| Basic Information | |
|---|---|
| Family ID | F056109 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 138 |
| Average Sequence Length | 50 residues |
| Representative Sequence | MKTKNMRELEKMWAKKAVEQSNPQQKGGAPTRQTVTHAPRTARKSSRGR |
| Number of Associated Samples | 103 |
| Number of Associated Scaffolds | 138 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 8.70 % |
| % of genes near scaffold ends (potentially truncated) | 25.36 % |
| % of genes from short scaffolds (< 2000 bps) | 87.68 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.29 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (85.507 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere (19.565 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.536 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (50.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.38% β-sheet: 0.00% Coil/Unstructured: 76.62% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.29 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 138 Family Scaffolds |
|---|---|---|
| PF05532 | CsbD | 33.33 |
| PF01968 | Hydantoinase_A | 9.42 |
| PF05378 | Hydant_A_N | 4.35 |
| PF09243 | Rsm22 | 1.45 |
| PF13426 | PAS_9 | 1.45 |
| PF00800 | PDT | 1.45 |
| PF00005 | ABC_tran | 1.45 |
| PF13807 | GNVR | 0.72 |
| PF02190 | LON_substr_bdg | 0.72 |
| COG ID | Name | Functional Category | % Frequency in 138 Family Scaffolds |
|---|---|---|---|
| COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 33.33 |
| COG0145 | N-methylhydantoinase A/oxoprolinase/acetone carboxylase, beta subunit | Amino acid transport and metabolism [E] | 8.70 |
| COG0077 | Prephenate dehydratase | Amino acid transport and metabolism [E] | 1.45 |
| COG5459 | Ribosomal protein RSM22 (predicted mitochondrial rRNA methylase) | Translation, ribosomal structure and biogenesis [J] | 1.45 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 85.51 % |
| Unclassified | root | N/A | 14.49 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459010|GIO7OMY01BOJN7 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300001305|C688J14111_10004548 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3809 | Open in IMG/M |
| 3300002568|C688J35102_120861729 | Not Available | 1872 | Open in IMG/M |
| 3300002906|JGI25614J43888_10034785 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1578 | Open in IMG/M |
| 3300002914|JGI25617J43924_10098324 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1049 | Open in IMG/M |
| 3300005167|Ga0066672_10937146 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300005338|Ga0068868_100628586 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
| 3300005344|Ga0070661_101870929 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
| 3300005345|Ga0070692_10544708 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 759 | Open in IMG/M |
| 3300005434|Ga0070709_10133123 | All Organisms → cellular organisms → Bacteria | 1699 | Open in IMG/M |
| 3300005434|Ga0070709_11024385 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 657 | Open in IMG/M |
| 3300005434|Ga0070709_11088803 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
| 3300005434|Ga0070709_11504878 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300005435|Ga0070714_100376636 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1337 | Open in IMG/M |
| 3300005435|Ga0070714_100605323 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1052 | Open in IMG/M |
| 3300005436|Ga0070713_100050672 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3430 | Open in IMG/M |
| 3300005436|Ga0070713_100092948 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2598 | Open in IMG/M |
| 3300005436|Ga0070713_100668116 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
| 3300005436|Ga0070713_102123648 | Not Available | 544 | Open in IMG/M |
| 3300005437|Ga0070710_10357259 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 969 | Open in IMG/M |
| 3300005437|Ga0070710_11338023 | Not Available | 534 | Open in IMG/M |
