| Basic Information | |
|---|---|
| Family ID | F056128 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 138 |
| Average Sequence Length | 37 residues |
| Representative Sequence | EVEHKQGQISQQEYEKTKAALDQTLQRALKRESQKA |
| Number of Associated Samples | 126 |
| Number of Associated Scaffolds | 138 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.83 % |
| % of genes from short scaffolds (< 2000 bps) | 92.03 % |
| Associated GOLD sequencing projects | 121 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (83.333 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (13.043 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.087 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.377 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.06% β-sheet: 0.00% Coil/Unstructured: 60.94% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 138 Family Scaffolds |
|---|---|---|
| PF01435 | Peptidase_M48 | 36.96 |
| PF07726 | AAA_3 | 2.90 |
| PF01557 | FAA_hydrolase | 2.17 |
| PF03729 | DUF308 | 2.17 |
| PF01740 | STAS | 1.45 |
| PF13664 | DUF4149 | 1.45 |
| PF04794 | YdjC | 1.45 |
| PF13905 | Thioredoxin_8 | 1.45 |
| PF09862 | DUF2089 | 0.72 |
| PF04643 | Motilin_assoc | 0.72 |
| PF02954 | HTH_8 | 0.72 |
| PF03239 | FTR1 | 0.72 |
| PF02843 | GARS_C | 0.72 |
| PF16640 | Big_3_5 | 0.72 |
| PF07589 | PEP-CTERM | 0.72 |
| PF05580 | Peptidase_S55 | 0.72 |
| PF00069 | Pkinase | 0.72 |
| PF02518 | HATPase_c | 0.72 |
| PF13620 | CarboxypepD_reg | 0.72 |
| PF13305 | TetR_C_33 | 0.72 |
| PF00486 | Trans_reg_C | 0.72 |
| PF00027 | cNMP_binding | 0.72 |
| PF08532 | Glyco_hydro_42M | 0.72 |
| PF00696 | AA_kinase | 0.72 |
| PF05977 | MFS_3 | 0.72 |
| PF00873 | ACR_tran | 0.72 |
| PF13418 | Kelch_4 | 0.72 |
| PF03583 | LIP | 0.72 |
| COG ID | Name | Functional Category | % Frequency in 138 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.90 |
| COG3247 | Acid resistance membrane protein HdeD, DUF308 family | General function prediction only [R] | 2.17 |
| COG3394 | Chitooligosaccharide deacetylase ChbG, YdjC/CelG family | Carbohydrate transport and metabolism [G] | 1.45 |
| COG0151 | Phosphoribosylamine-glycine ligase | Nucleotide transport and metabolism [F] | 0.72 |
| COG1874 | Beta-galactosidase GanA | Carbohydrate transport and metabolism [G] | 0.72 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 83.33 % |
| Unclassified | root | N/A | 16.67 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001593|JGI12635J15846_10648673 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 611 | Open in IMG/M |
| 3300005187|Ga0066675_11353451 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 523 | Open in IMG/M |
| 3300005293|Ga0065715_10419192 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 860 | Open in IMG/M |
| 3300005436|Ga0070713_100213090 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1750 | Open in IMG/M |
| 3300005439|Ga0070711_101953662 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 516 | Open in IMG/M |
| 3300005446|Ga0066686_10472787 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300005534|Ga0070735_10135115 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1535 | Open in IMG/M |
| 3300005542|Ga0070732_10141339 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1431 | Open in IMG/M |
| 3300005542|Ga0070732_10399675 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 829 | Open in IMG/M |
| 3300005566|Ga0066693_10130156 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 932 | Open in IMG/M |
| 3300005615|Ga0070702_101164467 | Not Available | 619 | Open in IMG/M |
| 3300005841|Ga0068863_100034326 | All Organisms → cellular organisms → Bacteria | 4833 | Open in IMG/M |
| 3300005892|Ga0075275_1004826 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1757 | Open in IMG/M |
| 3300006047|Ga0075024_100487357 | Not Available | 644 | Open in IMG/M |
| 3300006057|Ga0075026_100528146 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 683 | Open in IMG/M |
