NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F056368

Metagenome Family F056368

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F056368
Family Type Metagenome
Number of Sequences 137
Average Sequence Length 43 residues
Representative Sequence MGSFRKRLLVLIIGLVIVTQTVTLAAVLASTRRTVEARAAEQL
Number of Associated Samples 124
Number of Associated Scaffolds 137

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 81.02 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 90.51 %
Associated GOLD sequencing projects 122
AlphaFold2 3D model prediction Yes
3D model pTM-score0.55

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (94.161 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(32.847 % of family members)
Environment Ontology (ENVO) Unclassified
(30.657 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(38.686 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 57.75%    β-sheet: 0.00%    Coil/Unstructured: 42.25%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.55
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 137 Family Scaffolds
PF02775TPP_enzyme_C 3.65
PF09863DUF2090 0.73
PF13620CarboxypepD_reg 0.73
PF13458Peripla_BP_6 0.73
PF01855POR_N 0.73
PF00037Fer4 0.73

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 137 Family Scaffolds
COG0674Pyruvate:ferredoxin oxidoreductase or related 2-oxoacid:ferredoxin oxidoreductase, alpha subunitEnergy production and conversion [C] 0.73
COG4231TPP-dependent indolepyruvate ferredoxin oxidoreductase, alpha subunitEnergy production and conversion [C] 0.73

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.16 %
UnclassifiedrootN/A5.84 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001593|JGI12635J15846_10044333All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium3438Open in IMG/M
3300001593|JGI12635J15846_10394930All Organisms → cellular organisms → Bacteria836Open in IMG/M
3300001661|JGI12053J15887_10359556All Organisms → cellular organisms → Bacteria703Open in IMG/M
3300005328|Ga0070676_10980814All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300005344|Ga0070661_101396268All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300005437|Ga0070710_10590028All Organisms → cellular organisms → Bacteria772Open in IMG/M
3300005532|Ga0070739_10549032Not Available515Open in IMG/M
3300005546|Ga0070696_101351688All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300005576|Ga0066708_10454930All Organisms → cellular organisms → Bacteria822Open in IMG/M
3300005586|Ga0066691_10324676All Organisms → cellular organisms → Bacteria910Open in IMG/M
3300005591|Ga0070761_10127231All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1482Open in IMG/M
3300005610|Ga0070763_10664970All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300005764|Ga0066903_101370667All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1326Open in IMG/M
3300005834|Ga0068851_10164135All Organisms → cellular organisms → Bacteria → Proteobacteria1222Open in IMG/M
3300005836|Ga0074470_11102620All Organisms → cellular organisms → Bacteria956Open in IMG/M
3300005844|Ga0068862_101035020All Organisms → cellular organisms → Bacteria813Open in IMG/M
3300005921|Ga0070766_10938017All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300006034|Ga0066656_10795000All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300006893|Ga0073928_10162957All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1786Open in IMG/M
3300009143|Ga0099792_10910688All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300009148|Ga0105243_12045523All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300009176|Ga0105242_13170523All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300009430|Ga0114938_1330638Not Available554Open in IMG/M