| 3300005439|Ga0070711_100034375 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3381 | Open in IMG/M |
| 3300005439|Ga0070711_101221454 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300005439|Ga0070711_101567634 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
| 3300005458|Ga0070681_10506289 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1121 | Open in IMG/M |
| 3300005458|Ga0070681_11719061 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
| 3300005458|Ga0070681_11940453 | Not Available | 516 | Open in IMG/M |
| 3300005518|Ga0070699_100378973 | All Organisms → cellular organisms → Bacteria | 1277 | Open in IMG/M |
| 3300005533|Ga0070734_10001159 | All Organisms → cellular organisms → Bacteria | 41254 | Open in IMG/M |
| 3300005533|Ga0070734_10299821 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 919 | Open in IMG/M |
| 3300005542|Ga0070732_10023629 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3474 | Open in IMG/M |
| 3300005542|Ga0070732_10025928 | All Organisms → cellular organisms → Bacteria | 3322 | Open in IMG/M |
| 3300005542|Ga0070732_11034969 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300005575|Ga0066702_10391191 | Not Available | 847 | Open in IMG/M |
| 3300005575|Ga0066702_10686650 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 611 | Open in IMG/M |
| 3300005587|Ga0066654_10196125 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1047 | Open in IMG/M |
| 3300005614|Ga0068856_102607865 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300005712|Ga0070764_11114935 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300006028|Ga0070717_10271134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 1503 | Open in IMG/M |
| 3300006028|Ga0070717_10767300 | Not Available | 877 | Open in IMG/M |
| 3300006041|Ga0075023_100057956 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1234 | Open in IMG/M |
| 3300006050|Ga0075028_100299831 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300006163|Ga0070715_10343550 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300006175|Ga0070712_101233975 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300006903|Ga0075426_10173648 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1559 | Open in IMG/M |
| 3300006914|Ga0075436_101429762 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300006954|Ga0079219_10336402 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 960 | Open in IMG/M |
| 3300006954|Ga0079219_10416874 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 899 | Open in IMG/M |
| 3300006954|Ga0079219_12088596 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300009088|Ga0099830_10722845 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300009093|Ga0105240_10094521 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3646 | Open in IMG/M |
| 3300009093|Ga0105240_11254826 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300009098|Ga0105245_11765033 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 671 | Open in IMG/M |
| 3300009551|Ga0105238_10247865 | All Organisms → cellular organisms → Bacteria | 1759 | Open in IMG/M |
| 3300010359|Ga0126376_11321618 | Not Available | 742 | Open in IMG/M |
| 3300010359|Ga0126376_13267096 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300010371|Ga0134125_11026441 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300010373|Ga0134128_10544894 | All Organisms → cellular organisms → Bacteria | 1293 | Open in IMG/M |
| 3300010373|Ga0134128_11261156 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300010373|Ga0134128_13182231 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300010375|Ga0105239_11003251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 960 | Open in IMG/M |
| 3300010375|Ga0105239_13021641 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300010376|Ga0126381_101871238 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 866 | Open in IMG/M |
| 3300010396|Ga0134126_10653462 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1199 | Open in IMG/M |
