEWIAPY |
| Ga0182160_10520541 | 3300015281 | Miscanthus Phyllosphere | MAGDIVVVEADPWDPSDITEEMLQSLVDGGLLRPVTDSARLEWIAPCG |
| Ga0182160_10622151 | 3300015281 | Miscanthus Phyllosphere | MAGDIFVIEADPWDPSDVSVEMLQSLIDDGLLCPITDPDRLEWIAPLGEPEPRPPAGYV |
| Ga0182124_10599782 | 3300015282 | Miscanthus Phyllosphere | MAGNIVVIEVDPWGPSDVTVEMLQLLVHGGLLRPVTDPNRPEWIAPSGEPE |
| Ga0182124_10617112 | 3300015282 | Miscanthus Phyllosphere | MAGNIVVVEADPWDPSDVTEEMLQSLVDGGLLRPVTDPTR* |
| Ga0182186_10161291 | 3300015285 | Miscanthus Phyllosphere | MAGGPPVILPVDPWEPSDVSVEVLQSLVDDDLLRPITDPDRPEWIAPLGEPEPRP |
| Ga0182171_10176241 | 3300015287 | Miscanthus Phyllosphere | MAGDLVVIEADPWDPSNVTVEMLQSLVDGGLLRPVTDPNR |
| Ga0182173_10151381 | 3300015288 | Miscanthus Phyllosphere | PSHNGGGPPIILPVDPWGPSNVSVETLESLVDDGLLRPITDPDRLE* |
| Ga0182173_10314102 | 3300015288 | Miscanthus Phyllosphere | MAGDIVVIEADPWDPSDVTEEMLQSLVDGGLLHPVTDPNRPEWIAPSGEPELRPRNG |
| Ga0182173_10431581 | 3300015288 | Miscanthus Phyllosphere | MAGDIVVIEADSWDPSDVTMEMLQSLIDGGLLRPVTD |
| Ga0182173_10479341 | 3300015288 | Miscanthus Phyllosphere | MAGGPIILPADPWDPSDMSVEMLRSLIDDGLLRPITNPDRPEWIAPLGELEPRPPAG* |
| Ga0182173_10822631 | 3300015288 | Miscanthus Phyllosphere | MAGGAVVLRADPWGWSDVSMETLQSLVDDSLLRPVTDPSRLEWIAPGGEPESRPCDGY |
| Ga0182138_10107501 | 3300015289 | Miscanthus Phyllosphere | MAGDIVVIEADPWDPSDVTEEMLQSLVNGGLLRPVIDPTRPEWIAPYGE |
| Ga0182125_10406501 | 3300015291 | Miscanthus Phyllosphere | MAGNVVVVEADPWDPSDVTEEMLQSLIDGVLLRPVTDP |
| Ga0182125_10945641 | 3300015291 | Miscanthus Phyllosphere | MAGDIVVIEEDPWGPSDVTMEMLQSLVDGGLLRSVTDPNRLEWI |
| Ga0182141_10773561 | 3300015292 | Miscanthus Phyllosphere | MAGDIVVIEADPWDPSDVTVEMLQSLVDGGLLRPVTDPNRL |
| Ga0182126_10159291 | 3300015294 | Miscanthus Phyllosphere | MAGDIVVIEADPWDPSDVTMEMLQSLVDGGLLRPVMDP |
| Ga0182126_10267561 | 3300015294 | Miscanthus Phyllosphere | MADGPVILLVDPWGLSDVSVETLQSLVDDGLLCSVTDPNRPKWIAPSGEPKPR |
| Ga0182175_10805731 | 3300015295 | Miscanthus Phyllosphere | MAGGPPVILPVDPWELSDVSVEVLQSLIDGSLLRPITDPVRLE |
| Ga0182157_10673261 | 3300015296 | Miscanthus Phyllosphere | MAGDIVVIEADPWDPSDVSMEMLQSLIDDGLLRPITDPDRPEWIAPLGEPEPRPPA |
| Ga0182157_10900002 | 3300015296 | Miscanthus Phyllosphere | MAGGAVVIQADPWGPSDVSVETLQSLVDDSLLRPVSDPNKPEWIALGNEPEPRP |
