| Basic Information | |
|---|---|
| Family ID | F056163 |
| Family Type | Metagenome |
| Number of Sequences | 138 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MKLPPEIEFHEDIRLLIYRPRGLINEAEINKVISVIEEIEA |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 138 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 57.60 % |
| % of genes near scaffold ends (potentially truncated) | 87.68 % |
| % of genes from short scaffolds (< 2000 bps) | 86.23 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (79.710 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (17.391 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.435 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (71.739 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.09% β-sheet: 11.59% Coil/Unstructured: 62.32% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 138 Family Scaffolds |
|---|---|---|
| PF13561 | adh_short_C2 | 7.97 |
| PF06742 | DUF1214 | 5.07 |
| PF04367 | DUF502 | 5.07 |
| PF00232 | Glyco_hydro_1 | 3.62 |
| PF00884 | Sulfatase | 2.90 |
| PF00072 | Response_reg | 2.17 |
| PF02518 | HATPase_c | 2.17 |
| PF06863 | DUF1254 | 2.17 |
| PF10009 | DUF2252 | 2.17 |
| PF14707 | Sulfatase_C | 2.17 |
| PF12710 | HAD | 1.45 |
| PF16798 | DUF5069 | 1.45 |
| PF13557 | Phenol_MetA_deg | 1.45 |
| PF07228 | SpoIIE | 1.45 |
| PF01979 | Amidohydro_1 | 1.45 |
| PF00106 | adh_short | 0.72 |
| PF00196 | GerE | 0.72 |
| PF13432 | TPR_16 | 0.72 |
| PF03349 | Toluene_X | 0.72 |
| PF00230 | MIP | 0.72 |
| PF03372 | Exo_endo_phos | 0.72 |
| PF02656 | DUF202 | 0.72 |
| PF11964 | SpoIIAA-like | 0.72 |
| PF06230 | LpxI_C | 0.72 |
| PF14534 | DUF4440 | 0.72 |
| PF07963 | N_methyl | 0.72 |
| PF13202 | EF-hand_5 | 0.72 |
| COG ID | Name | Functional Category | % Frequency in 138 Family Scaffolds |
|---|---|---|---|
| COG5361 | Uncharacterized conserved protein | Mobilome: prophages, transposons [X] | 7.25 |
| COG2928 | Uncharacterized membrane protein | Function unknown [S] | 5.07 |
| COG5402 | Uncharacterized protein, contains DUF1214 domain | Function unknown [S] | 5.07 |
| COG2723 | Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase | Carbohydrate transport and metabolism [G] | 3.62 |
| COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 0.72 |
| COG2067 | Long-chain fatty acid transport protein | Lipid transport and metabolism [I] | 0.72 |
| COG2149 | Uncharacterized membrane protein YidH, DUF202 family | Function unknown [S] | 0.72 |
| COG3494 | Uncharacterized conserved protein, DUF1009 family | Function unknown [S] | 0.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 79.71 % |
| Unclassified | root | N/A | 20.29 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2065487018|GPINP_F5MS3JC02G76KD | Not Available | 508 | Open in IMG/M |
| 2065487018|GPINP_F5MS3JC02HHOXB | All Organisms → cellular organisms → Bacteria → Proteobacteria | 524 | Open in IMG/M |
| 2170459002|FZY7DQ102I6QWJ | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 526 | Open in IMG/M |
| 2170459003|FZ032L002JXL0J | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 502 | Open in IMG/M |
| 2170459007|GKWS7RC02GAATA | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 533 | Open in IMG/M |
| 2170459008|GA8OVOZ02JT88G | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 523 | Open in IMG/M |
| 2170459013|GO6OHWN01EBV50 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_100238451 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 546 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101855437 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300000550|F24TB_10147764 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2814 | Open in IMG/M |
| 3300000787|JGI11643J11755_11782351 | Not Available | 794 | Open in IMG/M |
| 3300000890|JGI11643J12802_12393070 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 742 | Open in IMG/M |