| 3300006059|Ga0075017_100422584 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1002 | Open in IMG/M |
| 3300006059|Ga0075017_100555491 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 875 | Open in IMG/M |
| 3300006163|Ga0070715_10016180 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2796 | Open in IMG/M |
| 3300006175|Ga0070712_101559059 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 578 | Open in IMG/M |
| 3300006755|Ga0079222_11649444 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 611 | Open in IMG/M |
| 3300009038|Ga0099829_10732470 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300009089|Ga0099828_11422648 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300009137|Ga0066709_100407832 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1887 | Open in IMG/M |
| 3300009137|Ga0066709_101927043 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300009156|Ga0111538_12343033 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300009174|Ga0105241_12485213 | Not Available | 518 | Open in IMG/M |
| 3300009524|Ga0116225_1309215 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300009624|Ga0116105_1060414 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300009636|Ga0116112_1114511 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300009683|Ga0116224_10226880 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300009698|Ga0116216_10135467 | All Organisms → cellular organisms → Bacteria | 1515 | Open in IMG/M |
| 3300009839|Ga0116223_10549256 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300010043|Ga0126380_12045107 | Not Available | 525 | Open in IMG/M |
| 3300010046|Ga0126384_11177270 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 706 | Open in IMG/M |
| 3300010049|Ga0123356_13120211 | Not Available | 577 | Open in IMG/M |
| 3300010361|Ga0126378_11918309 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300010366|Ga0126379_11530947 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300010375|Ga0105239_12594262 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300010379|Ga0136449_100650832 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1781 | Open in IMG/M |
| 3300010379|Ga0136449_103916607 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300010401|Ga0134121_10410093 | Not Available | 1227 | Open in IMG/M |
| 3300011269|Ga0137392_11639958 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300011271|Ga0137393_11084337 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300012096|Ga0137389_10015397 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5235 | Open in IMG/M |
| 3300012096|Ga0137389_10316555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1323 | Open in IMG/M |
| 3300012096|Ga0137389_10616878 | Not Available | 932 | Open in IMG/M |
| 3300012189|Ga0137388_12034282 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 502 | Open in IMG/M |
| 3300012199|Ga0137383_10365159 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1058 | Open in IMG/M |
| 3300012356|Ga0137371_11427122 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300012357|Ga0137384_11068324 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300012361|Ga0137360_10781660 | Not Available | 821 | Open in IMG/M |
| 3300012917|Ga0137395_10331509 | Not Available | 1082 | Open in IMG/M |
| 3300012917|Ga0137395_10546047 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 836 | Open in IMG/M |
| 3300012975|Ga0134110_10297720 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300013105|Ga0157369_10914257 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300013296|Ga0157374_11021800 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 846 | Open in IMG/M |
| 3300013297|Ga0157378_10174267 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2020 | Open in IMG/M |
| 3300014167|Ga0181528_10122334 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1412 | Open in IMG/M |