| Ga0182157_10931821 | 3300015296 | Miscanthus Phyllosphere | MAGDIVVIEADPWDPSDVIVETLESLVDGGLLRPVTDPNRPEWI |
| Ga0182106_10163331 | 3300015298 | Miscanthus Phyllosphere | MAGDIVVVDADPWDLSDVTEEMLQSLVDGGLLRPVIDPTTPEWI |
| Ga0182106_10267981 | 3300015298 | Miscanthus Phyllosphere | MAGDIVVIKADPWDPSDVTVEMLQSLVDGGLLRPVTDPNRPKWIAPSGEPEPRPRDG |
| Ga0182106_10827361 | 3300015298 | Miscanthus Phyllosphere | MAGGPVILPADPWEPSNVSVEVLQSLVDDGLLRPVTDPNRPECIAPSSEPEPRPRDGYVVSFMSF |
| Ga0182107_10143891 | 3300015299 | Miscanthus Phyllosphere | MASDIVVIEADPWDPSDITVEMLQSLVDGGLLRPVTDPNRLEWIASSGELEPRPCDG |
| Ga0182107_10563441 | 3300015299 | Miscanthus Phyllosphere | MAGDIVVVEADPWDPSDITEEMLQSLVNGGLLRPVTDPSRPEW |
| Ga0182107_10770071 | 3300015299 | Miscanthus Phyllosphere | MAGTVVVEADSWGQSDVTVETLQSLVDGGLLRPITDLNRPEWIAPSGEPEPRPCDG |
| Ga0182107_11047721 | 3300015299 | Miscanthus Phyllosphere | MVGGLVILPVDPWGSSDMSVETLQSLVDDGLLHPVTDPNRLEWIAPSGEPELRPRD |
| Ga0182108_10140111 | 3300015300 | Miscanthus Phyllosphere | MAGNVVVVEADPWDPSDVTEEMLQSLVDGGLLHPVTDSTRPEWIAPYGEPEPR |
| Ga0182108_10315281 | 3300015300 | Miscanthus Phyllosphere | MAGDIVVIEADPWDPSDVTVEMLQSLVDGGLLRPVTDPNRPELIAP |
| Ga0182108_10498971 | 3300015300 | Miscanthus Phyllosphere | MAGDIVVIEVDPWDPSDITVEMLQSLVDGRLLRPMTDPSRPEW |
| Ga0182143_10823722 | 3300015302 | Miscanthus Phyllosphere | MAGDIVVIEADPWDPSDVTVEMLQSLVDSGLLRPMTDPNRPKWIAPSGESEPRPRDGYVV |
| Ga0182143_10833151 | 3300015302 | Miscanthus Phyllosphere | MAGDIVVIEVDPWDPSDVTVETLQSLVDGGLLRPETDPNRPEWIAPSGEPEPRP |
| Ga0182123_10107141 | 3300015303 | Miscanthus Phyllosphere | MAGDIVVIEADPWDPSDVTAEMLQLLVNGGLLRLVMDPNRPE |
| Ga0182123_10319061 | 3300015303 | Miscanthus Phyllosphere | MAGDIVAIEVDPWDPSDVSVDMLQSLIDGGLLRPVTDPNRPEWIAPLGESE |
| Ga0182112_10215261 | 3300015304 | Miscanthus Phyllosphere | MAGDIVVVEADPWDPSDVTKDMLQSLVDGGLLRPVTDPTRPEWIAPYGE |
| Ga0182112_10469371 | 3300015304 | Miscanthus Phyllosphere | MVGAVVIQVDPWGPSDVSMETLQSLVDDGLLRPVTDPNRPEWIAPSGEPEPRPHD |
| Ga0182158_10610672 | 3300015305 | Miscanthus Phyllosphere | MAGGHIILPADPWDPSDVSVEMLRSLIDNGLLRPITDPDRPEWIAPSGEPEPRPR* |
| Ga0182158_10771891 | 3300015305 | Miscanthus Phyllosphere | MTGDTVVIGADPWYPSDITVEMLQLLIDGGLLRPVTDPNRPEWIAPS* |
| Ga0182158_10792661 | 3300015305 | Miscanthus Phyllosphere | MAGDIVVVEADPWDPSDVTEEMLQSLVDGGLLRPVTDSTRP |
| Ga0182158_11027341 | 3300015305 | Miscanthus Phyllosphere | MAGDIIVIEVDPWDPSDVTVEMLQSLIDGGLLHPVTNPNRLEWIAPSGEPE |
