Metagenome Family F056209

Overview

Basic Information

• Family ID: F056209
• Family Type: Metagenome
• Number of Sequences: 137
• Average Sequence Length: 42 residues
• Representative Sequence: SACSLVGFWAGLGWLVLVCCERKTLLAGWFGLAETNKRTG
• Number of Associated Samples: 55
• Number of Associated Scaffolds: 137

Quality Assessment

• Transcriptomic Evidence: No
• Most common taxonomic group: Unclassified
• % of genes with valid RBS motifs: 11.67 %
• % of genes near scaffold ends (potentially truncated): 56.20 %
• % of genes from short scaffolds (< 2000 bps): 86.86 %
• Associated GOLD sequencing projects: 55
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.47

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Unclassified (78.102 % of family members)
• NCBI Taxonomy ID: N/A
• Taxonomy: N/A

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (99.270 % of family members)
• Environment Ontology (ENVO): Unclassified (99.270 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant surface (99.270 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: Yes
• Secondary Structure distribution:
  α-helix: 55.88%
  β-sheet: 0.00%
  Coil/Unstructured: 44.12%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 137 Family Scaffolds
PF02535	Zip	0.73
PF00036	EF-hand_1	0.73
PF00809	Pterin_bind	0.73

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 137 Family Scaffolds
COG0428	Zinc transporter ZupT	Inorganic ion transport and metabolism [P]	0.73

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.10 %
All Organisms	root	All Organisms	21.90 %

Level 2

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.10 %
cellular organisms	root	All Organisms → cellular organisms	21.90 %

Level 3

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.10 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	21.90 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.10 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	21.90 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.10 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	21.90 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.10 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	21.90 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.10 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	21.90 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.10 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	19.71 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.10 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	19.71 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.10 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	19.71 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.10 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	19.71 %

Level 12

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.10 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	19.71 %

Level 13

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.10 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	19.71 %

Level 14

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.10 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	19.71 %

Level 15

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.10 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	19.71 %

Level 16

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.10 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	19.71 %

Level 17

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.10 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	19.71 %

Level 18

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.10 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	10.95 %
BOP clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade	0.73 %

Level 19

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.10 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	8.03 %
Arundinoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae	2.92 %
Oryzoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae	0.73 %

Level 20

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.10 %
Andropogonodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae	6.57 %
Arundineae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae	2.92 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	0.73 %
Oryzeae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae	0.73 %

Level 21

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.10 %
Andropogoneae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	6.57 %
Arundo	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo	2.92 %
Oryzinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae	0.73 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	0.73 %

Level 22

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.10 %
Tripsacinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae	3.65 %
Arundo donax	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	2.92 %
Saccharinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae	2.92 %
Oryza	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	0.73 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	0.73 %

Level 23

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.10 %
Zea	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea	3.65 %
Miscanthus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus	2.92 %
Arundo donax	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	2.92 %
Oryza	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	0.73 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	0.73 %