| 3300014168|Ga0181534_10874013 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300014489|Ga0182018_10333856 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 819 | Open in IMG/M |
| 3300014495|Ga0182015_10954630 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300014657|Ga0181522_10471738 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 755 | Open in IMG/M |
| 3300015052|Ga0137411_1154770 | All Organisms → cellular organisms → Bacteria → FCB group | 1041 | Open in IMG/M |
| 3300015242|Ga0137412_10501336 | Not Available | 929 | Open in IMG/M |
| 3300015371|Ga0132258_12291670 | Not Available | 1354 | Open in IMG/M |
| 3300016357|Ga0182032_10368639 | All Organisms → cellular organisms → Bacteria | 1154 | Open in IMG/M |
| 3300017924|Ga0187820_1269584 | Not Available | 552 | Open in IMG/M |
| 3300017975|Ga0187782_10775950 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 741 | Open in IMG/M |
| 3300018005|Ga0187878_1044840 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella aggregans | 2034 | Open in IMG/M |
| 3300018057|Ga0187858_10881122 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 527 | Open in IMG/M |
| 3300018062|Ga0187784_10822842 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300018062|Ga0187784_10827020 | Not Available | 738 | Open in IMG/M |
| 3300018085|Ga0187772_10648604 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300018088|Ga0187771_10804746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 797 | Open in IMG/M |
| 3300018468|Ga0066662_12547160 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 540 | Open in IMG/M |
| 3300019890|Ga0193728_1061421 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1805 | Open in IMG/M |
| 3300020199|Ga0179592_10074893 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1551 | Open in IMG/M |
| 3300020580|Ga0210403_11362377 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300020581|Ga0210399_11099757 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 636 | Open in IMG/M |
| 3300021171|Ga0210405_10119902 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2078 | Open in IMG/M |
| 3300021178|Ga0210408_10672582 | Not Available | 817 | Open in IMG/M |
| 3300021401|Ga0210393_10002885 | All Organisms → cellular organisms → Bacteria | 14006 | Open in IMG/M |
| 3300021403|Ga0210397_10991722 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300021407|Ga0210383_10782557 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 817 | Open in IMG/M |
| 3300021420|Ga0210394_11650087 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300021474|Ga0210390_10477385 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1051 | Open in IMG/M |
| 3300021475|Ga0210392_11200310 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
| 3300021478|Ga0210402_11370356 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 634 | Open in IMG/M |
| 3300021478|Ga0210402_11457579 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300021860|Ga0213851_1322969 | Not Available | 549 | Open in IMG/M |
| 3300022532|Ga0242655_10212989 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
| 3300025321|Ga0207656_10128285 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1186 | Open in IMG/M |
| 3300025454|Ga0208039_1091874 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300025576|Ga0208820_1113783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 646 | Open in IMG/M |
| 3300025945|Ga0207679_10779025 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300026322|Ga0209687_1210940 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300026480|Ga0257177_1078288 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300027439|Ga0209332_1081439 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300027629|Ga0209422_1085462 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300027727|Ga0209328_10033191 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1587 | Open in IMG/M |