3300009551|Ga0105238_10317428All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1544Open in IMG/M
3300009665|Ga0116135_1166825All Organisms → cellular organisms → Bacteria829Open in IMG/M
3300010361|Ga0126378_10456068All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1393Open in IMG/M
3300010361|Ga0126378_12972348All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300010376|Ga0126381_103358421All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300010396|Ga0134126_10799787All Organisms → cellular organisms → Bacteria1066Open in IMG/M
3300010399|Ga0134127_13134012Not Available540Open in IMG/M
3300010403|Ga0134123_12326038All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300012203|Ga0137399_10949860All Organisms → cellular organisms → Bacteria724Open in IMG/M
3300012205|Ga0137362_11783587All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium502Open in IMG/M
3300012211|Ga0137377_10053334All Organisms → cellular organisms → Bacteria → Proteobacteria3743Open in IMG/M
3300012929|Ga0137404_10291227All Organisms → cellular organisms → Bacteria → Proteobacteria1414Open in IMG/M
3300012931|Ga0153915_10245884All Organisms → cellular organisms → Bacteria → Proteobacteria1980Open in IMG/M
3300012971|Ga0126369_10824551All Organisms → cellular organisms → Bacteria1011Open in IMG/M
3300012984|Ga0164309_10003478All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria7337Open in IMG/M
3300014201|Ga0181537_11115716All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300014322|Ga0075355_1133935All Organisms → cellular organisms → Bacteria645Open in IMG/M
3300014325|Ga0163163_10569362All Organisms → cellular organisms → Bacteria1196Open in IMG/M
3300014501|Ga0182024_12578395All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300014745|Ga0157377_11445396Not Available544Open in IMG/M
3300015054|Ga0137420_1497811All Organisms → cellular organisms → Bacteria → Proteobacteria1364Open in IMG/M
3300015262|Ga0182007_10396416Not Available525Open in IMG/M
3300016294|Ga0182041_11620844All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300016357|Ga0182032_11343584All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300016357|Ga0182032_11393931All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300017970|Ga0187783_10533159All Organisms → cellular organisms → Bacteria850Open in IMG/M
3300017973|Ga0187780_10793431All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300017993|Ga0187823_10196857All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300017999|Ga0187767_10321675All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300018060|Ga0187765_10906580All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300020170|Ga0179594_10057148All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1330Open in IMG/M
3300020199|Ga0179592_10419707All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300021170|Ga0210400_11622013All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300021377|Ga0213874_10098858All Organisms → cellular organisms → Bacteria968Open in IMG/M
3300021402|Ga0210385_11340634All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300021403|Ga0210397_10368656All Organisms → cellular organisms → Bacteria1068Open in IMG/M
3300021420|Ga0210394_10149415All Organisms → cellular organisms → Bacteria → Proteobacteria2029Open in IMG/M
3300021420|Ga0210394_10960454All Organisms → cellular organisms → Bacteria742Open in IMG/M
3300021432|Ga0210384_10125691All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2300Open in IMG/M
3300021432|Ga0210384_10593114All Organisms → cellular organisms → Bacteria995Open in IMG/M
3300021477|Ga0210398_11210173All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300021479|Ga0210410_10231952All Organisms → cellular organisms → Bacteria → Proteobacteria1655Open in IMG/M
