NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metatranscriptome Family F056293

Metatranscriptome Family F056293

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F056293
Family Type Metatranscriptome
Number of Sequences 137
Average Sequence Length 140 residues
Representative Sequence MKEELRGEGGSDVFSSTRHVNPNANYSSNDFKMKFWSNDDAPIIRPLLKTQPSSFAKEISMGVNHSQADGYGGIACKKVTKISGRSQKQWMAAYAALILSGTAIFGLLVKYKKPKIA
Number of Associated Samples 97
Number of Associated Scaffolds 137

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 29.20 %
% of genes near scaffold ends (potentially truncated) 43.80 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 81
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (52.555 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(86.861 % of family members)
Environment Ontology (ENVO) Unclassified
(98.540 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(89.781 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 26.50%    β-sheet: 5.98%    Coil/Unstructured: 67.52%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 137 Family Scaffolds
PF14572Pribosyl_synth 0.73



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms52.55 %
UnclassifiedrootN/A47.45 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300008998|Ga0103502_10204525All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda722Open in IMG/M
3300009028|Ga0103708_100086584All Organisms → cellular organisms → Eukaryota761Open in IMG/M
3300009028|Ga0103708_100203790Not Available577Open in IMG/M
3300009274|Ga0103878_1011510Not Available826Open in IMG/M
3300009276|Ga0103879_10025156Not Available616Open in IMG/M
3300018533|Ga0193523_113726All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda535Open in IMG/M
3300018588|Ga0193141_1017675All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus553Open in IMG/M
3300018649|Ga0192969_1054320All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus541Open in IMG/M
3300018654|Ga0192918_1054936Not Available586Open in IMG/M
3300018654|Ga0192918_1064252Not Available522Open in IMG/M
3300018657|Ga0192889_1038978All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus699Open in IMG/M
3300018683|Ga0192952_1021667All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda638Open in IMG/M
3300018690|Ga0192917_1050648Not Available623Open in IMG/M
3300018690|Ga0192917_1056089Not Available586Open in IMG/M
3300018690|Ga0192917_1058742Not Available570Open in IMG/M
3300018692|Ga0192944_1051795All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda583Open in IMG/M
3300018696|Ga0193110_1044574Not Available531Open in IMG/M
3300018704|Ga0192954_1036674All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda656Open in IMG/M
3300018704|Ga0192954_1042002All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda617Open in IMG/M
3300018706|Ga0193539_1061700All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda593Open in IMG/M
3300018707|Ga0192876_1046208All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda730Open in IMG/M
3300018708|Ga0192920_1069990Not Available589Open in IMG/M
3300018717|Ga0192964_1070572All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda750Open in IMG/M
3300018720|Ga0192866_1058128All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus600Open in IMG/M
3300018723|Ga0193038_1049223All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus650Open in IMG/M
3300018731|Ga0193529_1076412All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus583Open in IMG/M
3300018736|Ga0192879_1121956All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus502Open in IMG/M
3300018756|Ga0192931_1089711Not Available569Open in IMG/M
3300018765|Ga0193031_1062354All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus628Open in IMG/M
3300018770|Ga0193530_1064693All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda704Open in IMG/M
3300018771|Ga0193314_1082988Not Available520Open in IMG/M
3300018783|Ga0193197_1073989Not Available502Open in IMG/M
3300018792|Ga0192956_1119971All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus622Open in IMG/M
3300018793|Ga0192928_1087028Not Available535Open in IMG/M
3300018793|Ga0192928_1088931Not Available528Open in IMG/M
3300018794|Ga0193357_1055596Not Available655Open in IMG/M
3300018794|Ga0193357_1059729Not Available631Open in IMG/M
3300018794|Ga0193357_1073216Not Available564Open in IMG/M
3300018804|Ga0193329_1085979Not Available597Open in IMG/M
3300018813|Ga0192872_1080201All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda560Open in IMG/M
3300018813|Ga0192872_1080644All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda558Open in IMG/M
3300018845|Ga0193042_1109432All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda707Open in IMG/M
3300018845|Ga0193042_1125327All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus626Open in IMG/M
3300018848|Ga0192970_1067474All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda662Open in IMG/M
3300018854|Ga0193214_1091054Not Available557Open in IMG/M
3300018856|Ga0193120_1125872Not Available591Open in IMG/M
3300018896|Ga0192965_1150263All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda691Open in IMG/M
3300018901|Ga0193203_10271840All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus533Open in IMG/M
3300018903|Ga0193244_1027753All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1011Open in IMG/M
3300018903|Ga0193244_1030179All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus974Open in IMG/M
3300018903|Ga0193244_1103440All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus524Open in IMG/M
3300018912|Ga0193176_10235840Not Available522Open in IMG/M
3300018952|Ga0192852_10208978Not Available637Open in IMG/M
3300018957|Ga0193528_10064643All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1324Open in IMG/M
3300018961|Ga0193531_10223995All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda693Open in IMG/M