| Ga0182144_10650051 | 3300015307 | Miscanthus Phyllosphere | MAGDIVVIEADPWDPSDVTVEMLQSLVDGGLLHPVTDPNRPEWIAPLGEPEPRPH |
| Ga0182144_10789791 | 3300015307 | Miscanthus Phyllosphere | MASNIVVIEVDPWGPYDITMEMLQSLIDGGLLRPVTDPNRPEWITPLGEPEPR |
| Ga0182144_11079261 | 3300015307 | Miscanthus Phyllosphere | MAGNVVVVEADPWDPSDVTEEMLQSLVDGGLFRPVIDPSRSEWIAPYGELEPRP |
| Ga0182142_10525672 | 3300015308 | Miscanthus Phyllosphere | MAGNIVVIEADPWDPSDVIVETLESLIDGGLLRPVTDPNRPEWIAPYGEP* |
| Ga0182140_10330661 | 3300015314 | Miscanthus Phyllosphere | MADDIVVIEADPWGPSDVTVEMLQSLIDGGLLRPITDPNRPEWIAPSGEPEQRPH |
| Ga0182140_11084152 | 3300015314 | Miscanthus Phyllosphere | MAGDIVVIEVDPWDTSDVTMEVLQSLIDGGLLRPVTD |
| Ga0182110_10202581 | 3300015322 | Miscanthus Phyllosphere | MAGDIVVIEADPWGPSDVTVEMLRSLVDGGLLCPVTDPNRPEWITP |
| Ga0182110_10586891 | 3300015322 | Miscanthus Phyllosphere | MAGDIVVIKVDPWDSSDITVEMLQSLIDGRLLRSVTGPNRPEWIAPLGEPKPRPR |
| Ga0182110_10924691 | 3300015322 | Miscanthus Phyllosphere | MASDIIVIEADPWDPSDVTMEMLQSLVDGGLLRPVTDPNRLE* |
| Ga0182110_11188031 | 3300015322 | Miscanthus Phyllosphere | MVDGPPVILPADPWEPSDVSVYVLQSLVDDGLLRPITDPDRPEWIAPL |
| Ga0182110_11260331 | 3300015322 | Miscanthus Phyllosphere | MAGGPPVILPVDHWEPSDVSVEVLQSLVDDDLLRPITDPD |
| Ga0182129_10929482 | 3300015323 | Miscanthus Phyllosphere | MADDIVVIEADPWDASNVTVEMLQSLVDGGLLRPMTDPNRPEWITPLGEPE |
| Ga0182187_11824851 | 3300015341 | Miscanthus Phyllosphere | MAGTVVIETDAWGQSDVSVEMLQSLVDDGLLRLVTDPNRLEWIALS |
| Ga0182109_11757782 | 3300015342 | Miscanthus Phyllosphere | VIEADPWDPSDITVEMLQSLVDRGLLRPVTDPSRPEWIAPS* |
| Ga0182109_12033021 | 3300015342 | Miscanthus Phyllosphere | MAGNVVVVEADPWDPSDVTEEMLQSLVDGGLLCPVTDPSRPE |
| Ga0182155_10941631 | 3300015343 | Miscanthus Phyllosphere | MAGSPPVILPVDPWEPSDVSVEVLQSLVDDGLLRPITDPDRPEWIAPLGEREP |
| Ga0182155_11150841 | 3300015343 | Miscanthus Phyllosphere | MVGGPPVILPVDPWEPSDVSVEVLQSLIDDGLLRPITDPDRPEWIAPLGER |
| Ga0182155_11472081 | 3300015343 | Miscanthus Phyllosphere | MADDIVVIEADPWDPSDVTMEMLQSLIDGGLLRPVTDPNRPEWIAPSGE* |
| Ga0182189_11507032 | 3300015344 | Miscanthus Phyllosphere | MAGDIVVIEVDPWDPSDITVEMLQSLVDGGHLRPVTDTNRSEWIAPSGR |
| Ga0182189_11783731 | 3300015344 | Miscanthus Phyllosphere | MAGDIVVVEADPWDPSDVTEEMLQSLVDGGLLHPETD |