3300021559|Ga0210409_10545139All Organisms → cellular organisms → Bacteria1026Open in IMG/M
3300021560|Ga0126371_10386137All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1540Open in IMG/M
3300021560|Ga0126371_12226882All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300021560|Ga0126371_12637297All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300022897|Ga0247764_1219797All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300023275|Ga0247776_10111527All Organisms → cellular organisms → Bacteria1057Open in IMG/M
3300025928|Ga0207700_11078809All Organisms → cellular organisms → Bacteria718Open in IMG/M
3300025937|Ga0207669_10896141All Organisms → cellular organisms → Bacteria741Open in IMG/M
3300025960|Ga0207651_10085332All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2291Open in IMG/M
3300026061|Ga0208541_1029225All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300026088|Ga0207641_12472736Not Available518Open in IMG/M
3300026118|Ga0207675_100758060All Organisms → cellular organisms → Bacteria → Terrabacteria group982Open in IMG/M
3300026142|Ga0207698_11390446All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300026333|Ga0209158_1018221All Organisms → cellular organisms → Bacteria → Proteobacteria3222Open in IMG/M
3300026376|Ga0257167_1078980All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium519Open in IMG/M
3300027043|Ga0207800_1029766All Organisms → cellular organisms → Bacteria805Open in IMG/M
3300027884|Ga0209275_10042655All Organisms → cellular organisms → Bacteria2146Open in IMG/M
3300027894|Ga0209068_10366344All Organisms → cellular organisms → Bacteria818Open in IMG/M
3300028808|Ga0302228_10089579All Organisms → cellular organisms → Bacteria → Proteobacteria1447Open in IMG/M
3300028906|Ga0308309_11349045All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300030043|Ga0302306_10223892All Organisms → cellular organisms → Bacteria723Open in IMG/M
3300030906|Ga0302314_10846472All Organisms → cellular organisms → Bacteria907Open in IMG/M
3300031250|Ga0265331_10555684All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300031544|Ga0318534_10461112All Organisms → cellular organisms → Bacteria728Open in IMG/M
3300031679|Ga0318561_10101473All Organisms → cellular organisms → Bacteria → Proteobacteria1512Open in IMG/M
3300031680|Ga0318574_10288885All Organisms → cellular organisms → Bacteria952Open in IMG/M
3300031681|Ga0318572_10332655All Organisms → cellular organisms → Bacteria900Open in IMG/M
3300031682|Ga0318560_10008090All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria4412Open in IMG/M
3300031716|Ga0310813_10169248All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1771Open in IMG/M
3300031719|Ga0306917_10733123All Organisms → cellular organisms → Bacteria776Open in IMG/M
3300031724|Ga0318500_10516023All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300031764|Ga0318535_10424210All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300031765|Ga0318554_10669047All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300031770|Ga0318521_10061367All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1974Open in IMG/M
3300031778|Ga0318498_10029178All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2385Open in IMG/M
3300031778|Ga0318498_10174551All Organisms → cellular organisms → Bacteria977Open in IMG/M
3300031781|Ga0318547_10590518All Organisms → cellular organisms → Bacteria688Open in IMG/M
3300031793|Ga0318548_10003923All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria5217Open in IMG/M
3300031793|Ga0318548_10211558All Organisms → cellular organisms → Bacteria952Open in IMG/M
3300031795|Ga0318557_10182138All Organisms → cellular organisms → Bacteria956Open in IMG/M
3300031795|Ga0318557_10327587All Organisms → cellular organisms → Bacteria703Open in IMG/M