3300018965|Ga0193562_10111551Not Available783Open in IMG/M
3300018965|Ga0193562_10148686All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda669Open in IMG/M
3300018965|Ga0193562_10168041Not Available621Open in IMG/M
3300018966|Ga0193293_10065454Not Available653Open in IMG/M
3300018969|Ga0193143_10219003All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus544Open in IMG/M
3300018972|Ga0193326_10043338Not Available713Open in IMG/M
3300018974|Ga0192873_10142361All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus1043Open in IMG/M
3300018974|Ga0192873_10434414All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus516Open in IMG/M
3300018978|Ga0193487_10180431Not Available710Open in IMG/M
3300018978|Ga0193487_10282917Not Available509Open in IMG/M
3300018980|Ga0192961_10163085All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda677Open in IMG/M
3300018981|Ga0192968_10113491All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus717Open in IMG/M
3300018982|Ga0192947_10202686Not Available652Open in IMG/M
3300018985|Ga0193136_10118640Not Available773Open in IMG/M
3300018986|Ga0193554_10272945Not Available639Open in IMG/M
3300018986|Ga0193554_10359520Not Available549Open in IMG/M
3300018986|Ga0193554_10385621Not Available526Open in IMG/M
3300018989|Ga0193030_10179056All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda694Open in IMG/M
3300018989|Ga0193030_10227513All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus613Open in IMG/M
3300018994|Ga0193280_10349439Not Available524Open in IMG/M
3300018996|Ga0192916_10192789Not Available596Open in IMG/M
3300018998|Ga0193444_10117428Not Available705Open in IMG/M
3300019000|Ga0192953_10047355All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus913Open in IMG/M
3300019004|Ga0193078_10219891All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus506Open in IMG/M
3300019006|Ga0193154_10220402Not Available663Open in IMG/M
3300019006|Ga0193154_10253903Not Available600Open in IMG/M
3300019007|Ga0193196_10297985Not Available693Open in IMG/M
3300019007|Ga0193196_10387400Not Available588Open in IMG/M
3300019007|Ga0193196_10402528Not Available573Open in IMG/M
3300019007|Ga0193196_10433123Not Available545Open in IMG/M
3300019008|Ga0193361_10290056Not Available567Open in IMG/M
3300019008|Ga0193361_10334731Not Available509Open in IMG/M
3300019010|Ga0193044_10157223All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda739Open in IMG/M
3300019011|Ga0192926_10339912Not Available640Open in IMG/M
3300019011|Ga0192926_10340809Not Available639Open in IMG/M
3300019012|Ga0193043_10188844All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda832Open in IMG/M
3300019012|Ga0193043_10188845All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda832Open in IMG/M
3300019012|Ga0193043_10216276All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus751Open in IMG/M
3300019015|Ga0193525_10337664Not Available706Open in IMG/M
3300019017|Ga0193569_10241627All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda778Open in IMG/M
3300019017|Ga0193569_10281570All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus697Open in IMG/M
3300019017|Ga0193569_10281571All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus697Open in IMG/M
3300019019|Ga0193555_10061680Not Available1366Open in IMG/M
3300019019|Ga0193555_10095782Not Available1079Open in IMG/M
3300019020|Ga0193538_10201931All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda674Open in IMG/M
3300019022|Ga0192951_10279595All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda628Open in IMG/M
3300019022|Ga0192951_10317743All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda589Open in IMG/M
3300019024|Ga0193535_10218185All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda601Open in IMG/M
3300019036|Ga0192945_10223392All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda601Open in IMG/M
3300019038|Ga0193558_10371955Not Available513Open in IMG/M
3300019040|Ga0192857_10251053Not Available589Open in IMG/M
3300019053|Ga0193356_10182362Not Available737Open in IMG/M
3300019053|Ga0193356_10293156Not Available572Open in IMG/M
3300019055|Ga0193208_10449797Not Available675Open in IMG/M
3300019055|Ga0193208_10621916Not Available562Open in IMG/M
3300019055|Ga0193208_10656761Not Available544Open in IMG/M
3300019055|Ga0193208_10666810Not Available539Open in IMG/M
3300019055|Ga0193208_10728592Not Available510Open in IMG/M
3300019100|Ga0193045_1044970All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda724Open in IMG/M
3300019100|Ga0193045_1053971All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus643Open in IMG/M
3300019103|Ga0192946_1042611All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda680Open in IMG/M
3300019111|Ga0193541_1030854All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda899Open in IMG/M
3300019119|Ga0192885_1051051All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus553Open in IMG/M
3300019131|Ga0193249_1144734All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda510Open in IMG/M
3300019147|Ga0193453_1162382Not Available576Open in IMG/M
3300019147|Ga0193453_1164010Not Available572Open in IMG/M
3300019147|Ga0193453_1166122Not Available567Open in IMG/M
3300019151|Ga0192888_10253371All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda506Open in IMG/M
3300031550|Ga0307392_1030654All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda659Open in IMG/M
3300031717|Ga0307396_10514138Not Available575Open in IMG/M
3300031729|Ga0307391_10791623Not Available543Open in IMG/M
3300031734|Ga0307397_10470142Not Available585Open in IMG/M
3300031735|Ga0307394_10291083All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda648Open in IMG/M
3300031737|Ga0307387_10743628All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda618Open in IMG/M
3300031739|Ga0307383_10536795All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda585Open in IMG/M