| Ga0182111_11367941 | 3300015345 | Miscanthus Phyllosphere | MAGDIVVIEVDPWDPSDVTTEMLQSLVDGGLLRLVTDPNRPEWIALSSKP* |
| Ga0182111_11737791 | 3300015345 | Miscanthus Phyllosphere | MASGAIVIQADPWGPSDVSAETLQSLIDDGLLHPVTDPNRPKWIALGAEPELRPRDG |
| Ga0182111_12271461 | 3300015345 | Miscanthus Phyllosphere | MADDIVVVEADPWDLSDVTEEMLQSLVDGGLLRPVTDPTRPEWIAPYSEPEPR |
| Ga0182139_11055701 | 3300015346 | Miscanthus Phyllosphere | MAGNVVVVEADPWDPSDVTEEMLQSLVDGGLLRPVTDPSRPEWIAP |
| Ga0182139_12153771 | 3300015346 | Miscanthus Phyllosphere | MAGNIVVVEVDPWDPSDVTEEMLRSLVDGGLLRPVTDSTRPEWIAP |
| Ga0182177_12351001 | 3300015347 | Miscanthus Phyllosphere | MAGGPVILQADPWGPCDVTMATLQSLVDDCPLCPITVPIRPEWIALGGEPELRPRDGYI |
| Ga0182161_11286061 | 3300015351 | Miscanthus Phyllosphere | MAGDIVVVEADPWDPSNVTEEVLQSLVDGGLLRPVTDSTRPEWI |
| Ga0182161_12226221 | 3300015351 | Miscanthus Phyllosphere | MADDIVVIEVDPWGPSDVTVEILQSLVDGGLLRPVTDPNRPEWITLSGELEPRP |
| Ga0182161_12336842 | 3300015351 | Miscanthus Phyllosphere | MAGTIVVIEADPWGRSDVSVETLQSLIDDGLLCPVTDPNRLEWIAPSGEPESRPSDGYVV |
| Ga0182159_12758481 | 3300015355 | Miscanthus Phyllosphere | MAGDIVVIEADPWDPSDVTVEMLQWLVDDGLLHPVTDPNRPEWIAP |
| Ga0182159_13192081 | 3300015355 | Miscanthus Phyllosphere | MAGDIVVIEADPWGLSDVIVEMLQSLVDGGLLRPITDPNRPEWIAPSG |
| Ga0182145_10531662 | 3300015361 | Miscanthus Phyllosphere | MAGDIVVIEADPWDPSDVTVEMLQSLVDGRLLRPVTDPNRPEWIAPS* |
| Ga0182145_11180992 | 3300015361 | Miscanthus Phyllosphere | MAGDIVVIEADPWDPSDITVEMLQSLIDDGLLRPVTDPSRP* |
| Ga0182203_11618231 | 3300017404 | Miscanthus Phyllosphere | MAGDIVVIEADPWDPSNIIVEMLQSLVDSRLLRSVTDPNRPEW |
| Ga0182204_10819021 | 3300017409 | Miscanthus Phyllosphere | MAGDIVVIEADPWDPSDVTVEMLQSLVDGGLLRPVTDPNRPEWIAPSGEPE |
| Ga0182204_10907641 | 3300017409 | Miscanthus Phyllosphere | MAGNVIVIEVDPWGPSDVTVELLQSLVDGGLLRPVTD |
| Ga0182207_11119612 | 3300017410 | Miscanthus Phyllosphere | MAGNVVVVEADPWDPSDVTEEMLQSLVDGGLLRPVTDPSRPEWI |
| Ga0182207_11267111 | 3300017410 | Miscanthus Phyllosphere | MAGDIVVIEADPWDPSDVTVEVLQSLVDSGLLRSVIDPNRLQWIAPSGEPELRPRDD |
| Ga0182207_11430072 | 3300017410 | Miscanthus Phyllosphere | MASGAVVLQADPWAPSDVSMVELQSLVDDGLLRPVIDPSRTEWIALGNKPKPRP |
| Ga0182208_10293591 | 3300017411 | Miscanthus Phyllosphere | MAGDIVVIEADPWDPSDVTVEMLQSLVDGGLLRPVTDPNRPEWIAPLGE |