Level 24

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.10 %
Zea mays	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays	3.65 %
Miscanthus lutarioriparius	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	2.92 %
Arundo donax	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	2.92 %
Oryza	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	0.73 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	0.73 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300005459|Ga0068867_101136120	Not Available	715
3300015267|Ga0182122_1050967	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	556
3300015268|Ga0182154_1064985	Not Available	522
3300015269|Ga0182113_1035920	Not Available	678
3300015274|Ga0182188_1060744	Not Available	506
3300015275|Ga0182172_1031933	Not Available	647
3300015281|Ga0182160_1049982	Not Available	586
3300015282|Ga0182124_1081679	Not Available	504
3300015289|Ga0182138_1062030	Not Available	561
3300015291|Ga0182125_1030552	Not Available	699
3300015292|Ga0182141_1013810	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	866
3300015292|Ga0182141_1025188	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	737
3300015294|Ga0182126_1018245	Not Available	811
3300015298|Ga0182106_1077055	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	550
3300015300|Ga0182108_1067374	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	580
3300015302|Ga0182143_1003035	Not Available	1350
3300015303|Ga0182123_1020401	Not Available	784
3300015303|Ga0182123_1038481	Not Available	660
3300015303|Ga0182123_1055814	Not Available	595
3300015303|Ga0182123_1083122	Not Available	530
3300015305|Ga0182158_1007712	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1052
3300015305|Ga0182158_1037400	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	682
3300015308|Ga0182142_1049104	Not Available	652
3300015308|Ga0182142_1052911	Not Available	638
3300015314|Ga0182140_1042639	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	682
3300015321|Ga0182127_1010635	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays	1042
3300015321|Ga0182127_1049741	Not Available	670
3300015322|Ga0182110_1011433	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1019
3300015322|Ga0182110_1095246	Not Available	548
3300015323|Ga0182129_1026667	Not Available	778
3300015323|Ga0182129_1059449	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	616
3300015341|Ga0182187_1148827	Not Available	561
3300015341|Ga0182187_1163070	Not Available	542
3300015342|Ga0182109_1091312	Not Available	703
3300015343|Ga0182155_1011622	Not Available	1346
3300015343|Ga0182155_1012766	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	1310
3300015343|Ga0182155_1073591	Not Available	752
3300015343|Ga0182155_1147974	Not Available	588
3300015343|Ga0182155_1167202	Not Available	562
3300015344|Ga0182189_1062243	Not Available	811
3300015344|Ga0182189_1094867	Not Available	698
3300015344|Ga0182189_1105284	Not Available	672
3300015344|Ga0182189_1222797	Not Available	507
3300015345|Ga0182111_1074220	Not Available	790
3300015345|Ga0182111_1085167	Not Available	751
3300015345|Ga0182111_1087837	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	743
3300015345|Ga0182111_1181134	Not Available	566
3300015346|Ga0182139_1011970	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	1439
3300015346|Ga0182139_1039344	Not Available	990
3300015346|Ga0182139_1044021	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	952
3300015346|Ga0182139_1060123	Not Available	853
3300015346|Ga0182139_1075057	Not Available	788
3300015346|Ga0182139_1117565	Not Available	668
3300015346|Ga0182139_1158653	Not Available	596
3300015347|Ga0182177_1007566	Not Available	1726
3300015347|Ga0182177_1028535	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays	1114
3300015347|Ga0182177_1049012	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	921
3300015347|Ga0182177_1237976	Not Available	511
3300015351|Ga0182161_1002625	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	2344
3300015351|Ga0182161_1090264	Not Available	770
3300015351|Ga0182161_1099792	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	741
3300015351|Ga0182161_1130873	Not Available	668
3300015351|Ga0182161_1217826	Not Available	546
3300015351|Ga0182161_1243120	Not Available	522
3300015351|Ga0182161_1260609	Not Available	507
3300015355|Ga0182159_1065752	Not Available	1013
3300015355|Ga0182159_1080222	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays	937
3300015355|Ga0182159_1138336	Not Available	751
3300015355|Ga0182159_1148676	Not Available	729
3300015355|Ga0182159_1199782	Not Available	643
3300015355|Ga0182159_1248892	Not Available	585
3300015355|Ga0182159_1353785	Not Available	500
3300015361|Ga0182145_1083095	Not Available	669
3300017404|Ga0182203_1104166	Not Available	584
3300017407|Ga0182220_1081692	Not Available	546
3300017409|Ga0182204_1026408	Not Available	788
3300017410|Ga0182207_1043814	Not Available	795
3300017410|Ga0182207_1118502	Not Available	577
3300017410|Ga0182207_1122491	Not Available	570
3300017411|Ga0182208_1057261	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays	648
3300017411|Ga0182208_1107429	Not Available	534
3300017411|Ga0182208_1115690	Not Available	521
3300017411|Ga0182208_1126594	Not Available	506
3300017411|Ga0182208_1129945	Not Available	501
3300017413|Ga0182222_1094865	Not Available	520
3300017415|Ga0182202_1010871	Not Available	1091
3300017415|Ga0182202_1057278	Not Available	668
3300017424|Ga0182219_1024052	Not Available	871
3300017424|Ga0182219_1064817	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	639
3300017424|Ga0182219_1103097	Not Available	554
3300017425|Ga0182224_1122702	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	555
3300017425|Ga0182224_1137449	Not Available	534
3300017425|Ga0182224_1158590	Not Available	509
3300017430|Ga0182192_1024692	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	973
3300017430|Ga0182192_1139175	Not Available	543
3300017433|Ga0182206_1008348	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	1234
3300017436|Ga0182209_1073331	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays	664
3300017436|Ga0182209_1103707	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	595
3300017436|Ga0182209_1109236	Not Available	585
3300017438|Ga0182191_1164492	Not Available	521
3300017442|Ga0182221_1057756	Not Available	703
3300017442|Ga0182221_1096429	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	601
3300017442|Ga0182221_1122644	Not Available	558
3300017442|Ga0182221_1166310	Not Available	506
3300017443|Ga0182193_1087938	Not Available	664
3300017443|Ga0182193_1114640	Not Available	607
3300017443|Ga0182193_1143463	Not Available	562
3300017680|Ga0182233_1087399	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	569
3300017683|Ga0182218_1015687	Not Available	990
3300017683|Ga0182218_1061614	Not Available	666
3300017683|Ga0182218_1084021	Not Available	607
3300017684|Ga0182225_1039759	Not Available	749
3300017684|Ga0182225_1056325	Not Available	673
3300017685|Ga0182227_1021423	Not Available	1113
3300017685|Ga0182227_1073947	Not Available	633
3300017685|Ga0182227_1132940	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	507
3300017686|Ga0182205_1090910	Not Available	624
3300017690|Ga0182223_1016103	Not Available	875
3300017690|Ga0182223_1067679	Not Available	596
3300017690|Ga0182223_1073871	Not Available	582