| 3300010398|Ga0126383_10642399 | Not Available | 1136 | Open in IMG/M |
| 3300010399|Ga0134127_10998974 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 897 | Open in IMG/M |
| 3300012205|Ga0137362_11426147 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
| 3300012206|Ga0137380_11113594 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 672 | Open in IMG/M |
| 3300012212|Ga0150985_107664669 | All Organisms → cellular organisms → Bacteria | 1228 | Open in IMG/M |
| 3300012363|Ga0137390_10437538 | All Organisms → cellular organisms → Bacteria → PVC group → Chlamydiae → Chlamydiia → Parachlamydiales → Parachlamydiaceae → Parachlamydia → unclassified Parachlamydia → Parachlamydia sp. C2 | 1284 | Open in IMG/M |
| 3300012683|Ga0137398_10129791 | All Organisms → cellular organisms → Bacteria | 1618 | Open in IMG/M |
| 3300012685|Ga0137397_10949331 | Not Available | 636 | Open in IMG/M |
| 3300012917|Ga0137395_10002548 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 8816 | Open in IMG/M |
| 3300012925|Ga0137419_11648275 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300012929|Ga0137404_10361486 | All Organisms → cellular organisms → Bacteria | 1273 | Open in IMG/M |
| 3300012931|Ga0153915_10196270 | All Organisms → cellular organisms → Bacteria | 2212 | Open in IMG/M |
| 3300012955|Ga0164298_10031381 | All Organisms → cellular organisms → Bacteria | 2391 | Open in IMG/M |
| 3300012957|Ga0164303_11296217 | Not Available | 539 | Open in IMG/M |
| 3300012960|Ga0164301_10175354 | All Organisms → cellular organisms → Bacteria | 1340 | Open in IMG/M |
| 3300012984|Ga0164309_10337980 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
| 3300012984|Ga0164309_11104724 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
| 3300012985|Ga0164308_10289378 | All Organisms → cellular organisms → Bacteria | 1296 | Open in IMG/M |
| 3300012985|Ga0164308_11719330 | Not Available | 582 | Open in IMG/M |
| 3300012986|Ga0164304_11746926 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300012988|Ga0164306_10062408 | All Organisms → cellular organisms → Bacteria | 2302 | Open in IMG/M |
| 3300012988|Ga0164306_11114626 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 657 | Open in IMG/M |
| 3300013296|Ga0157374_12025893 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 602 | Open in IMG/M |
| 3300013297|Ga0157378_10178561 | Not Available | 1996 | Open in IMG/M |
| 3300015242|Ga0137412_10423208 | All Organisms → cellular organisms → Bacteria | 1028 | Open in IMG/M |
| 3300018431|Ga0066655_10950360 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 591 | Open in IMG/M |
| 3300018431|Ga0066655_11033283 | Not Available | 570 | Open in IMG/M |
| 3300019999|Ga0193718_1012349 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1879 | Open in IMG/M |
| 3300020077|Ga0206351_10993430 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300020579|Ga0210407_10276107 | All Organisms → cellular organisms → Bacteria | 1311 | Open in IMG/M |
| 3300021170|Ga0210400_10049635 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 3266 | Open in IMG/M |
| 3300021403|Ga0210397_10123173 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1781 | Open in IMG/M |
| 3300021404|Ga0210389_10978650 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 657 | Open in IMG/M |
| 3300021432|Ga0210384_10000291 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 78913 | Open in IMG/M |
| 3300021445|Ga0182009_10419775 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
| 3300021560|Ga0126371_11219182 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 888 | Open in IMG/M |
| 3300022467|Ga0224712_10276282 | Not Available | 781 | Open in IMG/M |
| 3300024288|Ga0179589_10188076 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300025905|Ga0207685_10383665 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 716 | Open in IMG/M |
| 3300025906|Ga0207699_11021747 | Not Available | 611 | Open in IMG/M |