| 3300000955|JGI1027J12803_100192794 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 578 | Open in IMG/M |
| 3300000955|JGI1027J12803_104065714 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300000955|JGI1027J12803_109702487 | All Organisms → cellular organisms → Bacteria | 1350 | Open in IMG/M |
| 3300000956|JGI10216J12902_100770192 | All Organisms → cellular organisms → Bacteria | 1086 | Open in IMG/M |
| 3300000956|JGI10216J12902_101890113 | All Organisms → cellular organisms → Bacteria | 1371 | Open in IMG/M |
| 3300001431|F14TB_104112901 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300002899|JGIcombinedJ43975_10052835 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300004463|Ga0063356_101738964 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 934 | Open in IMG/M |
| 3300004463|Ga0063356_103296353 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300004479|Ga0062595_101043451 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 708 | Open in IMG/M |
| 3300005186|Ga0066676_10338829 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
| 3300005186|Ga0066676_10494997 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 830 | Open in IMG/M |
| 3300005294|Ga0065705_10398582 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300005332|Ga0066388_101553136 | Not Available | 1161 | Open in IMG/M |
| 3300005332|Ga0066388_101633884 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
| 3300005332|Ga0066388_103193053 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 837 | Open in IMG/M |
| 3300005332|Ga0066388_103209418 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 835 | Open in IMG/M |
| 3300005450|Ga0066682_10122827 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1643 | Open in IMG/M |
| 3300005764|Ga0066903_100758184 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1725 | Open in IMG/M |
| 3300005764|Ga0066903_103304821 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300005764|Ga0066903_103990206 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300005764|Ga0066903_104009899 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300005764|Ga0066903_105216191 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300005764|Ga0066903_109144294 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300006881|Ga0068865_100909447 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 766 | Open in IMG/M |
| 3300007788|Ga0099795_10507528 | Not Available | 563 | Open in IMG/M |
| 3300009137|Ga0066709_101807467 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 857 | Open in IMG/M |
| 3300010046|Ga0126384_11434837 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300010048|Ga0126373_10484007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1277 | Open in IMG/M |
| 3300010048|Ga0126373_11857466 | Not Available | 666 | Open in IMG/M |
| 3300010358|Ga0126370_12474820 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300010359|Ga0126376_10076320 | All Organisms → cellular organisms → Bacteria | 2473 | Open in IMG/M |
| 3300010359|Ga0126376_12708286 | Not Available | 545 | Open in IMG/M |
| 3300010360|Ga0126372_10325592 | Not Available | 1365 | Open in IMG/M |
| 3300010361|Ga0126378_13213002 | Not Available | 520 | Open in IMG/M |
| 3300010362|Ga0126377_11800184 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300010362|Ga0126377_12707879 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300010366|Ga0126379_10199485 | All Organisms → cellular organisms → Bacteria | 1923 | Open in IMG/M |
| 3300010366|Ga0126379_11070677 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 912 | Open in IMG/M |
| 3300010366|Ga0126379_11178283 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300010371|Ga0134125_12295216 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 587 | Open in IMG/M |