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Class

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Category

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	99.27%
Rhizoplane	Host-Associated → Plants → Rhizoplane	0.73%

Type

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	99.27%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	0.73%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	99.27%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	0.73%

Habitat

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	99.27%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.73%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Host-Associated
3300015267	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015268	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015269	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG	Host-Associated
3300015274	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015275	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015281	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG	Host-Associated
3300015282	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015289	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015291	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015292	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015294	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG	Host-Associated
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015298	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015302	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG	Host-Associated
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated
3300015308	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG	Host-Associated
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015321	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG	Host-Associated
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated
3300015323	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG	Host-Associated
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015342	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017407	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017409	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated
3300017415	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017424	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated
3300017430	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG	Host-Associated
3300017433	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG	Host-Associated
3300017436	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG	Host-Associated
3300017438	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG	Host-Associated
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated
3300017680	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG	Host-Associated
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017684	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG	Host-Associated
3300017685	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG	Host-Associated
3300017686	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017690	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG	Host-Associated

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0068867_1011361201	3300005459	Miscanthus Rhizosphere	VLACSLVGFWAGLGWLVLVCCERKTLLAGWFGLAETNKRTG*
Ga0182122_10509672	3300015267	Miscanthus Phyllosphere	MPTRYWACSLVGAGAGLGWLVLVFYERKTLLASWFGLAETNKRTG*
Ga0182154_10649851	3300015268	Miscanthus Phyllosphere	ACSLVSFWAGLGWLVLVYCERKPLLADWFGLAETNKRTG*
Ga0182113_10359201	3300015269	Miscanthus Phyllosphere	LAYSLVGFWAGLGWLVLVFYERKTLLAGWFRLTETNKRTG*
Ga0182188_10578892	3300015274	Miscanthus Phyllosphere	MTAHFSLIYRACSLVGAGAGLGWLVLVFCERKTLLAGWFGLAETNKRTG*
Ga0182188_10607441	3300015274	Miscanthus Phyllosphere	LLVGFWASLGWLVLVYCERKTLLAGWFGLAETNKR
Ga0182172_10319331	3300015275	Miscanthus Phyllosphere	LVGVCAGLGWLVLVFCERKILLAGWFELAVTNNRTG*
Ga0182160_10499821	3300015281	Miscanthus Phyllosphere	LACSLVGFWVGLGWLVLVCCERKTLLAGWFGLAETNKRTG*
Ga0182124_10392841	3300015282	Miscanthus Phyllosphere	SLVGAGAGLDWLVLVFCERKILLAGWFGLAETNQRTG*
Ga0182124_10816792	3300015282	Miscanthus Phyllosphere	LVGFWADLGWLVLVYCERKILLAGWFGLAETNKRTD*
Ga0182138_10620301	3300015289	Miscanthus Phyllosphere	VACSLVGFWASLGWLVLVCCERKTLLAGWFELAETNKRTG*
Ga0182125_10305521	3300015291	Miscanthus Phyllosphere	LVGFWAGLGWLVLVCCESKTLLADWFGLAETNKRTG*
Ga0182141_10138102	3300015292	Miscanthus Phyllosphere	LEGIWACSLVGAGAGLGWLVLVLCERKILLVGWFGLAETNKRTG*
Ga0182141_10251881	3300015292	Miscanthus Phyllosphere	GFWAGLGWLVLVCCERKTLLAGWFGLVETNKRIG*
Ga0182126_10182451	3300015294	Miscanthus Phyllosphere	CSLVGAGAGLGWLVLVFCERKTLLAGWFGLAETNKRTG*
Ga0182157_10794771	3300015296	Miscanthus Phyllosphere	ACSLVGFWAGLGWLVLVYCERKTLLADWFGLAETIKQTGLV*
Ga0182106_10770552	3300015298	Miscanthus Phyllosphere	SLVGAGAGLGWLVLVFCERKTLLAGRFGLAETNKRTG*
Ga0182108_10673741	3300015300	Miscanthus Phyllosphere	CSLVGFWAGLGWLVLVYCERKTLLAGWFGLAETNKRTDHLCHKC*
Ga0182143_10030353	3300015302	Miscanthus Phyllosphere	VKDKECWACSLVGVSAGLGWLVLIFCERKTLLAGWFGLAEINKRTG*
Ga0182123_10204011	3300015303	Miscanthus Phyllosphere	SACSLVGFWAGLSWLVLVCCERKTLLAGWFGLAETNKRTG*
Ga0182123_10384811	3300015303	Miscanthus Phyllosphere	ACSLVGFWAGLGWLVLVYCERKILLANWFGLAETNK*
Ga0182123_10558141	3300015303	Miscanthus Phyllosphere	EQGSPCSHSACSLVSFWADLSWLVLVYCERKTLLADWFGLTEINKRTG*
Ga0182123_10831221	3300015303	Miscanthus Phyllosphere	LVGFWAGLDWLVLVYCERKILLAGWFRLAETNKRTGCLSLLP
Ga0182112_10159023	3300015304	Miscanthus Phyllosphere	MTPLYAQWACSLVGAGAGLGWLVLVFCERKTLLAGWFGLAETNKRTV