3300031799|Ga0318565_10013235All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria3477Open in IMG/M
3300031821|Ga0318567_10806160All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300031823|Ga0307478_10956946All Organisms → cellular organisms → Bacteria716Open in IMG/M
3300031897|Ga0318520_10038158All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2455Open in IMG/M
3300031897|Ga0318520_10826104All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300031912|Ga0306921_10513483All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1392Open in IMG/M
3300031912|Ga0306921_10667914All Organisms → cellular organisms → Bacteria1197Open in IMG/M
3300031945|Ga0310913_11002031All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300032001|Ga0306922_10649927All Organisms → cellular organisms → Bacteria1114Open in IMG/M
3300032008|Ga0318562_10232841All Organisms → cellular organisms → Bacteria1069Open in IMG/M
3300032008|Ga0318562_10759070All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300032009|Ga0318563_10083990All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales1667Open in IMG/M
3300032025|Ga0318507_10177092All Organisms → cellular organisms → Bacteria917Open in IMG/M
3300032035|Ga0310911_10166268All Organisms → cellular organisms → Bacteria → Proteobacteria1246Open in IMG/M
3300032041|Ga0318549_10214775All Organisms → cellular organisms → Bacteria864Open in IMG/M
3300032043|Ga0318556_10677425Not Available537Open in IMG/M
3300032044|Ga0318558_10059312All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1714Open in IMG/M
3300032054|Ga0318570_10066223All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales1529Open in IMG/M
3300032060|Ga0318505_10119704All Organisms → cellular organisms → Bacteria1205Open in IMG/M
3300032067|Ga0318524_10061233All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales1812Open in IMG/M
3300032068|Ga0318553_10638399All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300032174|Ga0307470_11875858Not Available509Open in IMG/M
3300032177|Ga0315276_11596054All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300032205|Ga0307472_100430350All Organisms → cellular organisms → Bacteria1114Open in IMG/M
3300032261|Ga0306920_100487760All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1829Open in IMG/M
3300032783|Ga0335079_10334876All Organisms → cellular organisms → Bacteria1644Open in IMG/M
3300032805|Ga0335078_10441850All Organisms → cellular organisms → Bacteria → Proteobacteria1692Open in IMG/M
3300033158|Ga0335077_12097027All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300033290|Ga0318519_10177910All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1203Open in IMG/M
3300033412|Ga0310810_11158657All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300034894|Ga0373916_0052143All Organisms → cellular organisms → Bacteria593Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil32.85%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.84%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.11%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.92%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.19%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.19%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.19%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.19%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.19%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.19%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa2.19%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.19%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.46%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.46%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter1.46%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.