| 3300010376|Ga0126381_100904552 | All Organisms → cellular organisms → Bacteria | 1270 | Open in IMG/M |
| 3300010376|Ga0126381_104541836 | Not Available | 535 | Open in IMG/M |
| 3300010398|Ga0126383_11199643 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300010398|Ga0126383_11743887 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 711 | Open in IMG/M |
| 3300010398|Ga0126383_11780613 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 704 | Open in IMG/M |
| 3300010399|Ga0134127_10185854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1920 | Open in IMG/M |
| 3300012200|Ga0137382_10058167 | All Organisms → cellular organisms → Bacteria | 2438 | Open in IMG/M |
| 3300012201|Ga0137365_11210183 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 540 | Open in IMG/M |
| 3300012285|Ga0137370_10340909 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300012351|Ga0137386_10350335 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
| 3300012896|Ga0157303_10234549 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 550 | Open in IMG/M |
| 3300012948|Ga0126375_10302137 | Not Available | 1112 | Open in IMG/M |
| 3300012958|Ga0164299_11539473 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300012971|Ga0126369_12124562 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300012972|Ga0134077_10312140 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300012975|Ga0134110_10314635 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 679 | Open in IMG/M |
| 3300012984|Ga0164309_10769758 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300012987|Ga0164307_11840713 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300012989|Ga0164305_10529452 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
| 3300012989|Ga0164305_10879823 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300014154|Ga0134075_10270180 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 737 | Open in IMG/M |
| 3300015359|Ga0134085_10266227 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300015359|Ga0134085_10574836 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 522 | Open in IMG/M |
| 3300015371|Ga0132258_13799104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium sullae | 1029 | Open in IMG/M |
| 3300015372|Ga0132256_102153628 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300015373|Ga0132257_103623129 | Not Available | 562 | Open in IMG/M |
| 3300016270|Ga0182036_10418829 | All Organisms → cellular organisms → Bacteria | 1047 | Open in IMG/M |
| 3300016319|Ga0182033_11607826 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 588 | Open in IMG/M |
| 3300016319|Ga0182033_12019203 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300016387|Ga0182040_10590954 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 898 | Open in IMG/M |
| 3300016404|Ga0182037_11207436 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300016422|Ga0182039_10226085 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1509 | Open in IMG/M |
| 3300016422|Ga0182039_11641335 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300018054|Ga0184621_10035316 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1617 | Open in IMG/M |
| 3300018431|Ga0066655_10770856 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300018431|Ga0066655_10950319 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → environmental samples → uncultured Phycisphaerae bacterium | 591 | Open in IMG/M |
| 3300018433|Ga0066667_10721875 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300019874|Ga0193744_1085494 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300019877|Ga0193722_1101359 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300019882|Ga0193713_1102333 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300019883|Ga0193725_1134680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Xenophilus → unclassified Xenophilus → Xenophilus sp. L33 | 548 | Open in IMG/M |