Ga0182158_10077123	3300015305	Miscanthus Phyllosphere	MACSLVGFWVGLDWLVLVYCERKTLLTSWFGLAETNRRTIRAQQ*
Ga0182158_10374001	3300015305	Miscanthus Phyllosphere	CSLVGFWAGLDWLVLVCCERKILLTDWFGLAETNQRTG*
Ga0182142_10491042	3300015308	Miscanthus Phyllosphere	MESSACSLVGFWAGLGWLVLVYCERKTLLVGWFGLAETNKRTGCI*
Ga0182142_10529111	3300015308	Miscanthus Phyllosphere	LACSLVGFWAGLGWLVLDYYERKTQLAGWFGLAETNKRTG*
Ga0182140_10426391	3300015314	Miscanthus Phyllosphere	GFWAGLNWLMLVCCERKILLTSWFGLAETNQRTG*
Ga0182127_10106352	3300015321	Miscanthus Phyllosphere	SLVGFWAGLDWLVLVYCERKTLLAGWFGLAETNKRTGR*
Ga0182127_10497412	3300015321	Miscanthus Phyllosphere	SLVGFWAGLGWLVLVCCERKTLLAGWFRLAETNKRTG*
Ga0182127_10532322	3300015321	Miscanthus Phyllosphere	ACSLVGFWAGLGWLLLVYCERKTLLADWFGPAETNERTGCIR*
Ga0182110_10114331	3300015322	Miscanthus Phyllosphere	MACSLVGFWAGLGWLVLVCCERKTLLVGWFGLAETNERRVACSS
Ga0182110_10565622	3300015322	Miscanthus Phyllosphere	VIQKPACSLVGFWAGLGWLVLVYCERKTLLADWFGLVETNKRTG*
Ga0182110_10952461	3300015322	Miscanthus Phyllosphere	MQWVCSLVGTGAGLGWLVLVFCESKTLLAGWFGLAETNKRTG*
Ga0182129_10266671	3300015323	Miscanthus Phyllosphere	SVCSLVGFCAGLGWLVLVYCERKILLAGWFGLAETNKRTG*
Ga0182129_10536091	3300015323	Miscanthus Phyllosphere	VSQTACSLVGFWAGLGWPMLVCCERKTLLAGWFGLAETNKRTG
Ga0182129_10594492	3300015323	Miscanthus Phyllosphere	MPTRYWACSLVGAGAGLDWLVLVFYERKTLLASWFGLAETNKRTG*
Ga0182187_11488271	3300015341	Miscanthus Phyllosphere	ACSLVGAGAGLDWLVLFFCERKTLLASWFGLAETNKRTGWLY*
Ga0182187_11630701	3300015341	Miscanthus Phyllosphere	MACSLVNAGAGLGWLVLVFCERKTLLAGWFGLAETNKRTG*
Ga0182109_10913121	3300015342	Miscanthus Phyllosphere	LVPNHQHSSACSLVGFWAGLGWLVLVYYERKTLLAGWFGLAETNKRTG*
Ga0182155_10116221	3300015343	Miscanthus Phyllosphere	VGLWASLGWLVLVCCERKTLLAGWFGLVETNKRTGCLT*
Ga0182155_10127661	3300015343	Miscanthus Phyllosphere	MLMMQSACSLIGFWAGLGWLVLIYCEKKTLLADWFELVETNERTGE*
Ga0182155_10735911	3300015343	Miscanthus Phyllosphere	LTHTAYSLVGFWAGLGWLVLVCYERKTLLADWFGLAETNKRTG*
Ga0182155_11479741	3300015343	Miscanthus Phyllosphere	LTVNIYMACSLVVFWAGLGWLVLVYCERKTLLTGWFRLTETNKRTD*
Ga0182155_11672021	3300015343	Miscanthus Phyllosphere	MKIYSACLLVGFWVGLDWLVLVYCERKTLLTSWFGLAEINKRTG*
Ga0182189_10217161	3300015344	Miscanthus Phyllosphere	VGPCTYSVCSLVGFWAGLGWLVLIYCERKTLLVGWFGLTETNKR
Ga0182189_10622431	3300015344	Miscanthus Phyllosphere	MKACSLVGAGAGLGWLVLVFCESKTLLAGWFGLAETNKRTG*
Ga0182189_10948671	3300015344	Miscanthus Phyllosphere	SACSLVGFWAGLGWLVLVCCERKTLLAGWFGLAETNKRTG*
Ga0182189_11052841	3300015344	Miscanthus Phyllosphere	GFLGRACSLVGAGAGLGWLVLVFCERKILLAGWFELAETNKRTSWIS*
Ga0182189_12227971	3300015344	Miscanthus Phyllosphere	ACSLVGFWAGLGWLVLVCCERKTLLADWFGLAEINKRTG*
Ga0182111_10742201	3300015345	Miscanthus Phyllosphere	MKACSLVGAGAGLGWLVLVFCERKTLLAGWFGLAETNKRTGWLST*