46%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.46%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.46%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.73%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.73%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.73%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.73%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.73%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater0.73%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.73%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.73%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.73%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.73%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.73%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.73%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.73%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.73%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.73%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.73%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.73%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.73%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.73%
Sediment SlurryEngineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry0.73%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300001661Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)EnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005532Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1EnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009430Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Big SpringEnvironmentalOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014322Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailA_D1EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300015054Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015262Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaGHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017993Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3EnvironmentalOpen in IMG/M
3300017999Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021377Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7Host-AssociatedOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022897Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L051-202B-4EnvironmentalOpen in IMG/M
3300023275Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L199-509C-5EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026061Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleB_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes)EnvironmentalOpen in IMG/M
3300026376Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-BEnvironmentalOpen in IMG/M
3300027043Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 11 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028808Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300030043Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1EnvironmentalOpen in IMG/M
3300030906Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3EnvironmentalOpen in IMG/M
3300031250Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaGHost-AssociatedOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032177Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300034894Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A1A0.2EngineeredOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12635J15846_1004433313300001593Forest SoilMGSFRKRLLVLIIGLVIVTQTVTLAAVLASTRRTVEARAAEQLRS
JGI12635J15846_1039493013300001593Forest SoilMGSFRKRLLVLIIGLVIVTQTVTLAAVLVSTQRTVEARAALELR
JGI12053J15887_1035955613300001661Forest SoilMGSFRKRLLVLIIGLVIVTQTVTLAAVLASTRRTVEARAAEQ
Ga0070676_1098081413300005328Miscanthus RhizosphereMGSFRNRLLVLIIGLVIATQSVTLIAVLARVEGTVEGRAAEQLTA