| 3300027745|Ga0209908_10122342 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 663 | Open in IMG/M |
| 3300027821|Ga0209811_10300123 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 618 | Open in IMG/M |
| 3300027842|Ga0209580_10252456 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 877 | Open in IMG/M |
| 3300027853|Ga0209274_10135372 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1234 | Open in IMG/M |
| 3300027855|Ga0209693_10265183 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300027867|Ga0209167_10735440 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300027869|Ga0209579_10688295 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300027875|Ga0209283_10059265 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2452 | Open in IMG/M |
| 3300027879|Ga0209169_10455034 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 673 | Open in IMG/M |
| 3300027898|Ga0209067_10871765 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 528 | Open in IMG/M |
| 3300027986|Ga0209168_10502974 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 585 | Open in IMG/M |
| 3300028047|Ga0209526_10311313 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
| 3300028047|Ga0209526_10591552 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300029889|Ga0246001_1004453 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5957 | Open in IMG/M |
| 3300030054|Ga0302182_10184278 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300030659|Ga0316363_10276265 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300030760|Ga0265762_1021720 | Not Available | 1185 | Open in IMG/M |
| 3300031057|Ga0170834_112272637 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300031090|Ga0265760_10069583 | Not Available | 1078 | Open in IMG/M |
| 3300031680|Ga0318574_10890078 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300031715|Ga0307476_10959990 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 630 | Open in IMG/M |
| 3300031754|Ga0307475_10146783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1871 | Open in IMG/M |
| 3300031823|Ga0307478_10773138 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 804 | Open in IMG/M |
| 3300031823|Ga0307478_11365086 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300031833|Ga0310917_10651944 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300031893|Ga0318536_10710064 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300031918|Ga0311367_12287440 | Not Available | 517 | Open in IMG/M |
| 3300032160|Ga0311301_10002240 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 73343 | Open in IMG/M |
| 3300032515|Ga0348332_12188200 | Not Available | 1265 | Open in IMG/M |
| 3300032770|Ga0335085_10301794 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1897 | Open in IMG/M |
| 3300032782|Ga0335082_10099148 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2891 | Open in IMG/M |
| 3300032783|Ga0335079_10462491 | Not Available | 1358 | Open in IMG/M |
| 3300032892|Ga0335081_12027276 | Not Available | 613 | Open in IMG/M |
| 3300032898|Ga0335072_10611608 | Not Available | 1092 | Open in IMG/M |
| 3300032898|Ga0335072_11068838 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300033004|Ga0335084_10813872 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 948 | Open in IMG/M |
| 3300033561|Ga0371490_1121365 | Not Available | 672 | Open in IMG/M |