Ga0182111_10851672	3300015345	Miscanthus Phyllosphere	SACSLVGFWAGLGWLVLVCCERKILLAGWFGLTETNKRTW*
Ga0182111_10878371	3300015345	Miscanthus Phyllosphere	KIYSACLLVGFWVGLDWLVLVYCERKTLLTSCFGLAETNKRTS*
Ga0182111_11811341	3300015345	Miscanthus Phyllosphere	SACSLVGFWAGLGWLVLICCERKTLLAGWFGLAETNKRTC*
Ga0182139_10102191	3300015346	Miscanthus Phyllosphere	VLEGFWACSLVGAGAGLGWLVLVFCERKTLLAGWFGLAETNKRTG
Ga0182139_10119701	3300015346	Miscanthus Phyllosphere	MKYIYTACSLVGLGWLVLVCCERKTILAGWFRLAETNKRTDS
Ga0182139_10393441	3300015346	Miscanthus Phyllosphere	MSACSLVGFWAGLGWLVLVCCERKTLLPGWFGLAETNERTG*
Ga0182139_10440213	3300015346	Miscanthus Phyllosphere	RACSLVGAGAGLGWLVLVFCERKTLLAGWFVLAETNKRTG*
Ga0182139_10601231	3300015346	Miscanthus Phyllosphere	VSCHQFHESACSLVGAGAGLDWLVLVFCERKTLLAGWFGLAETNKRTG
Ga0182139_10750571	3300015346	Miscanthus Phyllosphere	VHLLSACSLVGLWAGLGWLVLVCCERKILLADWFELAETN
Ga0182139_11175651	3300015346	Miscanthus Phyllosphere	VCHPLLPACSLIGFWAGLDWLMLVCCERKILLAGWFGLAEINKRTG*
Ga0182139_11586531	3300015346	Miscanthus Phyllosphere	LVPKLIQLACSLVGAGAGLGWLVLVFCERKTLLAGWFGLAETNKR
Ga0182177_10075661	3300015347	Miscanthus Phyllosphere	VGLWAGLGWLVLVYCERKTLLAGWFGLVETNKRTG*
Ga0182177_10285352	3300015347	Miscanthus Phyllosphere	MKACSLVGAGAGLGWLVLVFCERKTLLAGWFGLAETN
Ga0182177_10490122	3300015347	Miscanthus Phyllosphere	SLVGAGTDLGWLVLVFCERKTLLAGWFGLAETNKRTCL*
Ga0182177_12379761	3300015347	Miscanthus Phyllosphere	SMWTRACSLVGAGAGLGWLVLVFCERKILLVGWFGLAETNKRTG*
Ga0182161_10026251	3300015351	Miscanthus Phyllosphere	KRSTQSACSLVGFWAGLDWLVLVLCERKILLVGWFGLVETNKRTG*
Ga0182161_10902642	3300015351	Miscanthus Phyllosphere	ACSLVGFWAGLDWLVLVLCERKTLLVGWFGLVETNKRTE*
Ga0182161_10997922	3300015351	Miscanthus Phyllosphere	WACSLVGAGAGLDWLVLVFYERKTLLASWFGLAETNKRTG*
Ga0182161_11308731	3300015351	Miscanthus Phyllosphere	MKIYSACLLVGFWVGLDWLVLVYCERKTLLAGWFGLAETNKRTS*
Ga0182161_12178261	3300015351	Miscanthus Phyllosphere	MSISSACSLVGFLAGLGWLVLVCCERKTLLAGWFGLAETNKRTG
Ga0182161_12431201	3300015351	Miscanthus Phyllosphere	GAGAGLGWLVLVFCERKTLLASWFGLAETNKRTG*
Ga0182161_12606092	3300015351	Miscanthus Phyllosphere	GFWAGLGLLVLVCCERKTLLPGWFGLAETNERTG*
Ga0182159_10657521	3300015355	Miscanthus Phyllosphere	ACSLVGFWAGLGWLVLVLCERKTLLVGWFGLVETNKRTCQISI*
Ga0182159_10802221	3300015355	Miscanthus Phyllosphere	CSLVGFWAGLGWLVLVCYERKILLTGWFGLAETNKRI*
Ga0182159_11383361	3300015355	Miscanthus Phyllosphere	TSSACSLVGFWVGLGWLVLVYCEKKTLLAGWFWLAETNKRTGRLW*
Ga0182159_11486761	3300015355	Miscanthus Phyllosphere	SLVGAGAGLGWLVLVFCERKTLLAGWFGLAETNKRTGWLST*
Ga0182159_11997821	3300015355	Miscanthus Phyllosphere	MACLLVGFWTDLGWLVLIYCERKILLAGWFGLAETKEDV*
Ga0182159_12488921	3300015355	Miscanthus Phyllosphere	SACSLVGFWASLGWLVLVYCERKTLLAGWFGLAETNKRTG*