| 3300020006|Ga0193735_1140622 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300021560|Ga0126371_10709719 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1154 | Open in IMG/M |
| 3300024330|Ga0137417_1357714 | All Organisms → cellular organisms → Bacteria | 3893 | Open in IMG/M |
| 3300025910|Ga0207684_10517989 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1022 | Open in IMG/M |
| 3300025930|Ga0207701_11054255 | Not Available | 675 | Open in IMG/M |
| 3300025930|Ga0207701_11067632 | Not Available | 670 | Open in IMG/M |
| 3300025936|Ga0207670_10425716 | Not Available | 1066 | Open in IMG/M |
| 3300026023|Ga0207677_11146820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium sullae | 710 | Open in IMG/M |
| 3300026078|Ga0207702_12326992 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 523 | Open in IMG/M |
| 3300026557|Ga0179587_10773098 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 633 | Open in IMG/M |
| 3300027903|Ga0209488_10440442 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
| 3300028784|Ga0307282_10155985 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1082 | Open in IMG/M |
| 3300031231|Ga0170824_106424315 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300031446|Ga0170820_13368760 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300031446|Ga0170820_17875514 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300031720|Ga0307469_11982874 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 565 | Open in IMG/M |
| 3300031740|Ga0307468_102063680 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300031740|Ga0307468_102282697 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300031912|Ga0306921_10657671 | All Organisms → cellular organisms → Bacteria | 1207 | Open in IMG/M |
| 3300031912|Ga0306921_11180209 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300031912|Ga0306921_11533112 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 727 | Open in IMG/M |
| 3300031942|Ga0310916_10493386 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1043 | Open in IMG/M |
| 3300031942|Ga0310916_10518412 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1015 | Open in IMG/M |
| 3300031954|Ga0306926_10049293 | All Organisms → cellular organisms → Bacteria | 5032 | Open in IMG/M |
| 3300031954|Ga0306926_10592384 | All Organisms → cellular organisms → Bacteria | 1355 | Open in IMG/M |
| 3300032001|Ga0306922_10039686 | All Organisms → cellular organisms → Bacteria | 4834 | Open in IMG/M |
| 3300032001|Ga0306922_10915150 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
| 3300032076|Ga0306924_11725050 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300032076|Ga0306924_12391968 | Not Available | 533 | Open in IMG/M |
| 3300032205|Ga0307472_101637118 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 634 | Open in IMG/M |
| 3300032261|Ga0306920_101550743 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 944 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 17.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.04% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.14% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 9.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.70% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.80% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.07% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 3.62% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.62% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.62% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.90% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.17% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 1.