3300032519|Ga0314676_10821035All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda535Open in IMG/M
3300032651|Ga0314685_10686425All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda552Open in IMG/M
3300032666|Ga0314678_10574273All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda505Open in IMG/M
3300032714|Ga0314686_10531843All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda577Open in IMG/M
3300032733|Ga0314714_10815844All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus502Open in IMG/M
3300033572|Ga0307390_10871120All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus569Open in IMG/M
3300033572|Ga0307390_11046246All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda518Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine86.86%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine6.57%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater3.65%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water1.46%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water1.46%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300008998Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_A100000548EnvironmentalOpen in IMG/M
3300009028Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S3EnvironmentalOpen in IMG/M
3300009274Eukaryotic communities of water from the North Atlantic ocean - ACM10EnvironmentalOpen in IMG/M
3300009276Eukaryotic communities of water from the North Atlantic ocean - ACM57EnvironmentalOpen in IMG/M
3300018533Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_147 - TARA_N000002107 (ERX1789415-ERR1719338)EnvironmentalOpen in IMG/M
3300018588Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000538 (ERX1782191-ERR1712140)EnvironmentalOpen in IMG/M
3300018649Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001440 (ERX1782476-ERR1712161)EnvironmentalOpen in IMG/M
3300018654Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000841 (ERX1782169-ERR1712180)EnvironmentalOpen in IMG/M
3300018657Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000705 (ERX1789382-ERR1719418)EnvironmentalOpen in IMG/M
3300018683Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001394 (ERX1782475-ERR1712204)EnvironmentalOpen in IMG/M
3300018690Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000839 (ERX1782228-ERR1712109)EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018696Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000864 (ERX1782143-ERR1711870)EnvironmentalOpen in IMG/M
3300018704Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001396 (ERX1782253-ERR1711956)EnvironmentalOpen in IMG/M
3300018706Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002813 (ERX1789488-ERR1719151)EnvironmentalOpen in IMG/M
3300018707Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000746 (ERX1789613-ERR1719509)EnvironmentalOpen in IMG/M
3300018708Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000843 (ERX1782185-ERR1711899)EnvironmentalOpen in IMG/M
3300018717Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001362 (ERX1789634-ERR1719196)EnvironmentalOpen in IMG/M
3300018720Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000793 (ERX1789656-ERR1719302)EnvironmentalOpen in IMG/M
3300018723Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_046 - TARA_N000000268 (ERX1782137-ERR1712170)EnvironmentalOpen in IMG/M
3300018731Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_151 - TARA_N000002755 (ERX1782345-ERR1712158)EnvironmentalOpen in IMG/M
3300018736Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000750 (ERX1789504-ERR1719154)EnvironmentalOpen in IMG/M
3300018756Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000879 (ERX1789481-ERR1719268)EnvironmentalOpen in IMG/M
3300018765Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782330-ERR1712010)EnvironmentalOpen in IMG/M
3300018770Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002783 (ERX1789454-ERR1719490)EnvironmentalOpen in IMG/M
3300018771Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001658 (ERX1789535-ERR1719438)EnvironmentalOpen in IMG/M
3300018783Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000011 (ERX1782442-ERR1712209)EnvironmentalOpen in IMG/M
3300018792Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001398 (ERX1782120-ERR1711892)EnvironmentalOpen in IMG/M
3300018793Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000876 (ERX1789367-ERR1719325)EnvironmentalOpen in IMG/M
3300018794Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001823 (ERX1782102-ERR1711992)EnvironmentalOpen in IMG/M
3300018804Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_109 - TARA_N000001738 (ERX1789642-ERR1719208)EnvironmentalOpen in IMG/M
3300018813Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782297-ERR1712172)EnvironmentalOpen in IMG/M
3300018845Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001426 (ERX1809760-ERR1740122)EnvironmentalOpen in IMG/M
3300018848Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001442 (ERX1789421-ERR1719148)EnvironmentalOpen in IMG/M
3300018854Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000076 (ERX1789602-ERR1719346)EnvironmentalOpen in IMG/M
3300018856Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001006 (ERX1782473-ERR1712200)EnvironmentalOpen in IMG/M
3300018896Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001362 (ERX1789685-ERR1719483)EnvironmentalOpen in IMG/M
3300018901Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000014 (ERX1782459-ERR1712126)EnvironmentalOpen in IMG/M
3300018903Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001499 (ERX1789636-ERR1719512)EnvironmentalOpen in IMG/M
3300018912Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000314 (ERX1782195-ERR1712243)EnvironmentalOpen in IMG/M
3300018952Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000539 (ERX1782281-ERR1712142)EnvironmentalOpen in IMG/M