| 3300025912|Ga0207707_10498043 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
| 3300025912|Ga0207707_10823237 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300025913|Ga0207695_10500736 | All Organisms → cellular organisms → Bacteria | 1097 | Open in IMG/M |
| 3300025915|Ga0207693_10433805 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
| 3300025915|Ga0207693_11046025 | Not Available | 622 | Open in IMG/M |
| 3300025915|Ga0207693_11261061 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
| 3300025917|Ga0207660_10789031 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 775 | Open in IMG/M |
| 3300025921|Ga0207652_10402886 | All Organisms → cellular organisms → Bacteria | 1234 | Open in IMG/M |
| 3300025927|Ga0207687_10377537 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1160 | Open in IMG/M |
| 3300025928|Ga0207700_10245603 | All Organisms → cellular organisms → Bacteria | 1527 | Open in IMG/M |
| 3300025928|Ga0207700_10398043 | All Organisms → cellular organisms → Bacteria | 1206 | Open in IMG/M |
| 3300025939|Ga0207665_11266767 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
| 3300026281|Ga0209863_10210441 | Not Available | 562 | Open in IMG/M |
| 3300026319|Ga0209647_1005652 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 9101 | Open in IMG/M |
| 3300026527|Ga0209059_1051747 | All Organisms → cellular organisms → Bacteria | 1805 | Open in IMG/M |
| 3300026557|Ga0179587_11023351 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
| 3300027517|Ga0209113_1039602 | Not Available | 673 | Open in IMG/M |
| 3300027574|Ga0208982_1117614 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
| 3300027583|Ga0209527_1041911 | All Organisms → cellular organisms → Bacteria | 1031 | Open in IMG/M |
| 3300027826|Ga0209060_10002226 | All Organisms → cellular organisms → Bacteria | 18511 | Open in IMG/M |
| 3300027826|Ga0209060_10480581 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
| 3300027842|Ga0209580_10126362 | All Organisms → cellular organisms → Bacteria | 1249 | Open in IMG/M |
| 3300027842|Ga0209580_10143457 | All Organisms → cellular organisms → Bacteria | 1173 | Open in IMG/M |
| 3300027842|Ga0209580_10184334 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
| 3300027857|Ga0209166_10014999 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4928 | Open in IMG/M |
| 3300027910|Ga0209583_10240928 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 793 | Open in IMG/M |
| 3300028536|Ga0137415_11123651 | Not Available | 599 | Open in IMG/M |
| 3300028800|Ga0265338_10453157 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 908 | Open in IMG/M |
| 3300030974|Ga0075371_11456398 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 666 | Open in IMG/M |
| 3300031057|Ga0170834_104397865 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 715 | Open in IMG/M |
| 3300031128|Ga0170823_10196634 | Not Available | 554 | Open in IMG/M |
| 3300031469|Ga0170819_12639974 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 653 | Open in IMG/M |
| 3300031716|Ga0310813_11272657 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 679 | Open in IMG/M |
| 3300031962|Ga0307479_10236697 | All Organisms → cellular organisms → Bacteria | 1801 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 19.57% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.70% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 7.97% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 5.07% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.35% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 