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.45% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.45% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.45% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.45% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.45% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.72% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.72% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.72% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.72% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2065487018 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2170459002 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cm | Environmental | Open in IMG/M |
| 2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 2170459007 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 10-21cm | Environmental | Open in IMG/M |
| 2170459008 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect DNA Tissue lysis 0-10cm | Environmental | Open in IMG/M |
| 2170459013 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis soil at the rocks surface 0-21cm | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300002899 | Soil microbial communities from Manhattan, Kansas, USA - Combined assembly of Kansas soil 100-500um Nextera (ASSEMBLY_DATE=20140607) | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019874 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a1 | Environmental | Open in IMG/M |
| 3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPINP_04334830 | 2065487018 | Soil | MELPPDIEFHPDIRLLVYRPRGLIDEAAINKIIGVI |
| GPINP_02315630 | 2065487018 | Soil | MKLPPEIQFHQDIRLLIYRPSGLIDEAVLNKVISVIEDLEAATQEPFNRFTDAS |
| E1_00547410 | 2170459002 | Grass Soil | MKIPPDFEFHEDIRLLIYRPHGLLNEVAFNEVISVVEDLEAKLQ |
| E4A_05291590 | 2170459003 | Grass Soil | LPPDIEFHEDIRLLIYRPKGVINEAEINRVIGVIEGIEAASQHPL |
| L02_00860190 | 2170459007 | Grass Soil | MKLPPDIEFHEDIRLLIYRPKGVINEAEINRVIGVIEGIEAASQHP |
| F48_00787610 | 2170459008 | Grass Soil | MKLPPDIEFHEDIRLLIYRPKGVINEAEINRVIGVIEGIEAASQHPFNR |
| N57_07181660 | 2170459013 | Grass Soil | MELPPEIEFHPDIRLLVYRPRGLIDEATVNKIISVIEDLEAATQE |
| INPhiseqgaiiFebDRAFT_1002384511 | 3300000364 | Soil | MKLPPEIEFHQDIRLFVYRPRGLIDEAAVNNVISVIEEIEAATQ |
| INPhiseqgaiiFebDRAFT_1018554372 | 3300000364 | Soil | MKLPSEIEFHEDIRLLVWRPRGLLDEAAINKVLSA |
| F24TB_101477644 | 3300000550 | Soil | MIGTISPRKENVMKLPSEIQFHEDIRLLVYRPRGLIDEAAINKIISVIEKLEAATQEPFN |
| JGI11643J11755_117823511 | 3300000787 | Soil | MELPPEIGFHPDIGLLIYRPRGLINEAALNKVINIIEDLE |
| JGI11643J12802_123930702 | 3300000890 | Soil | MKLPRDVEFHENIRLLIYRPRGLIDEAAINKVISIIEDLEASTQEPFNR |
| JGI1027J12803_1001927942 | 3300000955 | Soil | MKLPPDVEFHEDIRLFVWRPRGVLNEAAINKVLSTLEEPKILILSV* |
| JGI1027J12803_1040657141 | 3300000955 | Soil | MKLPREIEFYQDLCLLIYRPRGLIDEAAINKIISVIEDI |
| JGI1027J12803_1097024875 | 3300000955 | Soil | MKLPPEIQFHEDIRLLIYRPRGLIGETALNNVIDVIEDLEAATQEPFNRF |
| JGI10216J12902_1007701921 | 3300000956 | Soil | MNNIKLPPEIEFHKDIRLLIYRPKGLINEAEINRVIGVIEGIEAATQE |
| JGI10216J12902_1018901131 | 3300000956 | Soil | MNNIKLPPDIEFHQDIRLLIYRPKGLIDEAEINRVIGVIEGIEAATQE |
| F14TB_1041129011 | 3300001431 | Soil | MKLPSEIEFHQDIGLLVYRPRGLIDEAAINKIISVIEDIEAN |
| JGIcombinedJ43975_100528351 | 3300002899 | Soil | MKLPPDIEFHQGIRLLIYRPKGLINEAEINRVIGVIEGIEAASKQPFNRF |
| Ga0063356_1017389642 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MTLPPDIEFHEDIRLLVYRPRGLIDEAAINKITTAIEELEAK |
| Ga0063356_1032963532 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MKLPPDIEFHKDIRLFIYRPKGLINEAEINRVIGVIEGIEAAS |
| Ga0062595_1010434512 | 3300004479 | Soil | MKLPPDIEFHEDIHLLIYRPKGLINEAEINRVIGVIEGIEAASQQ |
| Ga0066676_103388291 | 3300005186 | Soil | MKLPPDVEFHEDIHLLIYRPCGLIDEAALNKVINVIEDLEAATQE |
| Ga0066676_104949971 | 3300005186 | Soil | MKLPPDVQFHKNARLLVYRPRGLLNESAINKVLSALEDLEAE |
| Ga0065705_103985821 | 3300005294 | Switchgrass Rhizosphere | MNLPPEADFHEDIRLLIWRPRGLVNEAAVNKILTVLEELEGKLH |