| Ga0182222_10370972 | 3300017413 | Miscanthus Phyllosphere | MAGDIVVIEVDPCDPSDVTVEMLQSLVDGGLLRPVTDPNRPELIAPLGEPE |
| Ga0182222_10596511 | 3300017413 | Miscanthus Phyllosphere | MASMVFIEANAWGRSDVSVETLQSLVDDGLLHPITDPNRPEWIAPSGEPEPRSHDGY |
| Ga0182202_11040191 | 3300017415 | Miscanthus Phyllosphere | MAGGPVILSVDPWDPSEVSVEMLQSVIDDGLLRPITDPDRPEWIASSGEP |
| Ga0182202_11321381 | 3300017415 | Miscanthus Phyllosphere | MAGDIVVVEADPWDPSDVTEEMLQSLVDGGLLRLVTDPTRPEWIAPYGEPEWRPRDGYVV |
| Ga0182228_10535481 | 3300017420 | Miscanthus Phyllosphere | MASTGVIKADAWHQSDVSVEMLQSLVDDDLLRSVTDPNRPEWISPSGEP |
| Ga0182228_10770761 | 3300017420 | Miscanthus Phyllosphere | MAGAVVIEADPWGQSDVSMETLQLLIYDDLLRPVTDSNRPEWIAPSGEPEL |
| Ga0182228_10792321 | 3300017420 | Miscanthus Phyllosphere | MAGGPPVIFPADPWGPSDVSVETLQSLVDGGILRLITDPDRLEWIASLGE |
| Ga0182228_11006951 | 3300017420 | Miscanthus Phyllosphere | MAGDIVVIEADPWDPSDVTVEMLQPLVDGGLLCPVTDPNRPEWISPLGEPES |
| Ga0182219_10380081 | 3300017424 | Miscanthus Phyllosphere | MASDIVVIEADPWDPSDVTVEMLQSLIDGGLLRPVTDPNRPKWIS |
| Ga0182219_10604651 | 3300017424 | Miscanthus Phyllosphere | MAGAVVIEADPWDQSNITVETLQSLVDGGLFFPVTDSNRPEWIAPSGEPEPRPHD |
| Ga0182219_10924321 | 3300017424 | Miscanthus Phyllosphere | MAGGPPIILPTDPWELSDVSMEVLQSLVDDGLLRLITDPDRPEWIAPLGEPEPRPREGYV |
| Ga0182219_11243012 | 3300017424 | Miscanthus Phyllosphere | MADDIIVVEADPWDPSDITEEMLQSLVDGGLLCPVTDPNMPEWIAPYSEPE |
| Ga0182192_10685991 | 3300017430 | Miscanthus Phyllosphere | MAGNVVVVEADPWDPSDVTEEMLQSLVDGGLLRPVTDPSRPEWIAPYGELEPRPR |
| Ga0182192_10879711 | 3300017430 | Miscanthus Phyllosphere | MVGGPPVILPVDPWEPSDVSVEVLQSLIDDGLLRPITDPDRPEWIAPL |
| Ga0182206_10893241 | 3300017433 | Miscanthus Phyllosphere | MAGAVVVEVDSWGQSDVTVEMLQSLVDGRLLRLVADPNRPEWIALSGGPEPRPCDGYIVSFV |
| Ga0182209_11062641 | 3300017436 | Miscanthus Phyllosphere | MAGTVVLPVDPWGLSDVSKETLQLLVDDGLLCPVADPNRAEWIALGSEPEPRPCDGYI |
| Ga0182209_11239691 | 3300017436 | Miscanthus Phyllosphere | MVVFSVAPMASAVVVEADSWVQSDVTVETLQSLVDGGLLRPVTDPNGPEWIALSGEP |
| Ga0182191_10827861 | 3300017438 | Miscanthus Phyllosphere | MAGDIVVVKADPWDPSDVTEEMLQSLVDGGLLRPVTDSTRLEWIAPYGEP |
| Ga0182191_11269251 | 3300017438 | Miscanthus Phyllosphere | SIAPMADDIVVVEADPWDPSDITEEMLQSLVDGGLLHPMTDPTRPEWIAPYGEPEPRPAMATS |
| Ga0182191_11645421 | 3300017438 | Miscanthus Phyllosphere | MAGDVVVIKEDPWDLSNVTIEMLQSLVDGRLLRPVTDPNR |