3300018957Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_151 - TARA_N000002755 (ERX1782215-ERR1712088)EnvironmentalOpen in IMG/M
3300018961Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002783 (ERX1789414-ERR1719458)EnvironmentalOpen in IMG/M
3300018965Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_149 - TARA_N000002141EnvironmentalOpen in IMG/M
3300018966Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001614 (ERX1809469-ERR1739845)EnvironmentalOpen in IMG/M
3300018969Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000539 (ERX1782234-ERR1712179)EnvironmentalOpen in IMG/M
3300018972Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_109 - TARA_N000001734 (ERX1789632-ERR1719168)EnvironmentalOpen in IMG/M
3300018974Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782160-ERR1711971)EnvironmentalOpen in IMG/M
3300018978Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_136 - TARA_N000002965 (ERX1789639-ERR1719422)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018981Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001440 (ERX1782157-ERR1712238)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018985Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_020 - TARA_A100000761 (ERX1782416-ERR1711874)EnvironmentalOpen in IMG/M
3300018986Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000596EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300018994Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001586 (ERX1789578-ERR1719368)EnvironmentalOpen in IMG/M
3300018996Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000839 (ERX1782178-ERR1712156)EnvironmentalOpen in IMG/M
3300018998Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002360 (ERX1782428-ERR1712117)EnvironmentalOpen in IMG/M
3300019000Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001394 (ERX1782320-ERR1712129)EnvironmentalOpen in IMG/M
3300019004Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_051 - TARA_N000000225 (ERX1782445-ERR1712173)EnvironmentalOpen in IMG/M
3300019006Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000394 (ERX1782339-ERR1711936)EnvironmentalOpen in IMG/M
3300019007Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000011 (ERX1782393-ERR1712012)EnvironmentalOpen in IMG/M
3300019008Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001826 (ERX1789684-ERR1719447)EnvironmentalOpen in IMG/M
3300019010Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809462-ERR1739838)EnvironmentalOpen in IMG/M
3300019011Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000871 (ERX1782184-ERR1712079)EnvironmentalOpen in IMG/M
3300019012Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001426 (ERX1809764-ERR1740129)EnvironmentalOpen in IMG/M
3300019015Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_147 - TARA_N000002109 (ERX1789583-ERR1719280)EnvironmentalOpen in IMG/M
3300019017Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002781EnvironmentalOpen in IMG/M
3300019019Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_137 - TARA_N000002929EnvironmentalOpen in IMG/M
3300019020Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002813 (ERX1789673-ERR1719264)EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019024Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002797 (ERX1789427-ERR1719237)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019038Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_143 - TARA_N000003141EnvironmentalOpen in IMG/M
3300019040Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000963 (ERX1782167-ERR1712154)EnvironmentalOpen in IMG/M
3300019053Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001823 (ERX1782123-ERR1712241)EnvironmentalOpen in IMG/M
3300019055Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000073 (ERX1782414-ERR1711963)EnvironmentalOpen in IMG/M
3300019100Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809468-ERR1739839)EnvironmentalOpen in IMG/M
3300019103Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782358-ERR1712021)EnvironmentalOpen in IMG/M
3300019111Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782321-ERR1712210)EnvironmentalOpen in IMG/M
3300019119Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000701 (ERX1789718-ERR1719442)EnvironmentalOpen in IMG/M
3300019131Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001424 (ERX1809759-ERR1740116)EnvironmentalOpen in IMG/M
3300019147Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_132 - TARA_N000002400 (ERX1782434-ERR1711973)EnvironmentalOpen in IMG/M
3300019151Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000705 (ERX1789682-ERR1719501)EnvironmentalOpen in IMG/M
3300031550Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031717Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031734Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031735Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031737Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032519Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032651Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032666Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032714Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032733Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb12_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0103502_1020452513300008998MarineMKEELRGEGGSDAFSSTRHVNPNANQAEHSAGERNFWKKEKDSVKFPDSRSNYSSNDFKMKFWSTDDAPIIRPLLKTQPSSLAKEISMGVNHNQADGYGGIACKKITKISGRSQKQWMAAYAALILSGTAIFGLLVKYKKPKIA*
Ga0103708_10008658423300009028Ocean WaterMKEALRGEGGSDVFSSTRHVNPNTTQTSNDFKMKFWSNGDSPVIRPLLKTQPHSVQPQISMGVNQHQADGYGGIACERITKISGRTSRQWMAAYSALILSGSAIFGLLVKYKKPKIA*
Ga0103708_10020379013300009028Ocean WaterMGELKGEGGSDVFSSTRHVNSNANYASNDYKMKFWSNDDSPLIRPLLKTQPQRPTTEIYMGVNQPQADGYGGIACKKVTKISGRTSKQWMAAYAALILGGSAVFGLLVKYKKPKI
Ga0103878_101151023300009274Surface Ocean WaterKNSHSYKIYNSTTKRNRFTIQQFNYKPTAIPLEQQIRKKSAQTKINMKEALRGEGGSDVFSSTRHVNPNANQAEHSAGERNFWRNEEQSTQASNEFKMKFWSNDDSPLIRPLLRTEPHSMKKPEITMGVNQHHADGYGGIACERITKISGRTSRQWMAAYAALILGGSAIFGLLVKYRKPKIA*