| Ga0066388_1007737453 | 3300005332 | Tropical Forest Soil | MKLPPDVEFYEDIRLFIHRPRGMLNEATINQVVSAIEDLEAKLQE |
| Ga0066388_1015531361 | 3300005332 | Tropical Forest Soil | MKFPPEIEFHQDIRLLIYRPKRVINEAEINRVIGVIEGIEAASQEPFNRFS |
| Ga0066388_1016338843 | 3300005332 | Tropical Forest Soil | MNNIKLSPEIEFHQDIRLLIYRPKGLINEAEINRVIGVIEGIEAASKQPFNRFS |
| Ga0066388_1031930531 | 3300005332 | Tropical Forest Soil | MKLAPEIEFHEDIRLLVWRPRGLLDEAAINKILSALEDLEAKLQ |
| Ga0066388_1032094182 | 3300005332 | Tropical Forest Soil | MSLPPEIEFHEDVRLLVYRPRGLIDEAAINKITSVIEEIE |
| Ga0066682_101228273 | 3300005450 | Soil | MKLPPDLEFHEDIRLLVYRPRGLLNEAAFNKVISALEDLEAKLQEPF |
| Ga0066903_1007581841 | 3300005764 | Tropical Forest Soil | MNNMKLPPELEFHEDIRLLIYRPRGLVNEAALNKTLGALEDLEA |
| Ga0066903_1020455941 | 3300005764 | Tropical Forest Soil | MKLPPDLEFYEDIRLLFFRPHGLLNEGAFNKVISALEDLE |
| Ga0066903_1033048213 | 3300005764 | Tropical Forest Soil | MNNIKLPPELEFHEDIRLLIYRPRGLVNEAALNKTLGALEDLEA |
| Ga0066903_1039902063 | 3300005764 | Tropical Forest Soil | MINLKLPPDVEFYEDIRLLIYRPRDLIDEAVVNRIVSVIEQIE |
| Ga0066903_1040098993 | 3300005764 | Tropical Forest Soil | MINVKLPPDVEFYEDIRLLIYRPRDLIDEAVVNRIVSVIEQIE |
| Ga0066903_1052161913 | 3300005764 | Tropical Forest Soil | MKLPPDIEFHEHIRLLIYRPKGLINEAEINRVIGVI |
| Ga0066903_1072855452 | 3300005764 | Tropical Forest Soil | MKLPPDVEFQEDIRLFIHRPRGLLNEATINQVVAALEDLEAKLQEPFNRFLD |
| Ga0066903_1091442942 | 3300005764 | Tropical Forest Soil | MKLPADVEFHEDIRLLIYRPRGLLDEAAINEVIGVIENLEAK |
| Ga0068865_1009094472 | 3300006881 | Miscanthus Rhizosphere | MKLPLPPDLEFHEDIRLLIYRPRGLLNEAAFNKVISALEDLEGKLQEP |
| Ga0099795_105075282 | 3300007788 | Vadose Zone Soil | MKLPPEIEVHSDIRLLVYRPRGLINEAAINKVVSAIEDLEAATQE |
| Ga0066709_1018074672 | 3300009137 | Grasslands Soil | MKLPPEIQFHQDIRLLIYRPHGLLNEAAFNTVISALEDLEAKL |
| Ga0126384_114348373 | 3300010046 | Tropical Forest Soil | MKLPPDIEFHEDIRLLIYRPRGLVNEAALNKTLSALEDLE |
| Ga0126373_104840073 | 3300010048 | Tropical Forest Soil | MKLPPEIEFHEDIRLLIYRPRGLINEAEINKVISVIEEIEA |
| Ga0126373_118574662 | 3300010048 | Tropical Forest Soil | MKLPPDVEFYEDVRLLIYRPRGLIDEAAVNKIVAVIEEIEAASP |
| Ga0134070_101256833 | 3300010301 | Grasslands Soil | MKLPPDVQFHKNARLLVYRPRGLLNESAINKVLSALEGLEAELQEPFNRF |
| Ga0126370_124748201 | 3300010358 | Tropical Forest Soil | MKLPPDIEFHEDIRLLIYRPRGLLDEAAINKVLSALEDLEAK |
| Ga0126376_100763204 | 3300010359 | Tropical Forest Soil | MINLKLPPDVEFHEDIRLLIYRPKGVINEAVVNNIVSVIEEIEAATQEPFNRF |
| Ga0126376_127082862 | 3300010359 | Tropical Forest Soil | MKLSPEIEFHQDIRLLIYRPKELINEAEINRVIGIIEGIEAASDEPFSRFS |
| Ga0126372_103255922 | 3300010360 | Tropical Forest Soil | MEIIEMNKMKLLPELEFYEDIRLLIYRPRGLVNEAALNKTLSALEDLEANLQE |
| Ga0126378_132130021 | 3300010361 | Tropical Forest Soil | MKLPPDIEFHQDIRLLIYRPKGVINEAEINRVIAVIEGIEAA* |
| Ga0126377_118001842 | 3300010362 | Tropical Forest Soil | MEIIQMNKMKLPPEIEFQEDIRLLIYRPQGLLNEAALNKALSALEDLEANL |
| Ga0126377_127078792 | 3300010362 | Tropical Forest Soil | MINVKLPPDVEFYEDIRLLIYRPRDLIDEAVVNRIVSVIEQIEAATQAPFN |
| Ga0126379_101994853 | 3300010366 | Tropical Forest Soil | MKLPPDIEFHQDIRLLIYRPKGMINEAEINRVSGIIE |
| Ga0126379_110706771 | 3300010366 | Tropical Forest Soil | MKLPPDIEFHEDIRLLIYRPKGLINAAEINRVIGVIEGIEAGSQEPFNRFS |
| Ga0126379_111782833 | 3300010366 | Tropical Forest Soil | MEIIEMDNTKLPPELEFHEDIRLLIYRPRGLVNEAALNKTLGALEDLEAKLQ |
| Ga0134125_122952162 | 3300010371 | Terrestrial Soil | MKLPPELEFHQDIRLLVYRPHGLIDEAAINKVVTAIEDLET |
| Ga0134128_130568501 | 3300010373 | Terrestrial Soil | MMLPRDVQFYEDVRLFVWIPRGVLDEAALNKVLGALEDLEAKLQAPFNRFTDTL |
| Ga0126381_1009045523 | 3300010376 | Tropical Forest Soil | MINVKLPAEVEFHEDVRLLIYRPKGVINEAVVNKIVSVIEEIEAATQEPF |
| Ga0126381_1024269501 | 3300010376 | Tropical Forest Soil | MNNMKLPPELEFHEDIRLLIYRPRGLVNEAALNKTLGALEDLEAKLQAPFNRFTD |