Ga0070661_10139626813300005344Corn RhizosphereMGSFRKRLLVLIIGLVIVTQTVTLAAVLVSTAHDVEGRAAGELRSGGSFA
Ga0070710_1059002813300005437Corn, Switchgrass And Miscanthus RhizosphereMGSFRKRLLVLIIGLVLVTQTVTLAAVLASTAHTVEGRAAAE
Ga0070739_1054903213300005532Surface SoilMGSFRKRLLVLIIGLVIVTQTVTLAAVLASTAHNVEARAAEQLRSGSSF
Ga0070696_10135168813300005546Corn, Switchgrass And Miscanthus RhizosphereMGSFRNRLLVLIIGLVIATQSVTLIAVLARVEGTVEGRAAEQLTAGGKLIEQF
Ga0066708_1045493023300005576SoilMGSFRKRLLVLIIGLGVVTQTVTLAAVLVSTRHTVEARAAEQLRSGGAFAE
Ga0066691_1032467623300005586SoilMGSFRKRLLVLIIGLVIVTQTVTLAAVLASTRRTVEARAAEQLRSGGSLAE
Ga0070761_1012723133300005591SoilMGSFRKRLLVLIIGLVIVTQTVTLAAVLVSTRRTVEAR
Ga0070763_1066497013300005610SoilMNSFRKRLLVLIIGLVVVTQTVTLAAVLASTRRTVEARSWEQLRSGAGL
Ga0066903_10137066713300005764Tropical Forest SoilMGSFRNRLLVLIIGLVIVTQTVTLAAVLLSTRRTVEAR
Ga0068851_1016413533300005834Corn RhizosphereMGSFRKRLLVLIIGLVVVTQTVTLAAVLVSTAHDVEGRAAGELRSG
Ga0074470_1110262013300005836Sediment (Intertidal)MNSFRNRLLVLIIGLIAVTQTVTLVAVLESTRRSVETRAAEQLTAGTSYA
Ga0068862_10103502023300005844Switchgrass RhizosphereMRSFRKRLLVLIIGLVIVTQTVTLAAVLASTRRTVEARSWEQLRSGAGIAD
Ga0070766_1093801713300005921SoilMGSFRKRLLVLIIGLVIVTQTVTLAAVLASTRRTVEARAAEQLR
Ga0066656_1079500023300006034SoilMGSFRKRLLVLIIGLVIVTQTVTLAAVLISTRRTVEARAAE
Ga0073928_1016295713300006893Iron-Sulfur Acid SpringMGSFRKRLLVLIIGLVIVTQTVTLAAVLMSTRRTVEARAALEL
Ga0099792_1091068813300009143Vadose Zone SoilMGSFRKRLLVLIIGLVVVTQTVTLAAVLASTAHTVEGRAVQELRSGG
Ga0105243_1204552313300009148Miscanthus RhizosphereMFHIRADAMGSFRNRLLVLIIGLVIVTQSVTLIAVLARVEQTVAGRASDELGS
Ga0105242_1317052323300009176Miscanthus RhizosphereMFHIRADAMGSFRNRLLVLIIALVVVTQSVTLIAVLARVEQTVEGRA
Ga0114938_133063823300009430GroundwaterMRTFRNRLLVLIIGLVVVAQTVTLVAVLARTERDVRSRAAD
Ga0105238_1031742813300009551Corn RhizosphereMGSFRKRLLVLIIGLVVVTQTVTLAAVLARTAHDVEGRAADELRSGGSF
Ga0116135_116682523300009665PeatlandMGSFRKRLLVLIIGLVIVTQTVTLAAVLASTAHNVEARAAEQLRSGGSFV
Ga0126378_1045606813300010361Tropical Forest SoilMGSFRKRLLLLIIGLVIVTQTVTLAAVLAITRRTVEARAAEQLRSGGAF
Ga0126378_1297234823300010361Tropical Forest SoilMGSFRKRLLVLIIGLVIVTQTVTLAAVLASTRGAVEERA
Ga0126381_10335842123300010376Tropical Forest SoilMGSFRKRLLVLIIGLVIVTQTVTLAAVLASTRGTVEARAR
Ga0134126_1079978713300010396Terrestrial SoilMRSFRKRLLVLIIGLAVLTQTVTLFAVLASTARDVRARA
Ga0134127_1313401213300010399Terrestrial SoilMGSFRKRLLVLIIGLAVLTQTVTLFAVLASTSRNVQARGAEQLTAAGS
Ga0134123_1232603823300010403Terrestrial SoilVTSFRKRILVLIIGLIAVTRTVTLVAVLASTRRNVESRAAEQLAAGSSY
Ga0137399_1094986013300012203Vadose Zone SoilMGSFRKRLLVLIIGLVIVTQTVTLAAVLASTARTVEARAAEQLRSGG
Ga0137362_1178358713300012205Vadose Zone SoilMGSFRKRLLVLIIGLVIVTQTVTLAAVLASTRRTVEARA
Ga0137377_1005333413300012211Vadose Zone SoilMGSFRKRLLVLIIGLGVVTQTVTLAAVLVSTRQTVEARAAEQLRSG
Ga0137404_1029122733300012929Vadose Zone SoilMGSFRKRLLVLIIGLVIVTQTVTLAAVLASTRRTVEARAAEQL
Ga0153915_1024588413300012931Freshwater WetlandsMGSFRKRLLVLIIGLVVVTQTVTLAAVLASTAHTVEGRASDELR
Ga0126369_1082455113300012971Tropical Forest SoilMRSFRKRLLVLLIGLVIVTQTVTLAAVLLSTRRTVETRSGEQLRSGNAL
Ga0164309_1000347873300012984SoilMRSFRKRLLVLIIGLVIVTQTVTLAAVLASTRRTVEARSWEQ
Ga0181537_1111571613300014201BogMRSFRKRLLVLIIGLVIVTQTVTLAAVLASTAHNVEARAVEQLRSGGT
Ga0075355_113393523300014322Natural And Restored WetlandsMRSFRKRLLVLIIGLVIVTQTVTLAAVLASTRRAVETRSAAQLRSG
Ga0163163_1056936213300014325Switchgrass RhizosphereMGSFRKRLLVLIIGLAIVTQTVTLAAVLASTAHNVEARAAEQLRSGSS
Ga0182024_1257839513300014501PermafrostMGSFRKRLLVLIIGLVVVTQTVTLAAVLASTAHNVEARAAEQLRS
Ga0157377_1144539613300014745Miscanthus RhizosphereMNSFRNRLLVLIIGLIAVTQTVTLVAVLASTRRNV
Ga0137420_149781133300015054Vadose Zone SoilVIIIRVCFHGSFRKRLLVLIIGLVVVTQTVTLAAVLASTAHTVEGRAAEQLRS
Ga0182007_1039641613300015262RhizosphereMGSFRKRLLVLIIGLVVLTQTVTLAAVLASTSLNVQGRAGERLRAGG