4.35% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.62% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.62% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.17% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.17% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.17% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.17% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.45% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.45% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.45% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.45% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.45% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.45% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.72% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.72% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.72% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.72% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.72% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.72% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.72% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
| 3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300002906 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300019999 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a1 | Environmental | Open in IMG/M |
| 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027517 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027574 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300030974 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F62_00395260 | 2170459010 | Grass Soil | MKTKNMRELEKMWAKKAVEQANSQQKGGAPTRQTVTHAPRTARKSSRGR |
| C688J14111_100045485 | 3300001305 | Soil | MKTKNMRELEKMWAKKASEQSNPKQKAGAPVRQTPTHTTRAARKSSRGR* |
| C688J35102_1208617291 | 3300002568 | Soil | KTKNMRELEKMWAKKASEQSNPKQKAGAPVRQTPTHTTRAARKSSRGR* |
| JGI25614J43888_100347851 | 3300002906 | Grasslands Soil | VKTKNMRELEKMWAKKAAEQSNPKQKTGTPTRQNPTQVTRVPRKSSRGR* |
| JGI25617J43924_100983242 | 3300002914 | Grasslands Soil | MKTKDMREMEKMWAKKAAEQSNPKQKTSTPTRQSPAHTTRTARKASRGR* |
| Ga0066672_109371461 | 3300005167 | Soil | MGMKTKNMRELEKMWAKKASEQSNPQKKGTPTRQTPTHTTRTAARKSSRGR* |
| Ga0068868_1006285862 | 3300005338 | Miscanthus Rhizosphere | MKTKNMRELEKMWAQKAKAQSNPQQKTGAPTRQTVAPAPRITRKSSRGS* |
| Ga0070661_1018709291 | 3300005344 | Corn Rhizosphere | KNMRELEKMWAKKASEQSNPQKKAGTPVRQTPTHTTRAARKSSRGR* |
| Ga0070692_105447082 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTKNMRELEKMWAKKASEQSNPKQKGGTSTRQAPTHTTRTATRKSSRGR* |
| Ga0070709_101331232 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQLWHAYCMKTKNMRELEKMWAKKAVEQSNPQQKSGAPTRQTVTHAPRTARKSSRGR* |
| Ga0070709_110243852 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | ELEKMWAKKAVEQSNPQQKGGAPTRQTVTHAPRISRKSNRGS* |
| Ga0070709_110888032 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | HSPLAARLWHAYCMKTKNMRELEKMWAKKAVEQSNPGKKGGAPARQTVTHAPRISRKSNRGS* |
| Ga0070709_115048782 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MGMKTKNMRELEKMWAKKASEQSNPQKKAGTPTRPTVSHAPRISRKSNRGS* |
| Ga0070714_1003766363 | 3300005435 | Agricultural Soil | MGMKTKNMRELEKMWAKKASEQSNPQKKAGTSTRPTVSHAPRISRKSNRGS* |
| Ga0070714_1006053232 | 3300005435 | Agricultural Soil | MAQLWHAYCMKTKNMRELEKMWAKKAVEQSNPQQKGGAPTRQTVTHAPRISRKSNRGS* |
| Ga0070713_1000506726 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MRELEKMWAKKAVEQSNPQQKGGAPTRQTVTHAPRISRKSNRGS* |
| Ga0070713_1000929483 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQLWHAYCMKTKNMRELEKMWAKKAVEQSNPQQKGGAPTRQTVSHAPRISRKSNRGS* |
| Ga0070713_1006681163 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MPPAYGILMGMKTKNMRELEKMWAKKASEQSNPQKKGGAPTRPTVSHAPRISRKSNRGS* |
| Ga0070713_1021236481 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MGMKTKNMRELEKMWAKKASEQSNPQKKGGAPTRPTVSHAPRI |
| Ga0070710_103572592 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTKNMRELEKMWAKKASEQSNPQKKGGAATRPTVSHAPRISRKSNRGS* |
| Ga0070710_113380231 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTKNMRELEKMWAKKAVEQANPQQKGGAPTRQTVTHAPRTARKSSRGR* |
| Ga0070711_1000343753 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | LWHAYCMKTKNMRELEKMWAKKAVEQSNPQQKGGAPTRQTVTHAPRTARKSSRGR* |
| Ga0070711_1012214542 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTKNMRELEKMWAKKASEQSNPQKKAGTPTRPTVSHAPRISRKSNRGS* |