| 3300033829|Ga0334854_021037 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1580 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.04% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.32% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 5.80% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.80% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.07% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.35% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.62% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.62% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.62% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.90% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.90% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.90% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.17% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.17% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.17% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.45% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 1.45% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.45% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.45% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.72% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.72% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.72% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.72% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.72% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.72% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.72% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.72% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.72% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.72% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.72% |
| Peat | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat | 0.72% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.72% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.72% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.72% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.72% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.72% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.72% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005892 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_305 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009636 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Host-Associated | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018005 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_150 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025454 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025576 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026480 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-B | Environmental | Open in IMG/M |
| 3300027439 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300029889 | Peat microbial communities from Marcell Experimental Forest bog in Minnesota, USA - MG_T3F_30cm | Environmental | Open in IMG/M |
| 3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033561 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB28FN SIP fraction | Environmental | Open in IMG/M |
| 3300033829 | Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12635J15846_106486731 | 3300001593 | Forest Soil | QLEVDRQQGNISQQEYDKHRAALDQTLERALKREAQKA* |
| Ga0066675_113534511 | 3300005187 | Soil | KDEMFQLEVEHKQGLMSQQEYEQARAALDQTLARAIRRAALK* |
| Ga0065715_104191922 | 3300005293 | Miscanthus Rhizosphere | DELFQLEVEHKQGDISQQEYERARAALEQTLERALKRSAVK* |
| Ga0070713_1002130904 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | FELEVEHKQGRISQEEYEKTKAALDQTLQRALSRESQKA* |
| Ga0070711_1019536621 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | FQLEVERQQGSITQQEYEKHKAALDQTLQRAISRTAQRV* |
| Ga0066686_104727872 | 3300005446 | Soil | LEVEHKQGHISQQEYEKAKAALDQTLERALKRNAARTSA* |
| Ga0070735_101351152 | 3300005534 | Surface Soil | FELEVEHKQGRISQQEYEQTKAALDQTLQRALKRENQKA* |
| Ga0070732_101413393 | 3300005542 | Surface Soil | LEVEHKQGKITQQEYEKAKAALDGTLERAIKRESQKV* |
| Ga0070732_103996752 | 3300005542 | Surface Soil | LEVEHKQGRISQQEYEKTKSALDQTLQRALKREAQRT* |
| Ga0066693_101301561 | 3300005566 | Soil | EHKQGQISQQEYEKTKAALDQTLQRALKRESQKA* |
| Ga0070702_1011644671 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | FQLEIERQQGQISQQEYETQKAALDQTLKRALARTARNS* |