Ga0103879_1002515613300009276Surface Ocean WaterMNNKKRKKSAQTKINMKEALRGEGGSDVFSSTRHVNPNANQAEHSAGERNFWRNEEQSTQASNEFKMKFWSNDDSPLIRPLLRTEPHSMKKPEITMGVNQHHADGYGGIACERITKISGRTSRQWMAAYAALILGGSAIFGLLVKYKKPKIA*
Ga0193523_11372613300018533MarineMKEELRGEGGSDVFSSTRHVNPNANQAEHSAGERNFWKKEKDSVKFPDSRSNYSSNDFKMKFWSNDDAPIIRPLLKTQPSSVAKEISMGVNHNQADGYGGIACKKITKISGRSQKQWIAAYAALILSGTAVFGLLVKYKKPKIA
Ga0193141_101767513300018588MarineYVSNFCERRSTFTKFQFQASSSTDCRSEHIQYCKEENKIMKDELRGEGGSDAFSSTRHVNPNANYSSNDFKMKFWSTDDAPIIRPLLKTQPSSLAKEISMGVNHNQADGYGGIACKKITKISGRSQKQWMAAYAALILSGTAIFGLLVKYKKPKIA
Ga0192969_105432013300018649MarineEDKIMKDELRGEGGSDVFSTTRHVNPNANQAEHRAGERNFWKKEKDTNYSSNEFKMKFWSNDDAPIIRPLLKTQPSFVAKEISMGVNHNQADGYGGIACKKITKISGRSQKQWMAAYAALILSGTAVFGLLVKYKKPKIA
Ga0192918_105493613300018654MarineMKEALRGEGGSDVFSSTRHVNPNANQAEHSAGERNFWRNEEQSTQASNEFKMKFWSNDDSPLIRPLLRTEPHSMKKPEITMGVNQHHADGYGGIACERITKISGRTSRQWMAAYAALILGGSAIFGLLVKYKKPKIA
Ga0192918_106425213300018654MarineMKEALRGEGGSDVFSSTRHVNPNATQTSNEFKMKFWSNDDSPLIRPLLRTEPHSMKKPEITMGVNQHHADGYGGIACERITKISGRTSRQWMAAYAALILGGSAIFGLLVKYKKPKIA
Ga0192889_103897813300018657MarineMKEEQLRGEGGSDAFSSTRHVNPNANYSSNDYKMKFWSNDDAPIIRPLLKTQPSSVAKEISMGVNHNQADGYGGIACKKITKISGRSQKQWIAAYAALILSGTAVFGLLVKYKKPKIA
Ga0192952_102166713300018683MarineTFTKYQCQALFQYRLCRSEHIQYSKEENKIMKDELRGEGGSDVFSTTRHVNPNANQAEHRAGERNFWKKGKDTNYSSNEFKMKFWSNDDAPIIRPLLKTQPSSVSKEISMGVNHNQADGYGGIACKKITKISGRSQKQWMAAYAALILSGTAVFGLLVKYKKPKIA
Ga0192917_105064813300018690MarineMKEALRGEGGSDVFSSTRHVNPNANQAEHSAGERNFWRNEEQSTQASNEFKMKFWSNDDSPLIRPLLRTEPHSMKKPEITMGVNQHHADGYGGIACERITKISGRTSRQWMAAYAALILGGSAIFGLLVKYRKPKIA
Ga0192917_105608913300018690MarineMKEALRGEGGSDVFSSTRHVNPNATQTSNEFKMKFWSNDDSPLIRPLLRTEPHSMKKPEITMGVNQHHADGYGGIACERITKISGRTSRQWMAAYAALILGGSAIFGLLVKYRKPKIA
Ga0192917_105874213300018690MarineMGELKGEGGSDVFSSTRHVNSNANYASNDYKMKFWSNGDSPVIRPLLKTQPQRPQTEISMGVNQPQADGYGGIACKKVTKISGRTSKQWMAAYAALILGGSAVFGLLVKYKKPKIA
Ga0192944_105179513300018692MarineHGECQALFQYRLYRSEHIQYSKEENKIMKDELRGEGGSDVFSTTRHVNPNANQAEHRAGERNFWKKGKDTNYSSNEFKMKFWSNDDAPIIRPLLKTQPSSVSKEISMGVNHNQADGYGGIACKKITKISGRSQKQWMAAYAALILSGTAVFGLLVKYKKPKIA
Ga0193110_104457413300018696MarineMGNYKSTAIPLEQQKRKKAAQTTVNMKEALRGEGGSDVFSSTRHVNPNANQAEHSAGERNFWRNEEQSTQASNEFKMKFWSNDDSPLIRPLLRTEPHSMKKPEITMGVNQHHADGYGGIACERITKISGRTSRQWMAAYAALILGGSAIFGLLVKYRKPKIA
Ga0192954_103667413300018704MarineMKDELRGEGGSDVFSTTRHVNPNANQAEHSAGERNWWKKEKDTDKSRDSRANSQNLNYSSNEFKMKFWSNDDAPIIRPLLKTQPSSVSKEISMGVNHNQADGYGGIACKKITKISGRSQKQWMAAYAALILSGTAVFGLLVKYKKPKIA
Ga0192954_104200213300018704MarineMKDELRGEGGSDVFSTTRHVNPNANQAEHRAGERNFWKKGKDTNYSSNEFKMKFWSNDDAPIIRPLLKTQPSSVSKEISMGVNHNQADGYGGIACKKITKISGRSQKQWMAAYAALILSGTAVFGLLVKYKKPKIA
Ga0193539_106170013300018706MarineTFTKFQFQASSSTDCRSEHIQYCKEEYKIMKETLRGEGGSDVFSSTRHVNPNANQAEHSAGERNFWKKEKDSAKFPDSRSNYSSNDFKMKFWSNDDAPIIRPLLKTQPSSFAKEISMGVNHSQADGYGGIACKKVTKISGRSQKQWMAAYAALILSGTAIFGLLVKYKKPKIA
Ga0192876_104620813300018707MarineMKEELRGEGGSDVFSSTRHVNPNANQAEHSAGERNFWKKEKDSVKFPDSRSNYSSNDFKMKFWSNDDAPIIRPLLKTQPSSVAKEISMGVNHNQADGYGGIACKKITKISGRSQKQWMAAYAALILSGTAIFGLLVKYKKPKIA
Ga0192920_106999013300018708MarineMKEALRGEGGSDVFSSTRHVNPNANQAEHSAGERNFWRNEEQSTQTSNEFKMKFWSNDDSPLIRPLLRTEPHSMKKPEITMGVNQHHADGYGGIACERITKISGRTSRQWMAAYAALILGGSAIFGLLVKYRKPKIA
Ga0192964_107057213300018717MarineMKDELRGEGGSDVFSTTRHVNPNANQAEHSAGERNWWKKEKDTDKSRDSRANSQNLNYSSNEFKMKFWSNDDAPIIRPLLKTQPSSVAKEISMGVNHNQADGYGGIACKKITKISGRSQKQWMAAYAALILSGTAVFGLLVKYKKPKIA
Ga0192866_105812813300018720MarineMKGELRGEGGSDAFSSTRHVNPNANYSSNDYKMKFWSNDDAPIIRPLLKTQPSSVAKEISMGVNHSQADGYGGIACKKVTKISGRSQKQWMAAYAALILSGTAIFGLLVKYKKPKIA
Ga0193038_104922313300018723MarineMKEALRGEGGSDVFSSTRHVNPNANQAEHSAGERNFWRNEEQSTQASNEFKMKFWSTDDAPLIRPLLRTQPHSLKKPEITMGVNQHHADGYGGIACERITKISGRTSRQWMAAYAALILGGSAIFGLLVKYKKPKIA
Ga0193529_107641213300018731MarineMKGELKGEGGSDVFSSTRHVNPNANYSSNDFKMKFWSNDDAPIIRPLLKTQPSSVAKEISMGVNHNQADGYGGIACKKITKISGRSQKQWIAAYAALILSGTAVFGLLVKYKKPKIA
Ga0192879_112195613300018736MarineTYTTQPQYCKEEYKIMKEELRGEGGSDVFSSTRHVNPNANYSSNDFKMKFWSNDDAPIIRPLLKTQPSSVAKEISMGVNHNQADGYGGIACKKITKISGRSQKQWMAAYAALILSGTAVFGLLVKYKKPKIA
Ga0192931_108971113300018756MarineLCKGSTKKVTLTKVLRLNDTDLPYILQFNYKSTAIPLEQQKRKKAAQTTVNMKEALRGEGGSDVFSSTRHVNPNANQAEHSAGERNFWRNEEQSTQASNEFKMKFWSNDDSPLIRPLLRTEPHSMKKPEITMGVNQHHADGYGGIACERITKISGRTSRQWMAAYAALILGGSAIFGLLVKYRKPKIA
Ga0193031_106235413300018765MarineMKEELRGEGGSDVFSSTRHVNPNANYSSNDFKMKFWSNDDAPIIRPLLKTQPSSFAKEISMGVNHSQADGYGGIACKKVTKISGRSQKQWMAAYAALILSGTAIFGLLVKYKKPKIA
Ga0193530_106469313300018770MarineMKEELRGEGGSDVFSSTRHVNPNANQAEHSAGERNFWKKEKDSAKFPDSRSNYSSNDFKMKFWSNDDAPIIRPLLKTQPSSVAKEISMGVNHSQADGYGGIACKKVTKISGRSQKQWMAAYAALILSGTAIFGLLVKYKKPKIA
Ga0193314_108298813300018771MarineKSSGSGFNFNKILQIQAEHAAGERNFWKNKKDDNYSSNDFKMKFWSNDDSPLIRPLLKTTPSGATKEISMGVNYHQADGYGGIACKKVTKISGRTQKQWMLAYAGLILSGTAIFGLLVKYKKPKIA
Ga0193197_107398913300018783MarineMGSPDTKVQDQGRIMKEELRGEGGSDVFSSTRHVNPNTNYSSNDFKMKFWSNDDSPLIRPLLKTTPSGVTKEISMGVNYHQADGYGGIACKKVTKISGRTQKQWMLAYAGLILSGTAIFGLLVKYKKPKIA
Ga0192956_111997113300018792MarineMKDELRGEGGSDVFSTTRHVNPNANQAEHRAGERNFWKKGKDTNYSSNEFKMKFWSNDDAPIIRPLLKTQPSFVAKEISMGVNHNQADGYGGIACKKITKISGRSQKQWMAAYAALIFSGTAVFGLLVKYKKPKIA
Ga0192928_108702813300018793MarineTYPTILQFNYKSTAIPLEQQKRKKAAQTTVNMKEALRGEGGSDVFSSTRHVNPNANQAEHSAGERNFWRNEEQSTQASNEFKMKFWSNDDSPLIRPLLRTEPHSMKKPEITMGVNQHHADGYGGIACERITKISGRTSRQWMAAYAALILGGSAIFGLLVKYKKPKIA
Ga0192928_108893113300018793MarineMKEALRGEGGSDVFSSTRHVNPNTNQAEHSAGERNFWKNEKQSTQTSNDFKMKFWSNDDSPLIRPLLRTEPYSNPRKPQVTMGVNQHHADGYGGIACERITKISGRTSRQWMAAYAALILSGSAIFGLLVKYKKPKIA
Ga0193357_105559613300018794MarineMCKQSSALKGEGGSDIFSSTRHVNPNANYASNDFKMKFWSNGDSPVIRPLLKTQPKNVQTEISMGVNQHQPDGYGGIACKKITKISGRTSKQWLAAYAALILGGTAVFGLLVKYKKPKIA
Ga0193357_105972913300018794MarineHGSTNLYLTAISFKEKREKISSNKSDTNMKEALRGEGGSDVFSSNRHVNPNANHTSNDFKMKFWSNGDSPVIRPLLKTQPHSVQPQISMGVNQHQADGYGGIACERITKISGRTSRQWMAAYAALIFSGAAIFGVLLKYKKPKIA