| Ga0070711_1015676342 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTKNMRELEKMWAKKAVEQSNPQQKGGAPTRQTVTHAPRISRKSNRGS* |
| Ga0070681_105062892 | 3300005458 | Corn Rhizosphere | MKTKNMREMEKMWAKKATEQSNPQKKAGTPVRQTPTHTTRAARKSSRGR* |
| Ga0070681_117190612 | 3300005458 | Corn Rhizosphere | MPGYGILMCMKTKNMRELEKMWAKKASEQSNPQKKGGAPTRQPVSHAPRISRKSNRGS* |
| Ga0070681_119404531 | 3300005458 | Corn Rhizosphere | MKTKNMRELEKMWAKKASEQSNPQKKAGTPVRQTPTHTTRVAR |
| Ga0070699_1003789733 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MGMKTKNMRELEKMWAKKAAEQSNPQQKAGMPTRQTPTHTTRTAARKSSRGR* |
| Ga0070734_1000115917 | 3300005533 | Surface Soil | MKTKNMRELEKMWAKKASEQSNPQKKGGAPTRPTVSHAPRISRKSNRGS* |
| Ga0070734_102998212 | 3300005533 | Surface Soil | MKNKNMREMEKMWAKKAAEQNNPKQKTGAAARQTPTHTVRATRKASRGR* |
| Ga0070732_100236295 | 3300005542 | Surface Soil | MKTKNMRELEKMWAKKAVEQSNPQQKGGAPTRQTVTHAPRTARKSSRGR* |
| Ga0070732_100259283 | 3300005542 | Surface Soil | MGMKTKNMRELEKMWAKKASEQSNPQQKGGTPTRPTVSHAPRISRKSNRGS* |
| Ga0070732_110349692 | 3300005542 | Surface Soil | MKNKNMREMEKMWAKKAAEQSDPKQKMGAATRQAPTHTVRATRKASRGR* |
| Ga0066702_103911913 | 3300005575 | Soil | MKTKNMREMEKMWAKKATEQSNPQKKAGTPARQTVTHAPRTARKASRGR* |
| Ga0066702_106866502 | 3300005575 | Soil | MKTKNMRELEKMWAKKATEQSNPQKKAGTPVRQTPTHTTRAARKSSRGR* |
| Ga0066654_101961252 | 3300005587 | Soil | MKTKNMREMEKMWAKKATEQSNPQKKAGTPVRQTPSHAPRISRKSNRGS* |
| Ga0068856_1026078652 | 3300005614 | Corn Rhizosphere | MKTKNMRELEKMWAKKAMEQRNPQQKGGAPTRQTVTPAPRIARKSSRGS* |
| Ga0070764_111149352 | 3300005712 | Soil | MKSKNMREMEKMWAKKAAEQSDPKQKTGAATRQAPTHTVRSTRKASRGR* |
| Ga0070717_102711342 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MGMKTKNMRELEKMWAKKASEQSNPQKKGGAPTRPTVSHAPRISRKSNRGS* |
| Ga0070717_107673001 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MLIGMKTKNMRELEKMWAQKAKAQSNPQQKGGAPTRQTVAPAPRITRKSSRGS* |
| Ga0075023_1000579561 | 3300006041 | Watersheds | MKTKNMREMEKMWAKKAAEQSNPRQKTGAAAKQGPSHTTRTARKASRGR* |
| Ga0075028_1002998312 | 3300006050 | Watersheds | MKTKNMREMEKMWAKKAAEQSKPRQKTGTPARQSPTHTTRTARKASRGQ* |
| Ga0070715_103435502 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPAYGILMGMKTKNMRELEKMWAKKASEQSNPQKKAGTPTRPTVSHAPRISRKSNRGS* |
| Ga0070712_1012339752 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTKNMRELEKMWAKKASEQSNPQKKAGTPTRQVPTHTTRAARKSSRGR* |
| Ga0075426_101736482 | 3300006903 | Populus Rhizosphere | MKTKNMRELEKMWAKKAVEQSNPQQKTGAPTRQTVTHAPRTARKSSRGR* |
| Ga0075436_1014297621 | 3300006914 | Populus Rhizosphere | KKAVEQSNPQQKTGAPTRQTVTHAPRTARKSSRGR* |
| Ga0079219_103364022 | 3300006954 | Agricultural Soil | MKTKNMRELEKMWAKKAVEQSNPGKKGGAPARQTVTHAPRIARKSSRGS* |
| Ga0079219_104168741 | 3300006954 | Agricultural Soil | MKTKNMRELEKMWAQKAKAQSNPQQKGGAPTRQTVAPAPRITRKSSR |
| Ga0079219_120885961 | 3300006954 | Agricultural Soil | MRELEKMWAKKAVEQSNPQQKTGAPTRQTVTHAPRTARKSSRGR* |
| Ga0099830_107228452 | 3300009088 | Vadose Zone Soil | MGMKTKNMRELEKMWAKKASEQSNPQQKTGTPTRQSPTHTTRTARKASRGR* |
| Ga0105240_100945215 | 3300009093 | Corn Rhizosphere | MKTKNMRELEKMWAKKASEQSNPQKKAGTPVRQTPTHTTRAARKSSRGR* |
| Ga0105240_112548261 | 3300009093 | Corn Rhizosphere | LERQDYGILICMKTKNMRELEKMWAKKASEQSNPQKKAGTPTRPTVSHAPRISRKSNRGS |
| Ga0105245_117650331 | 3300009098 | Miscanthus Rhizosphere | MKTKNMRELEKMWAKKASEQSKPQQKGGAPTRQPVSHAPRISRKSNRGS* |
| Ga0105238_102478653 | 3300009551 | Corn Rhizosphere | MGMKTKNMRELEKMWAKKASEQSNPQKKGGAPARPTVSHAPRISRKSNRGS* |
| Ga0126376_113216182 | 3300010359 | Tropical Forest Soil | MKTKNMRELEKMWAQKAKAQSNPQQKTGAPTRQTTTPAPRIARKSSRGS* |
| Ga0126376_132670961 | 3300010359 | Tropical Forest Soil | LEKMWAQKAKAQSNPQQKTGAPTRQTTTPPPRIARKSSRGS* |
| Ga0134125_110264412 | 3300010371 | Terrestrial Soil | MKTKNMRELEKMWAKKAAEQSNPQQKGGAPTRQTPTHTTRPAARKSSRGR* |
| Ga0134128_105448943 | 3300010373 | Terrestrial Soil | MYHQSDSPYVACLWHPYGMKTKNMRELEKMWAKKATEQSNPQKKAGTPVRQTPTHTTRAARKSSRGR* |
| Ga0134128_112611562 | 3300010373 | Terrestrial Soil | YGILMCMKTKNMRELEKMWAQKAKAQSNPQQKTGAPTRQTVAPAPRITRKSSRGS* |