| Ga0068863_1000343266 | 3300005841 | Switchgrass Rhizosphere | LFQLEMEHKQGSISQEEYAKAKTALDQTLERALKRKPMA* |
| Ga0075275_10048263 | 3300005892 | Rice Paddy Soil | LEIERQQGAISQEEYEKHKSALDQTLQRALSRAGKG* |
| Ga0075024_1004873572 | 3300006047 | Watersheds | EHKQGKITQQEYEKAKAALDGTLERAIKRDAQNV* |
| Ga0075026_1005281462 | 3300006057 | Watersheds | EVEHKQGSISHQEYERARAALDQTLERALKRAAVK* |
| Ga0075017_1004225841 | 3300006059 | Watersheds | HKQGRISQQEYEKTKSALDQTLQRALKREAAKQV* |
| Ga0075017_1005554911 | 3300006059 | Watersheds | EMFQLELERRTGKITQSEYEKTKAALDQTLDRALKRQG* |
| Ga0070715_100161801 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | EVEHKQGGISQEEYDRARAALDQTLERALKRTASK* |
| Ga0070712_1015590591 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | EVEHKQGKITQQEYEKAKAALDATLERAIKRESQKV* |
| Ga0079222_116494441 | 3300006755 | Agricultural Soil | DELFQLEVEHKQGSISQQEYEQARAALDQTLDRALKRAVK* |
| Ga0099829_107324702 | 3300009038 | Vadose Zone Soil | QLEVEHTQGQITDQEYAKTKSALDQTLARAIKRSR* |
| Ga0099828_114226483 | 3300009089 | Vadose Zone Soil | FQLEVDRKQGNISPQEYEKHRAALEQTLERALKREAQKT* |
| Ga0066709_1004078323 | 3300009137 | Grasslands Soil | QLEVERKQGNISPQEYEKHRAALDQTLERALKREAQKA* |
| Ga0066709_1019270431 | 3300009137 | Grasslands Soil | LEVEHKQGRISQQEYEKARAALDQTLERAIKRESQKTK* |
| Ga0111538_123430331 | 3300009156 | Populus Rhizosphere | ELEVERKQGRLSQEEYDKARSALDHTLERALKRQS* |
| Ga0105241_124852131 | 3300009174 | Corn Rhizosphere | EVEHKQGQISQQEYEKTKAALDQTLQRALKRESQKA* |
| Ga0116225_13092151 | 3300009524 | Peatlands Soil | QLEVEHKQGRISQQEYEKTKAALDQTLQRALKRATQKT* |
| Ga0116105_10604142 | 3300009624 | Peatland | EVERKQGQISQAEYDTAKSALDQTLERALKREAQKA* |
| Ga0116112_11145112 | 3300009636 | Peatland | EVERKQGQISQADYEKAKSALDQTLDRALKREAQKA* |
| Ga0116224_102268802 | 3300009683 | Peatlands Soil | FHLEVERQQGRISHQEYETAKSALDQTLQRALKREAQKA* |
| Ga0116216_101354671 | 3300009698 | Peatlands Soil | LEVERQQGRISHQEYETAKSALDQTLQRALKREAQKA* |
| Ga0116223_105492561 | 3300009839 | Peatlands Soil | EVEHKQGRISQQEYEKTKAALDQTLQRALKRATQKT* |
| Ga0126380_120451071 | 3300010043 | Tropical Forest Soil | VEHKQGRISQQEYETTKAALDQTLQRALKRESQRA* |
| Ga0126384_111772701 | 3300010046 | Tropical Forest Soil | ELEVERKQGKITDEEYEKARAALDYALDRALKRESVSQS* |
| Ga0123356_131202111 | 3300010049 | Termite Gut | EHKQGRISREEYDKAKAALDQTLEHALKREAAKQS* |
| Ga0126378_119183092 | 3300010361 | Tropical Forest Soil | EHKRGSISQQEYDKAKAALDQTLERALKRETQKA* |
| Ga0126379_115309472 | 3300010366 | Tropical Forest Soil | EHKQGHISQQEYEKAKAALDQTLQRALKREAARQT* |
| Ga0105239_125942622 | 3300010375 | Corn Rhizosphere | ELFQLELEHKQGKISDEEYAKTKSALDQTLARALKRNG* |
| Ga0136449_1006508321 | 3300010379 | Peatlands Soil | LEMEHKLGKITQQEYEKAKAALDQTLERALKRAK* |
| Ga0136449_1039166072 | 3300010379 | Peatlands Soil | FQLEVEHKQGRISQQEYEKAKAALDQTLERAVKRGVVKVS* |
| Ga0134121_104100931 | 3300010401 | Terrestrial Soil | ELFQLELEHKQARISDEDYAKTKAALDQTLARALKRSS* |
| Ga0137392_116399581 | 3300011269 | Vadose Zone Soil | EVEHTQGDISQQEYERARAALDQTLERALKRAALK* |
| Ga0137393_110843372 | 3300011271 | Vadose Zone Soil | VERRQGQISQPEYEKAKSALDQTLERALKREAQKA* |
| Ga0137389_100153977 | 3300012096 | Vadose Zone Soil | LLQLEVERKEDRVSRQEYERARAALDETLERAIKRARPK* |
| Ga0137389_103165551 | 3300012096 | Vadose Zone Soil | VERKQAQISEAEYQKAKAALDQTLARALKREAQQA* |
| Ga0137389_106168781 | 3300012096 | Vadose Zone Soil | KQGHLSQEEYEKAKSALDQTLERALKREATAKQT* |
| Ga0137388_120342821 | 3300012189 | Vadose Zone Soil | LEVERRQGQISQSEYEKAKSALDQTLERALKREAQKA* |
| Ga0137383_103651591 | 3300012199 | Vadose Zone Soil | EVEHKQGRISQEEYEKSKAALDQTLERALKRKSSTSAM* |
| Ga0137371_114271222 | 3300012356 | Vadose Zone Soil | LEVERKQGNISPQEYEKHRAALDQTLERALKREAQKA* |
| Ga0137384_110683242 | 3300012357 | Vadose Zone Soil | FQLEVEHKQGRISQEEYESAKSALDQTVQRALKREAQKA* |
| Ga0137360_107816602 | 3300012361 | Vadose Zone Soil | EVEHKQGKITQQEYEKAKAALDGTLERAIKREAQKV* |