Ga0182159_12831991	3300015355	Miscanthus Phyllosphere	MSILRFSYYLSCSLVGAGADLGWLVLVFYERKTLLAGWFGLAKTNTRTGL
Ga0182159_13537851	3300015355	Miscanthus Phyllosphere	CSLVGAGAGLGWLVLVFCERKTLLASWFGLAETNKRTG*
Ga0182145_10830951	3300015361	Miscanthus Phyllosphere	ACSLVGFWAGLDWLLLVCCERKTLLVGWFGLVETNKRTG*
Ga0182145_11763711	3300015361	Miscanthus Phyllosphere	LVGAGAGLSWLALVFCERKILLAGWFGLVETNKRTGCKT
Ga0182203_11041661	3300017404	Miscanthus Phyllosphere	MKIYSACLLVGFWVGLDWLVLVYCERKTLLTSWFGLAEINKRTG
Ga0182220_10816922	3300017407	Miscanthus Phyllosphere	MTRSACSLVGAGTGLGWLVLVFYERKTLFAGWFGLAEIKKRTRDM
Ga0182204_10264081	3300017409	Miscanthus Phyllosphere	QSACSLVGFWAGLNCLVLVYCEKKTLLAGWFGLAETNKRT
Ga0182207_10438143	3300017410	Miscanthus Phyllosphere	LIISLWVCSLVGVSADLGWLVLVFCERKTLLAGWFGLAETNKR
Ga0182207_11185021	3300017410	Miscanthus Phyllosphere	MKACSLVGAGAGLGWLVLVFCERKTLLAGWFGLAETNK
Ga0182207_11224911	3300017410	Miscanthus Phyllosphere	CSLVGFWAGLGWPVLVYCERKTLLAGWFELAETNKRTG
Ga0182208_10572611	3300017411	Miscanthus Phyllosphere	LVGVGAGLGWLVLVFCERKTLLASWFRLAETNKRTG
Ga0182208_11074291	3300017411	Miscanthus Phyllosphere	LSQLHQQLRAYSLVGAGAGLGWLVLVFYERKTLLTGWFGLAETNK
Ga0182208_11156901	3300017411	Miscanthus Phyllosphere	ACSLVGFWAGLGWLVLVYCERKILLAGWFGLAETNKRTG
Ga0182208_11265941	3300017411	Miscanthus Phyllosphere	LACSLVGFWAGLGWLVLVCCERKTLLAGWFGLAETNKQTGTPWASAHAK
Ga0182208_11299451	3300017411	Miscanthus Phyllosphere	MKSRPRSLVGAGAGLGWLVLICCERKILLADWFGLAETNKRID
Ga0182222_10948651	3300017413	Miscanthus Phyllosphere	AFIQGACSLVGFWAGLDWLVLVYCERKTLLASWFGLVETNKRTW
Ga0182202_10108711	3300017415	Miscanthus Phyllosphere	CSLVSFWASLGWLVLICYERKIFLAGWFGLAEINKRTG
Ga0182202_10572781	3300017415	Miscanthus Phyllosphere	CSLIGFWVGLDWLVLICCERKILLTDWFRLVETNKQTG
Ga0182219_10240521	3300017424	Miscanthus Phyllosphere	LVGFWAGLVWLVLIYYERKTLFTKWFGLAETNKRTG
Ga0182219_10648172	3300017424	Miscanthus Phyllosphere	VQTLNMKIYSACLLVGFWVGLDWLVLVYCERKTLLTSWFGLAEINKRTG
Ga0182219_10890492	3300017424	Miscanthus Phyllosphere	LARSLVSFWAGLDWLVLLYCERKTLLAGWFWLAETNKRTDCFSDND
Ga0182219_11030971	3300017424	Miscanthus Phyllosphere	CSLVGAGAGLGWLMLVFCERKTPLAGWFGLAETNKGTGRMANTHF
Ga0182224_11227021	3300017425	Miscanthus Phyllosphere	MPTRYWACSLVGAGAGLGWLVLVFYERKTLLASWFGLAETNKRTD
Ga0182224_11374491	3300017425	Miscanthus Phyllosphere	MSISSACSLVGFLAGLGWLVLVCCERKTLLAGWFGLAETNKRT
Ga0182224_11585902	3300017425	Miscanthus Phyllosphere	VACSLVGFWAGLGWLVLVCCERKTLLADWFGLAETN
Ga0182192_10246923	3300017430	Miscanthus Phyllosphere	MLMMQSACSLIGFWAGLGWLVLIYCEKKTLLADWFELVETNERTGE
Ga0182192_11391751	3300017430	Miscanthus Phyllosphere	VGFWAGLGWLALVCCERKTLLAGWFGLAETNKRTG
Ga0182206_10083482	3300017433	Miscanthus Phyllosphere	LKSCSLAGAGAGLGWLVLVFCERKTLLAGWFGLAETNKRTGLHVATI
Ga0182206_11486711	3300017433	Miscanthus Phyllosphere	LGWLVLVYCERKTLLVGWFGLVETNQRTDRMMATGL