| Ga0134128_131822312 | 3300010373 | Terrestrial Soil | MKTKNMRELEKMWAKKASEQSNPQKKAGTSTRQTPTHTTRTAARKSSRGR* |
| Ga0105239_110032512 | 3300010375 | Corn Rhizosphere | MKTKNMRELEKMWAKKASEQSNPQKKVGAPARPTVSHAPRISRKSNRGS* |
| Ga0105239_130216412 | 3300010375 | Corn Rhizosphere | MRPAYGILIGMKTKNMRELEKMWAKKASEQSNPQKKAGTPVRQTPTHTTRAARKSSRGR* |
| Ga0126381_1018712382 | 3300010376 | Tropical Forest Soil | MLIGMKTKNMRELEKMWAKKAMEQGNPKQKGGAPTRQTVAPAPRIARKSSRGS* |
| Ga0134126_106534622 | 3300010396 | Terrestrial Soil | MWPAYGILIGMKTKNMRELEKMWAKKATEQSNPQKKAGTPVRQTPTHTTRAARKSSRGR* |
| Ga0126383_106423991 | 3300010398 | Tropical Forest Soil | MLIGMKTKNMRELEKMWAQKAKAQSNPQQKGGAPTRQPAAPAPRIARKSSRGS* |
| Ga0134127_109989742 | 3300010399 | Terrestrial Soil | MKTKNMRELEKMWAKKASEQSNPQKKAGTPVRQTPTHTTRVARKSSRGR* |
| Ga0137362_114261472 | 3300012205 | Vadose Zone Soil | MKTKNMREMQKMWAKKASEQSNPQQKAGTPTRQSPTHTTRTARKASRGR* |
| Ga0137380_111135941 | 3300012206 | Vadose Zone Soil | MKTKNMRELVKMWAKKAVEQSNPQQKTGAPTRQTVTHAPRTARKSSRGR* |
| Ga0150985_1076646692 | 3300012212 | Avena Fatua Rhizosphere | MGMKTKNMRELEKMWAKKASEQSNPQKKAGTPTRQPVSHAPRISRKSNRGS* |
| Ga0137390_104375382 | 3300012363 | Vadose Zone Soil | MKTKDMREMEKMWAKKAAEQSNPKQKTSTPTRQSPAHATRTARKASRGR* |
| Ga0137398_101297913 | 3300012683 | Vadose Zone Soil | MDMKTKNMRELEKMWAKKASEQSNPQQKTGTPTRQSPTHTTRTARKASRGR* |
| Ga0137397_109493312 | 3300012685 | Vadose Zone Soil | MKTKNMRELEKMWAKKASEQSNPQKKAGTPMRQAPTHTTRAARK |
| Ga0137395_100025483 | 3300012917 | Vadose Zone Soil | VKTKNMRELEKMWAKKAAEQSNSKQKTGTPTRQNPTQVTRVPRKSSRGR* |
| Ga0137419_116482751 | 3300012925 | Vadose Zone Soil | MGMKTKNMRELEKMWAKKASEQSNPQQKAGTPTRQSPTHTTRTARKASRGR* |
| Ga0137404_103614862 | 3300012929 | Vadose Zone Soil | MGMKTKNMRELEKMWAKKASEQSNPQQKTATPTRQSPSHTTRTARKASRGR* |
| Ga0153915_101962704 | 3300012931 | Freshwater Wetlands | MKTKNMRELEKMWAKKAVEQSKPQQKTGAPTRQTVTHAPRTARKSSRGR* |
| Ga0164298_100313813 | 3300012955 | Soil | MGMKTKNMRELEKMWAKKASEQSNPQKKAGTPMRQTPTHTTRAARKSSRGR* |
| Ga0164303_112962172 | 3300012957 | Soil | MLKGMKTKNMREMEKMWAKKAAEQNNPRLKTGAPTRQSATPAPRIARKSSRGS* |
| Ga0164301_101753542 | 3300012960 | Soil | MAQLWHAYCMKTKNMRELETMWAKKAVEQSNPQQKSGAPTRQTVTHAPRTARKSSRGR* |
| Ga0164309_103379802 | 3300012984 | Soil | MKTKNMRELEKMWAKKASEQSNPQKKAGTSTRPTVSHAPRISRKSNRGS* |
| Ga0164309_111047242 | 3300012984 | Soil | MKTKNMRELEKMWAKKAVEQSNPQQKSGAPTRQTVTHAPRTARKSSRGR* |
| Ga0164308_102893782 | 3300012985 | Soil | MKTKNMRELEKMWAKKAMEQGKPQQKGAAPTRPTVSHAPRISRKSNRGS* |
| Ga0164308_117193302 | 3300012985 | Soil | MKTKNMRELEKMWAKKASEQSNPQKKAGTSTRQTPTHTTRT |
| Ga0164304_117469262 | 3300012986 | Soil | MRELEKMWAKKAMEQRNPQQKGGAPTRQTVTPAPRIARKSSRGS* |
| Ga0164306_100624082 | 3300012988 | Soil | YGILICMKTKNMRELEKMWAKKAVEQSNPQQKGGAPTRQTVTHAPRTARKSSRGR* |
| Ga0164306_111146261 | 3300012988 | Soil | MKTKNMRELEKMWAKKAMEQGKPQQKGGAPTRPTVSHAPRISRKSNRGS* |
| Ga0157374_120258932 | 3300013296 | Miscanthus Rhizosphere | ELEKMWAKKASEQSNPQKKGGAPARPTVSHAPRISRKSNRGS* |
| Ga0157378_101785611 | 3300013297 | Miscanthus Rhizosphere | GILMCMKTKNMRELEKMWAQKAKAQSNPQQKTGAPTRQTVAPAPRITRKSSRGS* |
| Ga0137412_104232083 | 3300015242 | Vadose Zone Soil | MGMKTKNMRELEKMWAKKASEQSNPQQKTGTPTRQSPTHTTRTARKA |
| Ga0066655_109503602 | 3300018431 | Grasslands Soil | MKTKNMRELEKMWAKKATEQSNPQKKAGTPVRQTPTHTTRAARKSSRGR |
| Ga0066655_110332833 | 3300018431 | Grasslands Soil | MKTKNMREMEKMWAKKATEQSNPQKKAGTPVRQTPTHTTRAARKSSRGR |
| Ga0193718_10123492 | 3300019999 | Soil | MGMKTKNMRELEKMWAKKASEQSNPQQKTGTPTRQSPTHTTRTARKASRGR |
| Ga0206351_109934301 | 3300020077 | Corn, Switchgrass And Miscanthus Rhizosphere | MPGYGILMCMKTKNMRELEKMWAKKASEQSNPQKKGGAPTRQPVSHAPRISRKSNRGS |
| Ga0210407_102761073 | 3300020579 | Soil | MDMKTKNMRELEKMWAKKASEQSNPQQKTGTPTRQSPSHTTRTARKASRGR |
| Ga0210400_100496354 | 3300021170 | Soil | MDMKTKNMRELEKMWAKKASEQSNPQQKAGTPTRQSPSHTTRTARKASRGR |
| Ga0210397_101231734 | 3300021403 | Soil | MKSKNMREMEKMWAKKAAEQNDPKQKTGAAARQTPTHTVRATRKASRGR |