Ga0193357_107321613300018794MarineMGELKGEGGSDVFSSTRHVNSNANYASNDFKMKFWSNDDSPLIRPLLKTQPQRPTTEISMGVNQPQADGYGGIACKKVTKISGRTSKQWMAAYAALILGGSAVFGLLVKYKKPKIA
Ga0193329_108597913300018804MarineTSPDTKVQDQGRIMKEELRGEGGSDVFSSTRHVNPNTNYSSNDFKMKFWSNDDSPLIRPLLKTTPSGVTKEISMGVNYHQADGYGGIACKKVTKISGRTQKQWMLAYAGLILSGTAIFGLLVKYKKPKIA
Ga0192872_108020113300018813MarineQYCKEELKIMKGELRGEGGSDAFSSTRHVNPNANQAEHSAGERNFWKKEKDSVKFPDSRSNYSSNDYKMKFWSNDDAPIIRPLLKTQPSSVAKEISMGVNHSQADGYGGIACKKVTKISGRSQKQWMAAYAALILSGTAIFGLLVKYKKPKIA
Ga0192872_108064413300018813MarineQYCKEELKIMKGELRGEGGSDAFSSTRHVNPNANQAEHSAGERNFWKKEKDSVKFPDSRSNYSSNDYKMKFWSNDDAPIIRPLLKTQPSSVAKEISMGVNHNQADGYGGIACKKITKISGRSQKQWIAAYAALILSGTAVFGLLVKYKKPKIA
Ga0193042_110943213300018845MarineMKGELRGEGGSDAFSSTRHVNPNANQAEHSAGERNFWKKEKDSVKFPDSRSNYSSNDYKMKFWSNDDAPIIRPLLKTQPSSFAKEISMGVNHSQADGYGGIACKKVTKISGRSQKQWMAAYAALILSGTAIFGLLVKYKKPKIA
Ga0193042_112532713300018845MarineMKGELRGEGGSDAFSSTRHVNPNANYSSNDYKMKFWSNDDAPIIRPLLKTQPSSFAKEISMGVNHSQADGYGGIACKKVTKISGRSQKQWMAAYAALILSGTAIFGLLVKYKKPKIA
Ga0192970_106747413300018848MarineMKDELRGEGGSDVFSTTRHVNPNANQAEHRAGERNFWKKEKDTNYSSNEFKMKFWSNDDAPIIRPLLKTQPSSVSKEISMGVNHNQADGYGGIACKKITKISGRSQKQWMAAYAALILSGTAVFGLLVKYKKPKIA
Ga0193214_109105413300018854MarineMKEELRGEGGSDVFSSTRHVNPNTNYSSNDFKMKFWSNDDSPLIRPLLKTTPSGVTKEISMGVNYHQADGYGGIACKKVTKISGRTQKQWMLAYAGLILSGTAIFGLLVKYKKPKIA
Ga0193120_112587213300018856MarineMKEALRGEGGSDVFSSTRHVNPNANQAEHSAGERNFWRNEEKSTQASNEFKMKFWSNDDSPLIRPLLRTEPHSMKKPEITMGVNQHHADGYGGIACERITKISGRTSRQWMAAYAALILGGSAIFGLLVKYRKPKIA
Ga0192965_115026313300018896MarineMKDELRGEGGSDVFSTTRHVNPNANQAEHRAGERNFWKKGKDTNYSSNEFKMKFWSNDDAPIIRPLLKTQPSSVAKEISMGVNHNQADGYGGIACKKITKISGRSQKQWMAAYAALILSGTAVFGLLVKYKKPKIA
Ga0193203_1027184013300018901MarineTWDTILRLNEIDLPYNSSITILPRYLLNNKKETKINMKEALRGEGGSDVFSSTRHVNPNATQASNEFKMKFWSTDDAPLIRPLLRTQPHSLKKPEITMGVNQHHADGYGGIACERITKISGRTSRQWMAAYAALILGGSAIFGLLVKYKKPKIA
Ga0193244_102775313300018903MarineDCRSEHIQYCKEELKIMKGELRGEGGSDAFSSTRHVNPNANQAEHSAGERNFWKKEKDSVKFPDSRSNYSSNDYKMKFWSNDDAPIIRPLLKTQPSSVAKEISMGVNHNQADGYGGIACKKITKISGRSQKQWIAAYAALILSGTAVFGLLVKYKKPKIA
Ga0193244_103017923300018903MarineEISVFYVYEISVFKLCPSEHILYCKENYKIMKEELRGEGGSDVFSSTRHVNPNANYSSNDFKMKFWSNDDAPIIRPLLKTQPSSVAKEISMGVNHNQADGYGGIACKKITKISGRSQKQWIAAYAALILSGTAVFGLLVKYKKPKIA
Ga0193244_110344013300018903MarineDCRSEHIQYCKEELKIMKGELRGEGGSDAFSSTRHVNPNANYSSNDYKMKFWSNDDAPIIRPLLKTQPSSFAKEISMGVNHSQADGYGGIACQKVTKISGRSQKQWMAAYAALILSGTAIFGLLVKYKKPKIA
Ga0193176_1023584013300018912MarineLNNKKEKTAQTQRNMKEALRGEGGSDVFSSTRHVNPNATQASNEFKMKFWSNDDSPLIRPLLKTQPHSLKKPEITMGVNQHHADGYGGIACERITKISGRTSRQWMAAYAALILSGSAIFGLLVKYKKPKIA
Ga0192852_1020897823300018952MarineMNMKEALRGEGGSDVFSSTRHVNPNTNQAEHSAGERNFWRSEEQSTQASNEFKMKFWSNDDSPLIRPLLRTQPHSLKKPEITMGVNQHHADGYGGIACERITKISGRTSRQWMAAYAALILSGSAIFGLLVKYRKPKIA
Ga0193528_1006464313300018957MarineMKGELKGEGGSDVFSSTRHVNPNANQAEHSAGERNFWKKEKDSVKFPDSRSNYSSNDFKMKFWSNDDAPIIRPLLKTQPSSVAKEISMGVNHNQADGYGGIACKKITKISGRSQKQWIAAYAALILSGTAVFGLLVKYKKPKIA
Ga0193531_1022399513300018961MarineMKEELRGEGGSDVFSSTRHVNPNANQAEHSAGERNFWKKEKDSVKFPDSRSNYSSNDFKMKFWSNDDAPIIRPLLKTQPSSFAKEISMGVNHSQADGYGGIACKKVTKISGRSQKQWMAAYAALILSGTAIFGLLVKYKKPKIA
Ga0193562_1011155113300018965MarineMKEALRGEGGSDVFSSTRHVNPNTNQAEHSAGERNFWKNEKQSTQTSNDFKMKFWSNDDSPLIRPLLRTEPYSNPRKPQVTMGVNQHHADGYGGIACERITKISGRTSRQWMAAYAALMFSGAAIFGLLLKYKKPKIE
Ga0193562_1014868613300018965MarineMKEDTLRGEGGSDVFSSTRHVNPNANRAEHSAGERNFWRNEKQSTQASNDFKMKFWSNDDSPIIRPLLKTQPHSNTFKPEISMGVNHDQADGYGGIACKKITKISGRTSRQWMGAYAALILSGSAIFGLLVKYKKPKIA
Ga0193562_1016804113300018965MarineTWATKKVTLTKVLRLNDTDLPYILQFNYKSTAIPLEQQKRKKSALTTINMKEALRGEGGSDVFSSTRHVNPNANQAEHSAGERNFWRNEEQSTQASNEFKMKFWSNDDSPLIRPLLRTEPHSMKKPEITMGVNQHHADGYGGIACERITKISGRTSRQWMAAYAALILGGSAIFGLLVKYRKPKIA
Ga0193293_1006545413300018966MarineDSKAELRYSGTYFIDKKMCKQSSALKGEGGSDIFSSTRHVNPNANYASNDFKMKFWSNGDSPVIRPLLKTQPKNVQTEISMGVNQHQPDGYGGIACKKITKISGRTSKQWLAAYAALILSGTAVFGLLVKYKKPKIA
Ga0193143_1021900313300018969MarineHGSTDCRSEHIQYCKEENKIMKDELRGEGGSDAFSSTRHVNPNANYSSNDFKMKFWSTDDAPIIRPLLKTQPSSLAKEISMGVNHNQADGYGGIACKKITKISGRSQKQWMAAYAALILSGTAIFGLLVKYKKPKIA
Ga0193326_1004333813300018972MarineMKEELRGEGGSDVFSSTRHVNPNTFKKTSGSGFNFNKILQIQAEHAAGERNFWKNKKDDNYSSNDFKMKFWSNDDSPLIRPLLKTTPSGVTKEISMGVNYHQADGYGGIACKKVTKISGRTQKQWMLAYAGLILSGTAIFGLLVKYKKPKIA
Ga0192873_1014236113300018974MarineMKEELRGEGGSDVFSSTRHVNPNANYSSNDFKMKFWSNDDAPIIRPLLKTQPSSVAKEISMGVNHNQADGYGGIACKKITKISGRSQKQWIAAYAALILSGTAVFGLLVKYKKPKIA
Ga0192873_1043441413300018974MarineMKEDTLRGEGGSDVFSSTRHVNPNATQASNDFKMKFWSNDDSPIIRPLLKTQPHSNTFKPEISMGVNHDQADGYGGIACKKITKISGRTSRQWMGAYAALILSGSAIFGLLVKYKKPKIA
Ga0193487_1018043113300018978MarineMKEELRGEGGSDVFSSTRHVNPNTIQAEHAAGERNFWKNKKDDNYSSNDFKMKFWSNDDSPLIRPLLKTTPSGATKEISMGVNYHQADGYGGIACKKVTKISGRTQKQWMLAYAGLILSGTAIFGLLVKYKKPKIA
Ga0193487_1028291713300018978MarineTKRNRFTIQQFNYKSTAIPLELQKGKKSAQTKINMKEALRGEGGSDVFSSTRHVNPNANQAEHSAGERNFWRNEEQSTQASNEFKMKFWSNDDSPLIRPLLRTEPHSMKKPEITMGVNQHHADGYGGIACERITKISGRTSRQWMAAYAALILGGSAIFGLLVKYRKPK
Ga0192961_1016308513300018980MarineMKEEQLRGEGGSDAFSSTRHVNPNANQAEHSAGERNFWKKEKDSVKFPDSRSNYSSNDYKMKFWSNDDAPIIRPLLKTQPSSVAKEISMGVNHNQADGYGGIACKKVTKISGRSQKQWMAAYAALILSGTAIFGLLVKYKKPKIA
Ga0192968_1011349123300018981MarineMKDELRGEGGSDVFSTTRHVNPNANQAEHRAGERNFWKKEKDTNYSSNEFKMKFWSNDDAPIIRPLLKTQPSFVAKEISMGVNHNQADGYGGIACKKITKISGRSQKQWMAAYAALILSGTAVFGLLVKYKKPKIA
Ga0192947_1020268613300018982MarineMKEDTLRGEGGSDVFSSTRHVNPNANQAEHSAGERNFWRNEKQNTQASNDFKMKFWSNDDSPMIRPLLKTQPHSNSTSFSFKPEISMGVNHDQADGYGGIACKKITKISGRTSRQWMGAYAALILSGSAIFGLLVKYKKPKIA
Ga0193136_1011864013300018985MarineMKEALRGEGGSDVFSSNRHVNPNANHASNDYKMKFWSDTDSPVIRPLLKTQPHSVKPQISMGVNQHQADGYGGIACERITKISGRTSRQWMLAYGALILSGSAIFGLLLKYKKPKIE
Ga0193554_1027294513300018986MarineMKEALRGEGGSDVFSSTRHVNPNANQAEHSAGERNFWRNEGQSTQASNEFKMKFWSNDDSPLIRPLLRTEPHSMKKPEITMGVNQHHADGYGGIACERITKISGRTSRQWMAAYAALILGGSAIFGLLVKYRKPKIA
Ga0193554_1035952013300018986MarineEGGSDVFSSNRHVNPNANHTSNDFKMKFWSNGDSPVIRPLLKTQPHSVQPQISMGVNQHQADGYGGIACERITKISGRTSRQWMAAYAALMFSGAAIFGLLLKYKKPKIE