| Ga0126381_1039907193 | 3300010376 | Tropical Forest Soil | MKLRPEIEFHEDIRLFIYRPRGLIDEAAMNEVIGVIEDLEAKLQEPFNRFADTVAADE |
| Ga0126381_1045418361 | 3300010376 | Tropical Forest Soil | MKPPPEVEFHEDIHLLIYRPRGLIDEAAISNIIAVIERLEIEK |
| Ga0126381_1048681301 | 3300010376 | Tropical Forest Soil | MEIIQMNKMKLPPEIEFQEDIRLLIYRPQGLLNEAALNKALGALEDLEEKLQEPFNR |
| Ga0126383_111996431 | 3300010398 | Tropical Forest Soil | MNNMKLPPELEFHEDIRLLIYRPRGLVNEAALNKTLGALEDLEAKLQEP |
| Ga0126383_117438871 | 3300010398 | Tropical Forest Soil | MKLPPEIEFHEDIRLLIFRPRGVVDEVALNRTLSALEDLETK |
| Ga0126383_117806132 | 3300010398 | Tropical Forest Soil | MKLLPEIEFHEDIRLFIYKPRGLIDEAAMNKVIGVIEDLEAKLEEPFNRF |
| Ga0134127_101858543 | 3300010399 | Terrestrial Soil | MKLSPDIEFHQDIRLLIYRPKGVINEAEINRVIGVIEG |
| Ga0137382_100581673 | 3300012200 | Vadose Zone Soil | MKPPPEIEFHQDIRLLVYRPHGLIDEAAINEVVSVIEGLE |
| Ga0137365_112101831 | 3300012201 | Vadose Zone Soil | MKLPPELEFHQDIRLLIYRPHGLIDEAAINKVVGAIEDLEAATQEPFNR |
| Ga0137370_103409093 | 3300012285 | Vadose Zone Soil | MKLLPEIEFHEDIRLLVYRPRGLIDETAVKKVISVLE |
| Ga0137386_103503351 | 3300012351 | Vadose Zone Soil | MNKMKLPPEIQFYEDIRLLIYRPRGLIDEAAINKVTSVIEDLEAE |
| Ga0157303_102345492 | 3300012896 | Soil | MKLPPDIEFHKDIRLFIYRPKGLINEAEINRVIGVIEGIEAASQQPFNRFS |
| Ga0126375_103021374 | 3300012948 | Tropical Forest Soil | MKLPPNVEFQEDIRLLIYRPRGLIDEAAVNKIVTVIEEIEAAS |
| Ga0164299_115394732 | 3300012958 | Soil | MKLSADIEFREDVRLLIYRPKGLINEAEINRVIGVIEGIEAASQQPFNRFSD |
| Ga0126369_121245622 | 3300012971 | Tropical Forest Soil | MKLPPDIEFHQGIRLLIYRPTGLINEAEINRVIGV |
| Ga0134077_103121403 | 3300012972 | Grasslands Soil | MKLPPEIQFYKDIRLLIYRPHGLIDEAAINKVTSVIE |
| Ga0134110_103146353 | 3300012975 | Grasslands Soil | MRLPPEIQFYKDAHLLVYRPHGLLNEASVNKVTSLIEDLE |
| Ga0164309_107697582 | 3300012984 | Soil | MKLPPDIEFHEDIRLFIYRPKGLINEAEINRVIGIIEGIEAAS |
| Ga0164307_118407132 | 3300012987 | Soil | MKLPPDIEFHEDIRLLIYKPHGLIDEAAINEVIGVIEDLEAKLQEPF |
| Ga0164305_105294522 | 3300012989 | Soil | MKLPPELEFHEDIRLLIYRPRGLVNEAALNKTLSALEDLE |
| Ga0164305_108798232 | 3300012989 | Soil | MKLPPDIEFHEDFRLLIYRPKGLINEAEINRVIGVIEGIE |
| Ga0134075_102701802 | 3300014154 | Grasslands Soil | MILLSPNVEFHEDIRLLIYRPRGVLNEAAINKVLSALEDLEAKL |
| Ga0134085_102662271 | 3300015359 | Grasslands Soil | MKLPPEIQFYKDIRLFIYRPRGLIDEAAINKVTSVIEELEAET |
| Ga0134085_105748361 | 3300015359 | Grasslands Soil | MKLPPDVQFHKNARLLVYRPRGLLNESAINKVLSALEDLEAELQ |
| Ga0132258_137991042 | 3300015371 | Arabidopsis Rhizosphere | MKLPPEIEFHPDIGLLIYRPRGLIDEAAINKVVSV |
| Ga0132256_1021536281 | 3300015372 | Arabidopsis Rhizosphere | MKLPPNIEFHEDIRLLIYRPRGLVNEAALNKTLSALEDLEAKLEKPF |
| Ga0132257_1036231292 | 3300015373 | Arabidopsis Rhizosphere | MNLPPEIQFLEDVRLVIYRPRGVVDEASLNRAIAALSDLEATLK |
| Ga0182036_104188293 | 3300016270 | Soil | MNLSPELEFHEDIRLLIYRPRGLVNEAALNKTLSALEDLEAKL |
| Ga0182033_116078261 | 3300016319 | Soil | VKLSPEIEFHEDIRLLVWRPRGLLDEAAINKILSALEDLEA |
| Ga0182033_120192031 | 3300016319 | Soil | MKLPPEIQFYEDIRLLVYRPRGLIDEAAVNKIVSVIEEIEAATQEPFNR |
| Ga0182040_105909542 | 3300016387 | Soil | MKLPPEIEFHEDIRLLIYRPRGLLNEAAINRVLGALEDLEAK |
| Ga0182037_112074361 | 3300016404 | Soil | MKLPPDIEFHEDIRLLIYRPKGLINEPEINRVIGIIEGIEAASQQPF |
| Ga0182039_102260851 | 3300016422 | Soil | MKLLQEIEFHEDIRLFIYKPRGLIDEAAMNEVIGVIEDLEAKLQEPFNRF |
| Ga0182039_116413352 | 3300016422 | Soil | MKLPPELEFHEDIRLLIYRPRGLVNEAALNKTLSALED |
| Ga0182038_114014172 | 3300016445 | Soil | MKLPPDVEFHEDIHLFIHRPHGLLNEATINQVVSALGDLEAKLQ |
| Ga0134074_13714202 | 3300017657 | Grasslands Soil | MKLPPDVQFHKNARLLVYRPRGLLNESAINKVLSALEDLEAELQEPFNRF |
| Ga0184621_100353161 | 3300018054 | Groundwater Sediment | MKLPPEVQFHEDIRLLIYRPKGLINEAEINRVIGVIEGI |
| Ga0066655_107708562 | 3300018431 | Grasslands Soil | MKLPPEIQFHEDIRLLIYRPRGLIDEVAINKVTSVIEQL |
| Ga0066655_109503191 | 3300018431 | Grasslands Soil | MTLPSDIEFHEDIRLFIYRPRGLIDEAALKKAISVLEDLEAKSQEP |