| Ga0137395_103315091 | 3300012917 | Vadose Zone Soil | IFQLEMEHKQGQVSDQEYSKAKAALDQTLARAVKRNR* |
| Ga0137395_105460471 | 3300012917 | Vadose Zone Soil | EVERRQGQISQAEYEKAKSALDQTLERALKREAQRA* |
| Ga0134110_102977202 | 3300012975 | Grasslands Soil | LEVEHKQGLMSQQEYEQARAALDQTLARAIRRAALK* |
| Ga0157369_109142572 | 3300013105 | Corn Rhizosphere | ERQQGQISAEEYEKQKSALDQTLKRALARVAKNS* |
| Ga0157374_110218001 | 3300013296 | Miscanthus Rhizosphere | LFQLEVERKQGKLSQEEYDKARNALDHTLERALKRQA* |
| Ga0157378_101742673 | 3300013297 | Miscanthus Rhizosphere | FQLEVEHKQGGISQQEYEKAKAALDQTLERALKRAALK* |
| Ga0181528_101223341 | 3300014167 | Bog | LEIERRQGKITPEDYEKAKAALDQTLDRALKRQS* |
| Ga0181534_108740132 | 3300014168 | Bog | ERKQGLISQAEYEKAKSALDQTLDRALKREAQKA* |
| Ga0182018_103338561 | 3300014489 | Palsa | QLEVEHKQGRISQQEYEKAKAALDQTLERAVKRTAVKVS* |
| Ga0182015_109546302 | 3300014495 | Palsa | EVEHKQGSISQPEYEKARAALDQTLDRAIKRDSQKK* |
| Ga0181522_104717381 | 3300014657 | Bog | QLEVERKQGKITPAEYEKARAALDQTLDRALKRQQG* |
| Ga0137411_11547701 | 3300015052 | Vadose Zone Soil | ISQSEYEKAKSALDQTLERALSEARGAEGVKVSTI* |
| Ga0137412_105013361 | 3300015242 | Vadose Zone Soil | ERKQGQISQAEYDRAKAALDQTLERALKREAQRA* |
| Ga0132258_122916701 | 3300015371 | Arabidopsis Rhizosphere | VEHKQGRISQQEYESAKSALDQTLQRALKREAQKA* |
| Ga0182032_103686392 | 3300016357 | Soil | EVEHKQGRISQQEYDKTKAALDQTLQRALKREAQKQT |
| Ga0187820_12695841 | 3300017924 | Freshwater Sediment | IEHKQGRITQQEYEKTKAALDHTLERALKRENQRA |
| Ga0187782_107759501 | 3300017975 | Tropical Peatland | VDRKQGEITQAEYDQAKAALDQTLERALRRQAQKA |
| Ga0187878_10448403 | 3300018005 | Peatland | EIERQQGLISQQDYEKQKAALDQTLQVALARRRTA |
| Ga0187858_108811222 | 3300018057 | Peatland | QLEVERRQGQISQAEYENAKSAMDKTLERALKREAQKA |
| Ga0187784_108228421 | 3300018062 | Tropical Peatland | QLEIERKQGKISAEDYEKAKAALDQTLDRALKRQV |
| Ga0187784_108270202 | 3300018062 | Tropical Peatland | LFQLEVELKQGKITQADYDKAKSALDQTLERALKRLG |
| Ga0187772_106486041 | 3300018085 | Tropical Peatland | EHKQGRISQQEYEKAKAALDQTLERALKREGRASSAVR |
| Ga0187771_108047461 | 3300018088 | Tropical Peatland | EHKQGRISQAEYEKAKAALDQTLERAVKRGTTKAG |
| Ga0066662_125471602 | 3300018468 | Grasslands Soil | FQLEVEHKQGRISQQEYESAKAALDQTLQRALKREAQKTS |
| Ga0193728_10614211 | 3300019890 | Soil | EVERRQGQISQAEYEKAKSALDQTLERALKREAQRA |
| Ga0179592_100748933 | 3300020199 | Vadose Zone Soil | LEIDRHQGAISPEEYKTTKAALDQTLARAIQRESRKS |
| Ga0210403_113623771 | 3300020580 | Soil | EHKQGRISQQEYEKAKAALDQTLERAVKRGAVKVS |
| Ga0210399_110997571 | 3300020581 | Soil | QLEVEHKQGKITQAEYDKTKAALDQTLERALKRQG |
| Ga0210405_101199023 | 3300021171 | Soil | VQLEVEHKQGRISQQEYDSAKSALDQTLQRALKREAQKA |
| Ga0210408_106725822 | 3300021178 | Soil | LEVEHKQGRITQAEYDKAKAALDQTLERAIKRGAVKTS |
| Ga0210393_1000288510 | 3300021401 | Soil | LFQLEVEHKQGQISQQEYEKTKAALDQTLQHALKREAQKA |
| Ga0210397_109917221 | 3300021403 | Soil | LEVEHKQGGISQQEYEKARAALDQTLERALKRAALK |
| Ga0210383_107825571 | 3300021407 | Soil | IFQLEVEHKQGRISQQEYEKAKAALDQTLERAVKRGAVKVG |
| Ga0210394_116500871 | 3300021420 | Soil | LFDLEVEHKQGRISQQEYEKTKAALDQTLQHALRRESQKA |
| Ga0210390_104773851 | 3300021474 | Soil | QLEVERRQGQISQSEYESAKSALDQTLDRALKREAQKA |
| Ga0210392_112003101 | 3300021475 | Soil | LEVEHKQGRISQQEYEKAKAALDQTLERAVKRGAVKVG |
| Ga0210402_113703561 | 3300021478 | Soil | FQLEVEKKQGKITPEDYEKARAALDQTLDRALKRQG |
| Ga0210402_114575791 | 3300021478 | Soil | FQLEVEHKQGRISQPEYEKVKAALDQTLERALARSAPK |
| Ga0213851_13229691 | 3300021860 | Watersheds | QLEVEHKQGSISQQEYEKTKAALDQTLERALKREAAKQT |
| Ga0242655_102129891 | 3300022532 | Soil | ELFDLEVEHKQGRISQQEYEMTKAALDQTLQRALKREAQRT |
| Ga0207656_101282851 | 3300025321 | Corn Rhizosphere | QLEVERQQGSITQQEYEKHKAALDQTLQRAISRTAQKV |
| Ga0208039_10918741 | 3300025454 | Peatland | LEVERKQGLISQAEYEKAKSALDQTLDRALKREAQKA |
| Ga0208820_11137832 | 3300025576 | Peatland | FQLEIERQQGVITQEDYEKQKAALDQTLKRALARTRRDNV |
| Ga0207679_107790251 | 3300025945 | Corn Rhizosphere | QLEMEHKQGSISQEEYAKAKTALDQTLERALKRKPMA |