Ga0193554_1038562113300018986MarineEGGSDVFSSNRHVNPNANHTSNDFKMKFWSNGDSPVIRPLLKTQPHSVQPQISMGVNQHQADGYGGIACERITKISGRTSRQWMAAYAALIFSGAAIFGVLLKYKKPKIA
Ga0193030_1017905613300018989MarineMGEIYVSNFCERRSTFTKFQFQASSSTDCRSEHIQYCKEEYKIMKETLRGEGGSDVFSSTRHVNPNANQAEHSAGERNFWKKEKDSAKFPDSRSNYSSNDFKMKFWSNDDAPIIRPLLKTQPSSFAKEISMGVNHSQADGYGGIACKKVTKISGRSQKQWMAAYAALILSGTAIFGLLVKYKKPKIA
Ga0193030_1022751313300018989MarineMGEIYVSNFCERRSTFTKFQFQASSSTDCRSEHIQYCKEEYKIMKETLRGEGGSDVFSSTRHVNPNANYSSNDFKMKFWSNDDAPIIRPLLKTQPSSVAKEISMGVNHSQADGYGGIACKKVTKISGRSQKQWMAAYAALILSGTAIFGLLVKYKKPKIA
Ga0193280_1034943913300018994MarineMKEALRGEGGSDVFSSTRHVNPNTNQAEHSAGERNFWKSEKQKTQTSYDFKMKFWSNDDSPLIRPLLRTEPYSNPRKPQVTMGVNQHHADGYGGIACERITKISGRTSRQWMAAYAALILSGSAIFGLLVKYKKP
Ga0192916_1019278913300018996MarineMKEALRGEGGSDVFSSTRHVNPNTNQAEHSAGERNFWKNEKQSTQTSNDYKMKFWSNDDSPLIRPLLRTEPYSNPRKPQVTMGVNQHHADGYGGIACERITKISGRTSRQWMAAYAALMFSGAAIFGLLLKYKKPKIE
Ga0193444_1011742813300018998MarineMNMKEALRGEGGSDVFSSTRHVNPNANQAEHSAGERNFWRNEEQSTQASNDFKMKFWSNDDSPLIRPLLRTQPHSLKKPEITMGVNQHHADGYGGIACERITKISGRTSRQWMAAYAALILSGSAIFGLLVKYRKPKIA
Ga0192953_1004735513300019000MarineMKDELRGEGGSDVFSTTRHVNPNANYSSNEFKMKFWSNDDAPIIRPLLKTQPSSVSKEISMGVNHNQADGYGGIACKKITKISGRSQKQWMAAYAALILSGTAVFGLLVKYKKPKIA
Ga0193078_1021989113300019004MarineLPYNSTITILPRYLLNNKKETKINMKEALRGEGGSDVFSSTRHVNPNATQASNEFKMKFWSTDDAPLIRPLLRTQPHSLKKPEITMGVNQHHADGYGGIACERITKISGRTSRQWMAAYAALILGGSAIFGLLVKYRKPKIA
Ga0193154_1022040213300019006MarineMKEALRGEGGSDVFSSTRHVNPNANQAEHSAGERNFWRNEEKSTQASNEFKMKFWSNDDSPLIRPLLRTEPHSMKKPEITMGVNQHHADGYGGIACERITKISGRTSRQWMAAYAALILGGSAIFGLLVKYKKPKIA
Ga0193154_1025390313300019006MarineMKEALRGEGGSDVFSSNRHVNPNANETSNDFKMKFWSNGDSPVIRPLLKTQPHSVQPQISMGVNQHQADGYGGIACERITKISGRTSRQWMAAYAALMFSGAAIFGLLLKYKKPKIE
Ga0193196_1029798513300019007MarineRIMKEELRGEGGSDVFSSTRHVNPNTFKKSSGSGFNFNKILQIQAEHAAGERNFWKNKKDDNYSSNDFKMKFWSNDDSPLIRPLLKTTPSGATKEISMGVNYHQADGYGGIACKKVTKISGRTQKQWMLAYAGLILSGTAIFGLLVKYKKPKIA
Ga0193196_1038740013300019007MarineRIMKEELRGEGGSDVFSSTRHVNPNTNYSSNDFKMKFWSNDDSPLIRPLLKTTPSGVTKEISMGVNYHQADGYGGIACKKVTKISGRTQKQWMLAYAGLILSGTAIFGLLVKYKKPKIA
Ga0193196_1040252813300019007MarineTWGHNSTTKRNRFTIQQFNYKSTAIPLEQQKRKKSAQTKINMKEALRGEGGSDVFSSTRHVNPNANQAEHSAGERNFWRNEEQSTQASNEFKMKFWSNDDSPLIRPLLRTEPHSMKKPEITMGVNQHHADGYGGIACERITKISGRTSRQWMAAYAALILGGSAIFGLLVKYRKPKIA
Ga0193196_1043312313300019007MarineMKEALRGEGGSDVFSSTRHVNPNTTQASNEFKMKFWSNDDSPLIRPLLRTEPHSMKKPEITMGVNQHHADGYGGIACERITKISGRTSRQWMAAYAALILGGSAIFGLLVKYRKPKIA
Ga0193361_1029005623300019008MarineMKEALRGEGGSDVFSSTRHVNPNANQAEHSAGERNFWRNEEQSTQASNEFKMKFWSNDDSPLIRPLLRTEPHSMKKPEITMGVNQHHADGYGGIACERITKISGRTSRQWMAAYAALILGGSAIFGLLVKYRKPKI
Ga0193361_1033473113300019008MarineKRNRFTIQQFNYKSIAIPLELQKGKKSAQTKINMKEALRGEGGSDVFSSTRHVNPNANQAEHSAGERNFWRNEEQSTQASNEFKMKFWSNDDSPLIRPLLRTEPHSMKKPEITMGVNQHHADGYGGIACERITKISGRTSRQWMAAYAALILGGSAIFGLLVKYRKPKI
Ga0193044_1015722313300019010MarineMKGELRGEGGSDAFSSTRHVNPNANQAEHSAGERNFWKKEKDSVKFPDSRSNYSSNDYKMKFWSNDDAPIIRPLLKTQPSSVAKEISMGVNHSQADGYGGIACKKVTKISGRSQKQWMAAYAALILSGTAIFGLLVKYKKPKIA
Ga0192926_1033991213300019011MarineMKEALRGEGGSDVFSSTRHVNPNTTWSTHNDLRFQDSRAKVSYPQTQTSNDFKMKFWSNDDSPLIRPLLRTEPYSNPRKPQVTMGVNQHHADGYGGIACERITKISGRTSRQWMAAYAALILSGSAIFGLLVKYKKPKIA
Ga0192926_1034080913300019011MarineMGELKGEGGSDVFSSTRHVNSNANYASNDYKMKFWSNGDSPVIRPLLKTQPQRPQTEISMGVNQPQADGYGGIACKKVTKISGRTSKQWMAAYAALIIGGSAVFGLLVKYKKPKIA
Ga0193043_1018884413300019012MarineMKEEQLRGEGGSDAFSSTRHVNPNANQAEHSAGERNFWKKEKDSVKFPDSRSNYSSNDYKMKFWSNDDAPIIRPLLKTQPSSVAKEISMGVNHSQADGYGGIACKKVTKISGRSQKQWMAAYAALILSGTAIFGLLVKYKKPKIA
Ga0193043_1018884513300019012MarineMKEEQLRGEGGSDAFSSTRHVNPNANQAEHSAGERNFWKKEKDSVKFPDSRSNYSSNDYKMKFWSNDDAPIIRPLLKTQPSSFAKEISMGVNHSQADGYGGIACKKVTKISGRSQKQWMAAYAALILSGTAIFGLLVKYKKPKIA
Ga0193043_1021627613300019012MarineMKEEQLRGEGGSDAFSSTRHVNPNANYSSNDYKMKFWSNDDAPIIRPLLKTQPSSFAKEISMGVNHSQADGYGGIACKKVTKISGRSQKQWMAAYAALILSGTAIFGLLVKYKKPKIA
Ga0193525_1033766413300019015MarineMKEALRGEGGSDVFSSTRHVNPNTNQAEHSAGERNFWKNEKQSTWSTHNDLRFQDSRAKVSYPQTQTSNDFKMKFWSNDDSPLIRPLLRTEPYSNPRKPQVTMGVNQHHADGYGGIACERITKISGRTSRQWMAAYAALILSGSAIFGLLVKYKKPKIA
Ga0193569_1024162713300019017MarineNFSFKPRPVQTADLNIYNFCERRSTFTKFQFQASSSTDCRSEHIQYCKEEYKIMKETLRGEGGSDVFSSTRHVNPNANQAEHSAGERNFWKKEKDSAKFPDSRSNYSSNDFKMKFWSNDDAPIIRPLLKTQPSSFAKEISMGVNHSQADGYGGIACKKVTKISGRSQKQWMAAYAALILSGTAIFGLLVKYKKPKIA
Ga0193569_1028157013300019017MarineNFSFKPRPVQTADLNIYNFCERRSTFTKFQFQASSSTDCRSEHIQYCKEEYKIMKETLRGEGGSDVFSSTRHVNPNANYSSNDFKMKFWSNDDAPIIRPLLKTQPSSFAKEISMGVNHSQADGYGGIACKKVTKISGRSQKQWMAAYAALILSGTAIFGLLVKYKKPKIA
Ga0193569_1028157113300019017MarineNFSFKPRPVQTADLNIYNFCERRSTFTKFQFQASSSTDCRSEHIQYCKEEYKIMKETLRGEGGSDVFSSTRHVNPNANYSSNDFKMKFWSNDDAPIIRPLLKTQPSSVAKEISMGVNHSQADGYGGIACKKVTKISGRSQKQWMAAYAALILSGTAIFGLLVKYKKPKIA
Ga0193555_1006168013300019019MarineMKEELRGEGGSDVFSSTRHVNPNTFKKSSGSGFNFNKILQIQAEHAAGERNFWKNKKDDNYSSNDFKMKFWSNDDSPLIRPLLKTTPSGVTKEISMGVNYHQADGYGGIACKKVTKISGRTQKQWMLAYAGLILSGTAIFGLLVKYKKPKIA
Ga0193555_1009578213300019019MarineGEGGSDVFSSTRHVNPNTNYSSNDFKMKFWSNDDSPLIRPLLKTTPSGVTKEISMGVNYHQADGYGGIACKKVTKISGRTQKQWMLAYAGLILSGTAIFGLLVKYKKPKIA
Ga0193538_1020193123300019020MarineMKEELRGEGGSDVFSSTRHVNPNANQAEHSAGERNFWKKEKDSAKFPDSRSNYSSNDFKMKFWSNDDAPIIRPLLKTQPSSFAKEISMGVNHSQADGYGGIACKKVTKISGRSQKQWMAAYAALILSGTAIFGLLVKYKKPKIA
Ga0192951_1027959513300019022MarineHGDRLYRSEHIQYSKEENKIMKDELRGEGGSDVFSTTRHVNPNANQAEHSAGERNWWKKEKDTDKSRDSRANSQNLNYSSNEFKMKFWSNDDAPIIRPLLKTQPSSVSKEISMGVNHNQADGYGGIACKKITKISGRSQKQWMAAYAALILSGTAVFGLLVKYKKPKIA
Ga0192951_1031774313300019022MarineHGDRLYRSEHIQYSKEENKIMKDELRGEGGSDVFSTTRHVNPNANQAEHRAGERNFWKKGKDTNYSSNEFKMKFWSNDDAPIIRPLLKTQPSSVAKEISMGVNHNQADGYGGIACKKITKISGRSQKQWMAAYAALILSGTAVFGLLVKYKKPKIA
Ga0193535_1021818513300019024MarineKFQFQASSSTDCRSEHIQYCKEEYKIMKETLRGEGGSDVFSSTRHVNPNANQAEHSAGERNFWKKEKDSAKFPDSRSNYSSNDFKMKFWSNDDAPIIRPLLKTQPSSFAKEISMGVNHSQADGYGGIACKKVTKISGRSQKQWMAAYAALILSGTAIFGLLVKYKKPKIA