Ga0182041_1162084423300016294SoilMGSFRNRLLVLTIGVVIVPQTVTLAAVLISTRQTGAARAA
Ga0182032_1134358413300016357SoilMGSFRNRLLVLIIGLVIVTQTVTLAAVLISTRQTVEVRA
Ga0182032_1139393113300016357SoilMGSFRNRLLVLIIGLVIVTQTVTLAAVLISTRQTVE
Ga0187783_1053315923300017970Tropical PeatlandMGSFRNRLLVLIIGLVVVTQTVTLAAVLISTHRTVETRAAEQLRA
Ga0187780_1079343113300017973Tropical PeatlandMGSFRNRLLVLIIGLVIVTQTVTLAAVLLSTRRTVEARAAEQL
Ga0187823_1019685713300017993Freshwater SedimentMRSFRNRLLVLIIGLDIVTQTVTLAAVLLSTRRTVEARAA
Ga0187767_1032167513300017999Tropical PeatlandMGSFRNRLLVLIIGLVVVTQTVTLAAVLVSTRRTVETRAAEQL
Ga0187765_1090658013300018060Tropical PeatlandMRSFRKRLLVLIIGLVVVTQTVTLAAVLASTRRTVEARSWEQL
Ga0179594_1005714833300020170Vadose Zone SoilMGSFRKRLLVLIIGLVIVTQTVTLAAVLASTRRTVEARAA
Ga0179592_1041970713300020199Vadose Zone SoilMGSFRKRLLVLIIGLVVVTQTVTLAAVLASTAHTVEGRAAQELRSGGS
Ga0210400_1162201313300021170SoilMGSFRKRLLVLIIGLVIVTQTVTLAAVLASTSTTV
Ga0213874_1009885823300021377Plant RootsMNSFRNRLLVLLIGLVVLIQTVTLFAVLARTSRNVEARAAEELRSGGSVVQQFV
Ga0210385_1134063423300021402SoilMGSFRKRLLVLIIGLVIVTQTVTLAAVLASTAHNVEARAAEQLRSG
Ga0210397_1036865633300021403SoilMRSFRKRLLVLIIGLVIVTQTVTLAAVLASTRRAVETRSAAQLRAGGSL
Ga0210394_1014941533300021420SoilMGSFRKRLLVLIIGLVIVTQTVTLAAVLASTRGAVEQRA
Ga0210394_1096045423300021420SoilMGSFRKRLLVLIIGLVIVTQTVTLAAVLASTAHNVEARAAEQLRSGGSFVQ
Ga0210384_1012569113300021432SoilMGDIFEGFMGSFRKRLLVLIIGLSVVTQTVTLAAVLISTRRTV
Ga0210384_1059311413300021432SoilMGSFRKRLLVLIIGLVIVTQTVTLAAVLASTRRTVE
Ga0210398_1121017313300021477SoilMRSFRKRLLVLLIGLVIVTQTVTLAAVLASTRRTVEARSWDQLRSGAAL
Ga0210410_1023195233300021479SoilMGSFRKRLLVLIIGLVIVTQTVTLAAVLASTRGAVEQRAKEQLGSG
Ga0210409_1054513933300021559SoilMGSFRKRLLALIIGLVVVTQTVTLAAVLASTRRTVEARAAEQLRS
Ga0126371_1038613733300021560Tropical Forest SoilMGSFRKRLLVLIIGLVIVTQTVTLAAVLASTRGTVEERAKE
Ga0126371_1222688223300021560Tropical Forest SoilMRSFRKRLLVLLIGLVIVTQTVTLAAVLLSTRRTVEARSAEQLRSG
Ga0126371_1263729713300021560Tropical Forest SoilMGSFRNRLLVLIIGLVIVTQTVTLAAVLLSTRRTVE
Ga0247764_121979713300022897Plant LitterMGSFRNRLLVLIIGLVVVTQSVTLIAVLARVEQTVEGRAAGELGAGG
Ga0247776_1011152713300023275Plant LitterMGSFRKRLLVLIIGLVVVTQTVTLAAVLASIAHDVESRAAE
Ga0207700_1107880913300025928Corn, Switchgrass And Miscanthus RhizosphereMGSFRNRLLVLIIGLVIVTQTVTLAAVLLSTRRTVEA
Ga0207669_1089614123300025937Miscanthus RhizosphereMNSFRNRLLVLIIGLIAVTQTVTLVAVLASTRRNVEAR
Ga0207651_1008533233300025960Switchgrass RhizosphereMNSFRNRLLVLIIGLIAVTQTVTLVAVLASTRRNVEA
Ga0208541_102922513300026061Natural And Restored WetlandsMNSFRNRLLVLIIGLIAVTQTVTLVAVLESTRRSVEARAAEQLTA
Ga0207641_1247273623300026088Switchgrass RhizosphereMGSFRNRLLVLIIGLVVVTQSVTLIAVLARVEQTVEGRAAGELGAGGA
Ga0207675_10075806013300026118Switchgrass RhizosphereMGSFRNQLLALIIGLIIVTQSVTLIAVLARVDGSVAQRATEQLESVSNFIE
Ga0207698_1139044613300026142Corn RhizosphereMSSFRKRLLVLIIGLVVVTQTVTLAAVLASTAHNVAARAAEQLRSGSS
Ga0209158_101822113300026333SoilMGSFRKRLLVLIIGLGVVTQTVTLAAVLVSTRHTVEARAAEQLRS
Ga0257167_107898013300026376SoilMGSFRKRLLVLIIGLVIVTQTVTLAAVLASTRRTVEAR
Ga0207800_102976613300027043Tropical Forest SoilMTSFRKRLLVLIIGLVIVTQTVTLAAVLLGTRQTVEARAAEQLRSGGTLA
Ga0209275_1004265513300027884SoilMGSFRKRLLVLIIGLVIVTQTVTLAAVLASTAHNV
Ga0209068_1036634423300027894WatershedsMRSFRKRLLVLIIGLVIVTQTVTLAAVLASTRRAVE
Ga0302228_1008957913300028808PalsaMGSFRNQLLAVIIGLVCVTQTVTLIAVLARTEHSVEERAAKQLV
Ga0308309_1134904523300028906SoilMNSFRKRLLVLIIGLVVVTQTVTLAAVLASTRRTVEARSWEQ
Ga0302306_1022389223300030043PalsaMGSFRNRLLAVIIGLVCVTQTVTLIAVLARTEHSVQERAAKQLVAGS
Ga0302314_1084647223300030906PalsaMGSFRKRLLVLIIGLVIVTQTVTLAAVLASTAHNVEARAAEQLRSGGSFVE
Ga0265331_1055568423300031250RhizosphereMGSFRKRLLVLIIGLVIVTQTVTLAAVLASTAHDVQARAAEQLRSGG
Ga0318534_1046111213300031544SoilMGSFRNRLLVLIIGLVIVTETVTLAAVLISTRRTVEAR