Ga0182209_10733311	3300017436	Miscanthus Phyllosphere	VLEGFWACSLVGAGAGLGWLVLVFCERKTLLAGWFGLAETNK
Ga0182209_11037071	3300017436	Miscanthus Phyllosphere	MNAYTACSLVGAGAGLDWLVLVFCERKTLLAGWFGLAETNKRTGWL
Ga0182209_11092361	3300017436	Miscanthus Phyllosphere	MDHISACSLVGFWAGLSCLVLICCERKILLVGWFGLAETNKRIG
Ga0182191_11501741	3300017438	Miscanthus Phyllosphere	LRHAACSLVDFWTGLGWLVLVYCERKTLLAGWFGLAETN
Ga0182191_11644921	3300017438	Miscanthus Phyllosphere	SACSLVSFWAGLDWLVLVCCERKILLTDWFGLAETNKLTGI
Ga0182221_10557981	3300017442	Miscanthus Phyllosphere	QWACSLVGAGAGLGWLVLVFCERKTLLAGWFGLAETNKRTG
Ga0182221_10577561	3300017442	Miscanthus Phyllosphere	GFVFRPHTQSACSLVSFWAGLGWLVLVYCERKTLLAGWFGLAETMKRTG
Ga0182221_10964291	3300017442	Miscanthus Phyllosphere	TRYWACSLVGAGAGLGWLVLVFYERKTLLASWFGLAETNKRTG
Ga0182221_11226441	3300017442	Miscanthus Phyllosphere	SLVGFWAGLGWLMLVCCEKKTLLTGWFGLAETNKRTG
Ga0182221_11663101	3300017442	Miscanthus Phyllosphere	WACSLVGAGAGLGWLVLVFCERKTLLAGWFGLAETNKRTCL
Ga0182193_10879381	3300017443	Miscanthus Phyllosphere	LVGAGAGLGWLVLVFCERKTLLASWFGLAETNERTG
Ga0182193_11028942	3300017443	Miscanthus Phyllosphere	LVGIWAGLDWLVLVLCERKTLLVGWFGLVETNKRTE
Ga0182193_11146401	3300017443	Miscanthus Phyllosphere	LRFHGTQRACSLVGAGAGLGWLMLVFYERKTLLTGWFGLAETNNRTG
Ga0182193_11434631	3300017443	Miscanthus Phyllosphere	MIYPFWACSLVGTGVGLGWLVLVFCERKTLFAGWFGLAETNKETG
Ga0182233_10873992	3300017680	Miscanthus Phyllosphere	MACSLVGFWAGLGWLVLVYCERKILLAGWFGLAETNKRTGRIEPNRSD
Ga0182218_10093171	3300017683	Miscanthus Phyllosphere	MGYWACSLVGAGAGLGWLVLVFCERKTLLAGWFGLAETNKRTGCIMD
Ga0182218_10156871	3300017683	Miscanthus Phyllosphere	MKACSLVGAGAGLGWLVLVFCERKTLLAGWFGLAETNKRTG
Ga0182218_10616141	3300017683	Miscanthus Phyllosphere	LTHTAYSLVGFWAGLGWLVLVCYERKTLLADWFGLAETNKRTG
Ga0182218_10840211	3300017683	Miscanthus Phyllosphere	MNVDSACSLVGLWAGLGWLVLVYCERKTLLAGWFGLAETNKRTG
Ga0182225_10397591	3300017684	Miscanthus Phyllosphere	MACLLVGFWTDLGWLVLIYCERKILLAGWFGLAETKEDV
Ga0182225_10563251	3300017684	Miscanthus Phyllosphere	MNMACSLVGFWVGLGWLMLVYYERKTPLTGWFGLAETNKRTG
Ga0182227_10214232	3300017685	Miscanthus Phyllosphere	MSISSACSLVGFLAGLGWLVLVCCERKTLLAGWFGLAETNKRTGS
Ga0182227_10739471	3300017685	Miscanthus Phyllosphere	MAYSLVSFWAGLGWLVLVYCERKTLLTGWFGLAGTNKLTG
Ga0182227_11329402	3300017685	Miscanthus Phyllosphere	ACSLVGVGAGLGWLVLVFCERKTLLASWFRLAETNKRTG
Ga0182205_10909101	3300017686	Miscanthus Phyllosphere	YWACSLVGAGAGLGWLVLVFYERKTLLASWFGLAETNKRTG
Ga0182223_10161031	3300017690	Miscanthus Phyllosphere	LACSLVGVCAGLGWLVLVFCEKKTLLAGWFGLAETNKRTG
Ga0182223_10676791	3300017690	Miscanthus Phyllosphere	CSPCSLVGAGAGLDWLVLVFCERKTLLAGWFGLAETNKRTW
Ga0182223_10738711	3300017690	Miscanthus Phyllosphere	WACSLVGAGAGLGWLVLVFYERKTLLVGWFGLAGTNKRTGC