| Ga0182191_11739501 | 3300017438 | Miscanthus Phyllosphere | MAGNIVVIEVNPWGPSDVTMEMLQSLVDGGLLRLVTDPNRPE |
| Ga0182221_10801241 | 3300017442 | Miscanthus Phyllosphere | MANIVVLLADPWDRSDVTVGVLQSLVDDGLLRPITDPSKPEWMASGGEPELRP |
| Ga0182221_11118012 | 3300017442 | Miscanthus Phyllosphere | MAGGPPVILLADPWEPSDVSVEVLQSLVDDGLLRPITDPDRPEWRATN |
| Ga0182221_11135741 | 3300017442 | Miscanthus Phyllosphere | MASGAVVIQADPWGSSDVSMETLQSLVDDGLHCPITDPNRPEWIAPRGESELRPHDGY |
| Ga0182193_11974751 | 3300017443 | Miscanthus Phyllosphere | MAGNVVVVEADPWDPSDVTEEMLQSLVDGGLLRPVTNPSRPEWIAPYGELEPRPRD |
| Ga0182233_10508612 | 3300017680 | Miscanthus Phyllosphere | MAGDIVVIEADPWDPSDVTVEMLQSLIDGGLLRPVTDPNRPEWIAPSGEPEPRPRDGY |
| Ga0182233_11069841 | 3300017680 | Miscanthus Phyllosphere | MAGDIVVVEADPWDPSDVTEEVLQSLVDGGLLRPVTDSTRPEWIAPYGEPEPRPRD |
| Ga0182218_11154432 | 3300017683 | Miscanthus Phyllosphere | MAGDIVVIEVDPWDPSDVTVEMLQLLINGGLLCPVTDPNRTEWIAPSGEQEPRPC |
| Ga0182218_11366771 | 3300017683 | Miscanthus Phyllosphere | MANVVVLPADPWDRSDVTVGVLQSLVDDGLLHPITDPSRPEWMALGGEPEPRPRDGYVVS |
| Ga0182218_11498191 | 3300017683 | Miscanthus Phyllosphere | PTVLMAGAVVIQADPWGRSDVSVETLQSLIDDGLLRPVTDPSRPEWIAPGAS |
| Ga0182225_10427451 | 3300017684 | Miscanthus Phyllosphere | MAGDIVVIEADPWDPSDVTVEVLQSLVDGGLLRPVTDPNRLEWIASSGELEPRPCDGYVV |
| Ga0182225_10970981 | 3300017684 | Miscanthus Phyllosphere | MLMADNIVVIEADPWGLFDVTVEMLQSLVDGGLLPPVTDPNRLEWISPSGEPEPRPRDG |
| Ga0182225_11248341 | 3300017684 | Miscanthus Phyllosphere | MAGDIIVIEVDPWDPSNVTEEMLQSLVDSGLLRPV |
| Ga0182205_10669981 | 3300017686 | Miscanthus Phyllosphere | MADGPPVILSVDPWEPSDVSVEVLQSRVDDSLLRPTTDPDRPEWIAPL |
| Ga0182231_10823172 | 3300017689 | Miscanthus Phyllosphere | MAGDIVVIEADPWDPSDVTMEMLQLLVNGGLLRPVTD |
| Ga0182223_10925642 | 3300017690 | Miscanthus Phyllosphere | MAGDIVVIEADPWDPSDITVEMLQSLVDSGLLRPVTDPNRPEWIA |
| Ga0207689_115150691 | 3300025942 | Miscanthus Rhizosphere | MAGDIVVVEADPWDPSDVTEEMLQSLVDGGLLRLVTDPARPEWIAP |
| Ga0207689_116182961 | 3300025942 | Miscanthus Rhizosphere | MAGDIVVIEADPWDPSDVTAKMLESLIDGGLLHPVMDPNTPEWISSYSE |
| Ga0207651_108279851 | 3300025960 | Switchgrass Rhizosphere | MAGDIVVVEVDPWDPSDVTEKMLQSLVDGGLLRPVTDSTRPEWIAPYGEPEPRPRD |
| Ga0207648_116042051 | 3300026089 | Miscanthus Rhizosphere | MAGGPPVILSVDPWEPSDVSVEVLQSLVNDDLLRLITDPDRPKWIAPLGEPEPRPREGYDMSFVSFH |
| ⦗Top⦘ |