Ga0318561_1010147333300031679SoilMGSFRNRLLVLIIGLVIVTQTVTLAAVLLSTRRTV
Ga0318574_1028888513300031680SoilMNSFRNRLLVLIVGLVIVTQTVTFFAVAARTQRDVEA
Ga0318572_1033265523300031681SoilMGSFRKRLLVLIIGLSVVTQTVTLAAVLISTRQTVQA
Ga0318560_1000809013300031682SoilMGSFRNRLLVLIIGLVIVTQTVTLAAVLISTRQTVEVR
Ga0310813_1016924813300031716SoilMSSFRNRLLVLIIGLVIVTQTVTLAAVLLSTRRTVEARAAE
Ga0306917_1073312323300031719SoilMGRFRNRLLVLIIGLVIVTQTVTLAAVLISTRRMV
Ga0318500_1051602313300031724SoilMGSFRNRLLVLIIGLVIVTQTVTLAAVLLSTRRTVEARAAEQLR
Ga0318535_1042421023300031764SoilMGSFRNRLLVLIIGLVIVTETVTLAAVLISTRRTVEARAAEQM
Ga0318554_1066904713300031765SoilMGSFRNRLLVLIIGLVIVTQTVTLAAVLLSTRRTVEARAAEELRAGGTLAEH
Ga0318521_1006136733300031770SoilMGRFRNRLLVLIIGLVIVTQTVTLAAVLISTRRMVETRA
Ga0318498_1002917813300031778SoilMGRFRNRLLVLIIGLVIVTQTVTLAAVLISTRRTVETRAAEQLR
Ga0318498_1017455113300031778SoilMNSFRNRLLVLIVGLVIVTQTVTFFAVAARTQRDVEARAAE
Ga0318547_1059051823300031781SoilMGSFRNRLLVLIIGLVIVTQFVTLAAVLLSTRRTVEARAAEELRTGGALA
Ga0318548_1000392313300031793SoilMSSFRNRLLVLIIGLVIVTQTVTLAAVLISTRRMVEARAAEQL
Ga0318548_1021155813300031793SoilMGSFRNRLLVLIIGLVIVTETVTLAAVMISTRRTVEARAAEQMR
Ga0318557_1018213813300031795SoilMGRFRNRLLVLIIGLVIVTQTVTLAAVLISTRRTVETRAAEQLRSGGT
Ga0318557_1032758723300031795SoilMGRFRNRLLVLIIGLVIVTQTVTLAAVLISTRRMVETRAAEQLRSGATL
Ga0318565_1001323553300031799SoilMGRFRNRLLVLIIGLVIVTQTVTLAAVLISTRRTV
Ga0318567_1080616023300031821SoilMGSFRNRLLVLIIGLVIVTQTVTLAAVLISTRQTV
Ga0307478_1095694613300031823Hardwood Forest SoilMGSFRNRFLVLIIGLVIVTQTVTLAAVLLSTRRTVEARAAEQLRAGGTL
Ga0318520_1003815843300031897SoilMGRFRNRLLVLIIGLVIVTQTVTLAAVLISTRRTVEARAAEQLRS
Ga0318520_1082610413300031897SoilMGSFRNRLLVLIIGLVIVTETVTLAAVLISTRRTVEARAAE
Ga0306921_1051348333300031912SoilMGRFRNRLLVLIIGLVIVTQTVTLAAVLISTRRTVEARAAEQLRSG
Ga0306921_1066791433300031912SoilMGSFRKRLLVLIIGLSVVTQTVTLAAVLISTRQTVQARAAEE
Ga0310913_1100203113300031945SoilMGSFRNRLLVLIIGLVIVTQTVTLAAVLISTRRTVEARAAEQLRSGGA
Ga0306922_1064992733300032001SoilMNSFRNRLLVLIVGLVIVTQTVTFFAVAARTQRDVEAR
Ga0318562_1023284133300032008SoilMGSFRNRLLVLIIGLVIVTQTVTLAAVLLSTRRTVEARAAEQLRSGAALAD
Ga0318562_1075907023300032008SoilMGSFRNRLLVLIIGLVIVTETVTLAAVLISTRRTVEARAAEQMRSGAA
Ga0318563_1008399013300032009SoilMGRFRNRLLVLIIGLVIVTQTVTLAAVLISTRRTVEAR
Ga0318507_1017709213300032025SoilMGSFRNRLLVLIIGLVIVTQTVTLAAVLISTRRTVE
Ga0310911_1016626813300032035SoilMGSFRNRLLVLIIGLVIVTQTVTLAAVLISTRQTVEAR
Ga0318549_1021477523300032041SoilMGRFRNRLLVLIIGLVIVTQTVTLAAVLISTRRTVEARAAEQLR
Ga0318556_1067742513300032043SoilMNSFRNRVLVLIVGLVIVTQTVTFFAVAARTQRDVQARAAEQ
Ga0318558_1005931233300032044SoilMGSFRNRLLVLIIGLVIVTQTVTLAAVLISTRRTV
Ga0318570_1006622333300032054SoilMGRFRNRLLVLIIGLVIVTQTVTLAAVLISTRRTVEARAAEQLRSGGTLA
Ga0318505_1011970413300032060SoilMGSFRKRLLVLIIGLSVVTQTVTLAAVLISTRQTVQARAAEELRSGG
Ga0318524_1006123313300032067SoilMGRFRNRLLVLIIGLVIVTQTVTLAAVLISTRRTVE
Ga0318553_1063839923300032068SoilMGSFRNRLLVLIIGLVIVTETVTLAAVLISTRRTVEARAAEQMRS
Ga0307470_1187585823300032174Hardwood Forest SoilMNSFRNRLLVLIIGLIAVTQTVTLVAVLASTRRNVE
Ga0315276_1159605413300032177SedimentMNSFRNRLLVLIIGLIAVTQTVTLVAVLESTRRNVEARAADQLTAGASYA
Ga0307472_10043035013300032205Hardwood Forest SoilMGSFRKRLLVLIIGLVVVTQTVTLAAVLVSTRRTVEARAAEQLR
Ga0306920_10048776013300032261SoilMGSFRNRLLVLIIGLVIVTQTVTLAAVLISTRRMVEARAAEQL
Ga0335079_1033487633300032783SoilMNSFRNRLLVLIIGLVIVTQTVTFFAVLARTRSAVETRAAEQLRSGGSVVQQFM
Ga0335078_1044185013300032805SoilMGSFRKRLLVLIIGLVVVTQTVTLAAVLASTRGTVEERAAEQLSSGG
Ga0335077_1209702713300033158SoilMGSFRKRLLVLIIGLVIVTQTVTLAAVLASTRGTVRARAAEQLSQGGALA
Ga0318519_1017791033300033290SoilMGSFRNRLLVLIIGLVIVTQTVTLAAVLISTRRMV
Ga0310810_1115865713300033412SoilMGSFRNRLLVLIIGLVIVTQTVTLAAVLLSTRRTVEARAA
Ga0373916_0052143_442_5913300034894Sediment SlurryMRSFRNRLLVLIIGLIIVTQTVTVFAVLASARRNVEARAAEQLAAGGSYA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.