| Ga0209687_12109401 | 3300026322 | Soil | LDRKQGRITPEEYAKTKTALDQTLDHALKRESQKV |
| Ga0257177_10782881 | 3300026480 | Soil | FQLEVEHTQGDISQQEYERARAALDQTLERALKRAALK |
| Ga0209332_10814391 | 3300027439 | Forest Soil | FQLEVERRQGQISQAEYEKAKSALDQTLERALKREAQRA |
| Ga0209422_10854621 | 3300027629 | Forest Soil | IEHKQGRISQQEYEKTKSALDQTLQRALKREAQKA |
| Ga0209328_100331911 | 3300027727 | Forest Soil | LFQLEVEHKQGRILQPEYERARAALDQTLDRAIKRAPRK |
| Ga0209908_101223422 | 3300027745 | Thawing Permafrost | FQLEVERNQGQISQSEYEKAKSALDQTLERALRREAQKA |
| Ga0209811_103001231 | 3300027821 | Surface Soil | LFELEIEHKQGRISQQEYESAKAALDQTLQRALKRESQKA |
| Ga0209580_102524561 | 3300027842 | Surface Soil | LKDEIFELEIEHKQGRITQQEYEKTKSALDQTLQRALKREAQKA |
| Ga0209274_101353721 | 3300027853 | Soil | VEHKQGRISQLEYESAKAALDQTLQRALKRVAPKA |
| Ga0209693_102651831 | 3300027855 | Soil | QLEMEHKQGKISQQEYEKAKAALDGTLERALKRDAQRN |
| Ga0209167_107354401 | 3300027867 | Surface Soil | LFQLEVEHKQGHISQQEYEKTKAALDQTLQHALKREAQKA |
| Ga0209579_106882952 | 3300027869 | Surface Soil | DLEVEHKQGRISQQEYETTKAALDQTLQRALKRESQKA |
| Ga0209283_100592651 | 3300027875 | Vadose Zone Soil | LEVEHKQGGISRQEYERARAALDQTLERALKRAALK |
| Ga0209169_104550341 | 3300027879 | Soil | QLEVEHKQGRITQQEYEKAKAALDQTLERAVKRGAVKVG |
| Ga0209067_108717651 | 3300027898 | Watersheds | DELFDLEVEHKQGLISQQEYEKTKAALDQTLQRALKREAQRT |
| Ga0209168_105029742 | 3300027986 | Surface Soil | LFQLEVERRQGQISQAEYEKAKSALDQTLERALKREATKV |
| Ga0209526_103113132 | 3300028047 | Forest Soil | QLEVERRQGQISQSEYEKAKSALDQTLERALKREAQKA |
| Ga0209526_105915522 | 3300028047 | Forest Soil | KEEIFELEVEHKQGRISQQEYESAKSALDQTLQRALKREGARQT |
| Ga0246001_10044531 | 3300029889 | Peat | EVERKQGQISQADYERAKSALDQTLDRALKREAQKA |
| Ga0302182_101842781 | 3300030054 | Palsa | LEVERRQGQISQSEYESAKSALDQTLDRALKREAQKA |
| Ga0316363_102762652 | 3300030659 | Peatlands Soil | EVEHKQGRISQQEYEKTKAALDQTLQRALKRATQKT |
| Ga0265762_10217202 | 3300030760 | Soil | VEHKQGRISQQEYEKAKAALDQTLERALKRSAVKVS |
| Ga0170834_1122726372 | 3300031057 | Forest Soil | FQLEVDHTQGRITQQEYDSAKSALDQTLQRALKREAQKA |
| Ga0265760_100695832 | 3300031090 | Soil | FQLEVEHKQGQISQQEYEKTKAALDQTLQHALKREAQKA |
| Ga0318574_108900781 | 3300031680 | Soil | VEHKQGKISQQEYEKAKAALDGTLERAIKRDAQQN |
| Ga0307476_109599902 | 3300031715 | Hardwood Forest Soil | LEVERRQGQISQAEYEKAKSALDQTLERALKREAQRG |
| Ga0307475_101467833 | 3300031754 | Hardwood Forest Soil | LEVERKQGKITPADYEKARAALDQTLERALKRQQG |
| Ga0307478_107731381 | 3300031823 | Hardwood Forest Soil | EIFQLEVEHKQGRISQQEYDSAKSALDQTLQRALKREAQKA |
| Ga0307478_113650861 | 3300031823 | Hardwood Forest Soil | QLEIEHQQGQISDPEYAKAKSALDQTLSRAIKRKG |
| Ga0310917_106519441 | 3300031833 | Soil | FQLELEHKQGRISQQEYEKAKSALDQTLERALRRTTSKTT |
| Ga0318536_107100642 | 3300031893 | Soil | QLEVEHKQGKISQQEYEKAKAALDGTLERAIKRDAQQN |
| Ga0311367_122874403 | 3300031918 | Fen | ELELERKQGKISPPDYEKARAALDQTLDRALKRKA |
| Ga0311301_100022401 | 3300032160 | Peatlands Soil | VEHKQGRISQQEYEKAKAALDQTLERAVKRGAIKVTS |
| Ga0348332_121882002 | 3300032515 | Plant Litter | FQLEVEHKQGRISQQEYEKAKAALDQTLERAVKRGAVKVS |
| Ga0335085_103017944 | 3300032770 | Soil | QLEVEHKQGRISQAEYEKAKSALDQTLERAIKRVGKS |
| Ga0335082_100991481 | 3300032782 | Soil | VEHKQGRISQQEYEKAKTALDQTLERALKRTMAKAT |
| Ga0335079_104624911 | 3300032783 | Soil | LEVEHKQGRISQQEYEKAKAALDQTLERAVKRGTAKVT |
| Ga0335081_120272761 | 3300032892 | Soil | EVERQQGRISDAEYQSTKSALDQTLLRALARAKGTAHS |
| Ga0335072_106116081 | 3300032898 | Soil | EHKRGEISQQEYEKAKSALDQTLQRALKRDAARPV |
| Ga0335072_110688382 | 3300032898 | Soil | IERKQGKISADDYEKAKAALDQTLDRALRRSGLSS |
| Ga0335084_108138723 | 3300033004 | Soil | QLEIEKEQGKISAEDYESTKAALNQTLRRALQRKNS |
| Ga0371490_11213651 | 3300033561 | Peat Soil | QLEVERKQGLISQAEYEKAKSALDQTLDRALKREAQKA |
| Ga0334854_021037_1458_1580 | 3300033829 | Soil | LFQLEVERRQGQISQSEYESAKSALDQTLDRALKREAQKA |
| ⦗Top⦘ |