Ga0192945_1022339213300019036MarineMKEDTLRGEGGSDVFSSTRHVNPNANQAEHSAGERNFWRNEKQNTQASNDFKMKFWSNDDSPMIRPLLKTQPHSNTFKPEISMGVNHDQADGYGGIACKKITKISGRTSRQWMGAYAALILSGSAIFGLLVKYKKPKIA
Ga0193558_1037195513300019038MarineMKEALRGEGGSDVFSSTRHVNPNANQAEHSAGERNFWRTEEQSTQASNEFKMKFWSNDDSPLIRPLLRTEPHSMKKPEITMGVNQHHADGYGGIACERITKISGRTSRQWMAAYAALILGGSAIFGLLVKYKKPKIA
Ga0192857_1025105313300019040MarineNHEGRTKRRSGSDVFSSTRHVNPNTNYSSNDFKMKFWSNDDSPLIRPLLKTTPSGVTKEISMGVNYHQADGYGGIACKKVTKISGRTQKQWMLAYAGLILSGTAIFGLLVKYKKPKIA
Ga0193356_1018236213300019053MarineMCKQSSALKGEGGSDIFSSTRHVNPNANYASNDFKMKFWSNGDSPVIRPLLKTQPKNAQTEISMGVNQHQPDGYGGIACKKITKISGRTSKQWLAAYAALILGGTAVFGLLVKYKKPKIA
Ga0193356_1029315613300019053MarineMKEALRGEGGSDVFSSTRHVNPNATQASNDFKMKFWSNDDSPIIRPLLKTQPHSNTFKPEISMGVNHDQADGYGGIACKKITKISGRTSRQWMGAYAALILSGSAIFGLLVKYKKPKIA
Ga0193208_1044979723300019055MarineMKEALRGEGGSDVFSSNRHVNPNTNQASNDFKMKFWSNDDSPLIRPLLKTQPHSVQPQISMGVNQHHADGYGGIACERITKISGRTSRQWMAAYGALILSGSAIFGLLLKYKKPKIE
Ga0193208_1062191613300019055MarineTWEYQVQTSTSPDTKVQDQGKIMKEELRGEGGSDVFSSTRHVNPNTNYSSNDFKMKFWSNDDSPLIRPLLKTTPSGVTKEISMGVNYHQADGYGGIACKKVTKISGRTQKQWMLAYAGLILSGTAIFGLLVKYKKPKIA
Ga0193208_1065676113300019055MarineLWLRFPDTKVQDQGRIMKEELRGEGGSDVFSSTRHVNPNTNYSSNDFKMKFWSNDDSPLIRPLLKTTPSGVTKEISMGVNYHQADGYGGIACKKVTKISGRTQKQWMLAYAGLILSGTAIFGLLVKYKKPKIA
Ga0193208_1066681013300019055MarineHGSPDTNFQDHGIIMKEELRGEGGSDVFSSTRHVNPNTNYSSNDFKMKFWSNDDSPLIRPLLKTTPSGVTKEISMGVNYHQADGYGGIACKKVTKISGRTQKQWMLAYAGLILSGTAIFGLLVKYKKPKIA
Ga0193208_1072859213300019055MarineMGSPDANFQDHGRIMKEELRGEGGSDVFSSTRHVNPNTIQAEHAAGERNFWKNKKDDNYSSNDFKMKFWSNDDSPLIRPLLKTTPSGVTKEISMGVNYHQADGYGGIACKKVTKISGRTQKQWMLAYAGLILSGTAIFGLLVKYKKPKIA
Ga0193045_104497013300019100MarineMKETLRGEGGSDAFSSTRHVNPNANQAEHSAGERNFWKKEKDSVKFPDSRSNYSSNDYKMKFWSNDDAPIIRPLLKTQPSSVAKEISMGVNHSQADGYGGIACKKVTKISGRSQKQWMAAYAALILSGTAIFGLLVKYKKPKIA
Ga0193045_105397123300019100MarineMKETLRGEGGSDAFSSTRHVNPNANYSSNDYKMKFWSNDDAPIIRPLLKTQPSSFAKEISMGVNHSQADGYGGIACKKVTKISGRSQKQWMAAYAALILSGTAIFGLLVKYKKPKIA
Ga0192946_104261113300019103MarineMKDELRGEGGSDVFSTTRHVNPNANQAEHSAGERNWWKKEKDTDKSRDSRANSQNLNYSSNEFKMKFWSNDDAPIIRPLLKTQPSSVAKEISMGVNHNQADGYGGIACKKITKISGRSQKQWMAAYAALIFSGTAVFGLLVKYKKPKIA
Ga0193541_103085413300019111MarineMKETLRGEGGSDVFSSTRHVNPNANQAEHSAGERNFWKKEKDSVKFPDSRSNYSSNDFKMKFWSNDDAPIIRPLLKTQPSSFAKEISMGVNHSQADGYGGIACKKVTKISGRSQKQWMAAYAALILSGTAIFGLLVKYKKPKIA
Ga0192885_105105113300019119MarineLYCKENYKIMKEELRGEGGSDVFSSTRHVNPNANYSSNDFKMKFWSNDDAPIIRPLLKTQPSSVAKEISMGVNHNQADGYGGIACKKITKISGRSQKQWIAAYAALILSGTAVFGLLVKYKKPKIA
Ga0193249_114473413300019131MarineDELRGEGGSDVFSTTRHVNPNANQAEHSAGERNWWKKEKDTDKSRDSRANSQNLNYSSNEFKMKFWSNDDAPIIRPLLKTQPSSVAKEISMGVNHSQADGYGGIACKKVTKISGRSQKQWMAAYAALILSGTAIFGLLVKYKKPKIA
Ga0193453_116238213300019147MarineMKIVTLTKYNSSTTKSSRFSILQFIYKSTAIPLEQQKRKKSAQTKINMKEALRGEGGSDVFSSTRHVNPNATQASNEFKMKFWSNDDSPLIRPLLRTEPHSMKKPEITMGVNQHHADGYGGIACERITKISGRTSRQWMAAYAALILCGSAIFGLLVKYRKPKIA
Ga0193453_116401013300019147MarineMKEALRGEGGSDVFSSTRHVNPNTTQASNEFKMKFWSNDDSPLIRPLLRTEPHSMKKPEITMGVNQHHADGYGGIACERITKISGRTSRQWMAAYAALILCGSAIFGLLVKYRKPKIA
Ga0193453_116612213300019147MarineMKEALRGEGGSDVFSSTRHVNPNSNQAEHSAGERNFWRNEEQSTQASNEFKMKFWSNDDSPLIRPLLRTQPHSLKKPEITMGVNQHHADGYGGIACERITKISGRTSRQWMAAYAALILCGSAIFGLLVKYRKPKIA
Ga0192888_1025337113300019151MarineMKEDTLRGEGGSDVFSSTRHVNPNANRAEHSAGERNFWRNEKQSTQASNDFKMKFWSNDDSPIIRPLLKTQPHSNTFKPEISMGVNHDQADGYGGIACKKITKISGRTSRQWMAAYAALILSGSAIFGLLVKYKKP
Ga0307392_103065413300031550MarineMKDELRGEGGSDVFSTTRHVNPNANQAEHSAGERNWWKKEKDTDKSRDSRANSQNLNYSSNEFKMKFWSNDDAPIIRPLLKTQPSSVSKEISMGVNHNQADGYGGIACKKITKISGRSQKQWMAAYAALILSGTAVFGLLVKYKKPKIV
Ga0307396_1051413813300031717MarineMRGEGGSDVFSSNRHVNPNANQTSSYDFKMKFWSNDDSPLIRPLLKSQPQSVQPQISMGVNLHQADGYGGIACKKITKISGRTSRQWMAAYGALILSGTAVFGLLLKYKKPKIA
Ga0307391_1079162313300031729MarineMKEDQLRGEGGSDVFSSTRHVNPNANNSSNEFKMKFWSNDDSPIIRPLLKTQPSSISKEISMGVNHNQADGYGGIACKKITKISGRSQKQWMAAYAALILSGTAVFGLLVKYKKPKIV
Ga0307397_1047014223300031734MarineMKDAMRGEGGSDVFSSNRHVNPNANQTSSYDFKMKFWSNDDSPLIRPLLKSQPQSVQPQISMGVNLHQADGYGGIACKKITKISGRTSRQWMAAYGALILSGSAVFGLLLKYKKPKIA
Ga0307394_1029108313300031735MarineMKDELRGEGGSDVFSTTRHVNPNANQAEHRAGERNFWKKGKDTNYSSNEFKMKFWSNDDAPIIRPLLKTQPSFVAKEISMGVNHNQADGYGGIACKKITKISGRSQKQWMAAYAALILSGTAVFGLLVKYKKPKIA
Ga0307387_1074362813300031737MarineMKDELRGEGGSDVFSTTRHVNPNANQAEHSAGERNWWKKEKDTDKSRDSRANSQNLNYSSNEFKMKFWSNDDAPIIRPLLKTQPSFVAKEISMGVNHNQADGYGGIACKKITKISGRSQKQWMAAYAALILSGTAVFGLLVKYKKP
Ga0307383_1053679513300031739MarineMKDELRGEGGSDVFSTTRHVNPNANQAEHRAGERNFWRKGKDTNYSSNEFKMKFWSNDDAPIIRPLLKTQPSSVSKEISMGVNHNQADGYGGIACKKITKISGRSQKQWMAAYAALIFSGAAVFGLLVKYK
Ga0314676_1082103513300032519SeawaterSTDCRSEHIQYCKEEYKIMKEELRGEGGSDVFSSTRHVNPNTNQAEHSAGERNFWKKEKDSVKFPDSRSNYSSNDFKMKFWSNDDAPIIRPLLKTQPSSVAKEISMGVNHSQADGYGGIACKKVTKISGRSQKQWMAAYAALILSGTAIFGLLVKYKKPKIA
Ga0314685_1068642513300032651SeawaterCRSEHIQYCKEENKIMKDELRGEGGSDAFSSTRHVNPNANQAEHSAGERNFWKKEKDSVKFPDSRSNYSSNDFKMKFWSTDDAPIIRPLLKTQPSSLAKEISMGVNHNQADGYGGIACKKITKISGRSQKQWMAAYAALILSGTAIFGLLVKYKKPKIA
Ga0314678_1057427313300032666SeawaterKIMKDELRGEGGSDAFSSTRHVNPNANQAEHSAGERNFWKKEKDSVKFPDSRSNYSSNDFKMKFWSTDDAPIIRPLLKTQPSSLAKEISMGVNHNQADGYGGIACKKITKISGRSQKQWMAAYAALILSGTAIFGLLVKYKKPKIA
Ga0314686_1053184313300032714SeawaterIYVSNFCERRSTFTKFQFQASSSTDCRSEHIQYCKEENKIMKDELRGEGGSDAFSSTRHVNPNANQAEHSAGERNFWKKEKDSVKFPDSRSNYSSNDFKMKFWSTDDAPIIRPLLKTQPSSLAKEISMGVNHNQADGYGGIACKKITKISGRSQKQWMAAYAALILSGTAIFGLLVKYKKPKIA
Ga0314714_1081584413300032733SeawaterIYVSNFCERRSTFTKFQFQASSSTDCRSEHIQYCKEENKIMKDELRGEGGSDVFSSTRHVNPNANYSSNDFKMKFWSTDDAPIIRPLLKTQPSSLAKEISMGVNHNQADGYGGIACKKITKISGRSQKQWMAAYAALILSGTAIFGLLVKYKKPKIA
Ga0307390_1087112013300033572MarineMKEDQLRGEGGSDVFSSTRHVNPNANNSSNEFKMKFWSNDDAPIIRPLLKTQPSSVATEISMGVNHNQADGYGGIACKKITKISGRSQKQWMAAYAALILSGTAVFGLLVKYKKPKIA
Ga0307390_1104624613300033572MarineMKDELRGEGGSDVFSTTRHVNPNANQAEHSAGERNFWKTKKDTNYSSNEFKMKFWSNDDAPIIRPLLKTQPSFVAKEISMGVNHNQADGYGGIACKKITKISGRSQKQWMAAYAALILSGTAVFGLLVKYKKPKIA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.