| Ga0066667_107218752 | 3300018433 | Grasslands Soil | MKLPPDIQFHEDIRLLVWRPRGLIDEAAINKVISVIEDLEAATQE |
| Ga0193744_10854942 | 3300019874 | Soil | MKLPPDVEFHEDIRLFVYRPRGSIDEAAINKITSVIEDLE |
| Ga0193722_11013593 | 3300019877 | Soil | MTLPPDIQFYHDIRLLIYRPRGLIDQAAINKITSVIEDL |
| Ga0193713_11023332 | 3300019882 | Soil | MILPPDIEFHQDIRLLIYRPKGLINEAEINRVIGVIEGIEAASQE |
| Ga0193725_11346802 | 3300019883 | Soil | MKLPPDIEFHQDIRLLIYRPKGLINEAEINRVIGVIEGIEAGTQEPFN |
| Ga0193735_11406222 | 3300020006 | Soil | MKLASDVEFHEDIRLLIYRPRGLIDEPAIKKVASVLE |
| Ga0126371_107097192 | 3300021560 | Tropical Forest Soil | MKLAPHLEFHEDVRLLVWRPLGLLDDAALNKVLNALEDLE |
| Ga0137417_13577141 | 3300024330 | Vadose Zone Soil | MKLPPEVEFHQDIPLLIYRPRGLIGEVALNNVISVIEELEAATQEPLIDSPIAGSR |
| Ga0207684_105179893 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLPPDVQFHADIRLLVYRPRGLIDEAAINKVISVIEDL |
| Ga0207701_110542551 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLSPDIEFHQDIRLLIYRPKGVINEAEINRVIGVI |
| Ga0207701_110676321 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLPPDIEFHQDIRLLIYRPKGVINEAEINRVIGVI |
| Ga0207670_104257161 | 3300025936 | Switchgrass Rhizosphere | MKGNPMKLPPEIEFHQDIRLLIYRPRGLIDETAINNT |
| Ga0207677_111468202 | 3300026023 | Miscanthus Rhizosphere | MKLPPEIEFHQDIRLLIYRPRGLIDETAINNTISVIEELEAAI |
| Ga0207702_123269921 | 3300026078 | Corn Rhizosphere | MKLPPDIEFHEDIRLLIYRPRGLVNEAAINKVLTALEDL |
| Ga0179587_107730982 | 3300026557 | Vadose Zone Soil | MKLPPDIEFHEDLRVLIYRPKGLINEAEINRVIGVIEGIEAASQQP |
| Ga0209488_104404423 | 3300027903 | Vadose Zone Soil | MKLLPEIEFHDDIRLLIYRPRGVLNEAAINKVLSAVEDLEAKLQEPF |
| Ga0307282_101559853 | 3300028784 | Soil | MKLPPDIQFHHDIRLLIYRPRGLIDQAAINKITSVIEDLEAAT |
| Ga0170834_1037675932 | 3300031057 | Forest Soil | MKLPPDIQFQEDIRLLLWRPRGLLNEPAINKILGALEDLEAKLQEPF |
| Ga0170824_1064243151 | 3300031231 | Forest Soil | MTPLPDIEFHEDVRLLIYRPRGLIDEAAVNKIISV |
| Ga0170824_1121516001 | 3300031231 | Forest Soil | MKLPPEIQFHQDIRLFVYRPHGLLNEAAFNKVLGALEDLEAKLQEPFNR |
| Ga0170820_133687601 | 3300031446 | Forest Soil | MKLPPEIEFHQDIRLLIYRPRGLIDEAAVNKIISVIEEIEAATQ |
| Ga0170820_178755141 | 3300031446 | Forest Soil | MTPLPDIEFHEDVRLLIYRPRGLIDEAAVNKIISVIEEIEA |
| Ga0307469_119828741 | 3300031720 | Hardwood Forest Soil | MNLPPDIEFHEDFRLLIYRPKGLINEAEINRVIGVIE |
| Ga0307468_1020636801 | 3300031740 | Hardwood Forest Soil | MKLLPEIEFHEDIRLLVYRPRGLIDETAVKKVISVLEDLEAK |
| Ga0307468_1022826971 | 3300031740 | Hardwood Forest Soil | MKLPPEVEFHEDIRLLIYRPKGLINEAEINRVIGVIEGI |
| Ga0306921_106576711 | 3300031912 | Soil | VKLSPEIEFHEDIRLLVWRPRGLLDEAAINKILSALEDLE |
| Ga0306921_111802093 | 3300031912 | Soil | MKLPPEIEFHEDIRLLIYRPRGLLNEAAINKVLSA |
| Ga0306921_115331121 | 3300031912 | Soil | MKLLPGIEFHEDIRLLIYKPHGLINEAAMNEVIGVIEDLEAKLQEPFNRFADTVAADEV |
| Ga0310916_104933862 | 3300031942 | Soil | MKLPPDIEFHEDIRLLIYRPKGLINEPEINRVIGIIEGIEAASQQPFN |
| Ga0310916_105184123 | 3300031942 | Soil | MNKMNLPADVQFYEDVRLLVWRPRGLIDDAAINKILSALEDLE |
| Ga0306926_100492935 | 3300031954 | Soil | VKLPPEIQFHEDIRLLVWRPRGLLDEAAINKILSALED |
| Ga0306926_105923844 | 3300031954 | Soil | MNLSPELEFHEDIRLLIYRPRGLVNEAALNKTLSALEDLEAKLEKPFDRF |
| Ga0306922_100396861 | 3300032001 | Soil | VKLPPEIQFHEDIRLLVWRPRGLLDEAAINKILSAL |
| Ga0306922_109151501 | 3300032001 | Soil | MKLPPEIEFHEDIRLLIYRPRGLIDEAEINRVIGVIEGIEA |
| Ga0306924_117250501 | 3300032076 | Soil | LYTHLYTQVKLSPEIEFHEDIRLLVWRPRGLLDEAAINKILS |
| Ga0306924_123919681 | 3300032076 | Soil | MKLPPDLEFHEDIRLLVYRPKAVINEAEINRVIGVI |
| Ga0307471_1003092623 | 3300032180 | Hardwood Forest Soil | MSSVVGMNKMKLSPDLEFDEDIRLLIYRPRGLLNEAAFNKVISAVENLEAKLQEPF |
| Ga0307472_1016371181 | 3300032205 | Hardwood Forest Soil | MKLPPDIEFHEDIRLLIYKPHGLIDEAAINEVIGVIEDLEAKLQAPFNRFADT |
| Ga0306920_1015507432 | 3300032261 | Soil | MKLPPDIEFHEDIRLLIYRPKGLINEPEINRVIGII |
| ⦗Top⦘ |