| Ga0210389_109786502 | 3300021404 | Soil | MKSKNMREMEKMWAKKAAEQSDPKQKTGTATRQAPTHTVRATRKASRGR |
| Ga0210384_1000029137 | 3300021432 | Soil | MKTKDMREMEKMWAKKAAEQSNPKQKTSTPTRQSPAHTTRTARKASRGR |
| Ga0182009_104197752 | 3300021445 | Soil | MKTKNMRELEKMWAKKAVEQSNPQQKGGAPTRQTVTHAPRTARKSSRGR |
| Ga0126371_112191821 | 3300021560 | Tropical Forest Soil | MKTKNMRELEKMWAQKAKAQSNPQQKGGAPTRQTVAPAPRIARKSSRGS |
| Ga0224712_102762821 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTKNMRELEKMWAKQASEQSNPQKKAGTPVRQTPTHTTRAARKSSRGR |
| Ga0179589_101880762 | 3300024288 | Vadose Zone Soil | MSMKTKNMRELEKIWAKKASEQSNPQQKAGTPTRQSPSHTPRTARKASRGR |
| Ga0207685_103836652 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | YCMKTKNMRELEKMWAKKAVEQSNPQQKGGAPARQTVTHAPRIARKSSRGS |
| Ga0207699_110217472 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTKNMRELEKMWAKKASEQSNPQKKAGTPTRPTVSHAPRISRKSN |
| Ga0207707_104980433 | 3300025912 | Corn Rhizosphere | MKTKNMRELEKMWAKKASEQSNPKQKGGTSTRQAPTHTTRTATRKSSRGR |
| Ga0207707_108232371 | 3300025912 | Corn Rhizosphere | RPAYGILYGMKTKNMRELEKMWAKKASEQSNPQKKAGTPVRQTPTHTTRVARKSSRGR |
| Ga0207695_105007362 | 3300025913 | Corn Rhizosphere | MKTKNMRELEKMWAKKASEQSNPQKKAGTPVRQTPTHTTRAARKSSRGR |
| Ga0207693_104338052 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTKNMRELEKMWAKKASEQSNPQKKAGTPTRQVPTHTTRAARKSSRGR |
| Ga0207693_110460251 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTKNMRELEKMWAKKAVEQSNPQQKGGAPTRQTVTHAPRTAR |
| Ga0207693_112610612 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | KMWAKKAVEQSNPQQKGGAPTRQTVTHAPRTARKSSRGR |
| Ga0207660_107890311 | 3300025917 | Corn Rhizosphere | MKTKNMREMEKMWAKKASEQSNPQKKAGTPVRQTPTHTTRAARKSSRGR |
| Ga0207652_104028862 | 3300025921 | Corn Rhizosphere | MKTKNMRELEKMWAKKASEQSNPQKKAGTPVRQTPTHTTRVARKSSRGR |
| Ga0207687_103775372 | 3300025927 | Miscanthus Rhizosphere | MKTKNMRELEKMWAKKASEQSKPQQKGGAPTRQPVSHAPRISRKSNRGS |
| Ga0207700_102456033 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MPPAYGILMGMKTKNMRELEKMWAKKASEQSNPQKKGGAPTRPTVSHAPRISRKSNRGS |
| Ga0207700_103980432 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MRELEKMWAKKAVEQSNPQQKGGAPTRQTVTHAPRISRKSNRGS |
| Ga0207665_112667672 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | TKNMRELEKMWAKKAVEQSNPQQKSGAPTRQTVTHAPRISRKSNRGS |
| Ga0209863_102104411 | 3300026281 | Prmafrost Soil | MKTKNTREMEKMWAKKAVEQSKPGQKTSTPTRQSPTHTTRTA |
| Ga0209647_10056523 | 3300026319 | Grasslands Soil | VKTKNMRELEKMWAKKAAEQSNPKQKTGTPTRQNPTQVTRVPRKSSRGR |
| Ga0209059_10517472 | 3300026527 | Soil | GMKTKNMRELEKMWAKKATEQSNPQKKAGTPVRQTPTHTTRAARKSSRGR |
| Ga0179587_110233512 | 3300026557 | Vadose Zone Soil | DCGILMAMKTKNMRELEKMWAKKASEQSNPQQKPGAPTRQSPAPATRTARKASRGR |
| Ga0209113_10396022 | 3300027517 | Forest Soil | MKSKNMREMEKHWAKKAAEQNGSQQKGAAATRQPTHNTTRAPRKASRGR |
| Ga0208982_11176141 | 3300027574 | Forest Soil | MKNKNMREMEKIWAKKAAEQNDPKQKTGAAARQTPTHTTRTTRKASRGR |
| Ga0209527_10419111 | 3300027583 | Forest Soil | MGMKTKNMRELEKMWAKKASEQSNPQQKAGAPTRQSPAPATRTARKASRGR |
| Ga0209060_1000222614 | 3300027826 | Surface Soil | MKTKNMRELEKMWAKKASEQSNPQKKGGAPTRPTVSHAPRISRKSNRGS |
| Ga0209060_104805812 | 3300027826 | Surface Soil | MKNKNMREMEKMWAKKAAEQNNPKQKTGAAARQTPTHTVRATRKASRGR |
| Ga0209580_101263621 | 3300027842 | Surface Soil | MGMKTKNMRELEKMWAKKASEQSNPQQKGGTPTRPTVSHAPRISRKSNRGS |
| Ga0209580_101434572 | 3300027842 | Surface Soil | MRPTYGILICMKTKNMRELEKMWAKKAMEQGKPQQKGGAPTRPTVSHAPRISRKSNRGS |
| Ga0209580_101843341 | 3300027842 | Surface Soil | HSPSIARLWHAYCMKTKNMRELEKMWAKKAVEQSNPQQKGGAPTRQTVTHAPRTARKSSRGR |
| Ga0209166_100149992 | 3300027857 | Surface Soil | MKTKNMRELEKMWAKKAVEQSNPQQKTGAPTRQTVTHAPRTARKSSRGR |
| Ga0209583_102409281 | 3300027910 | Watersheds | MKTKNMREMEKMWAKKAAEQSNPRQKTGAAAKQGPSHTTRTARKASRGR |
| Ga0137415_111236512 | 3300028536 | Vadose Zone Soil | MGMKTKNMRELEKMWAKKASEQSNPQQKAGTPTRQSPTHTTRTARKASRGR |
| Ga0265338_104531571 | 3300028800 | Rhizosphere | MKSKNMREMEKMWAKKAAEQANPKQKGAAPTRQAPTHTTRTTRKASRGR |
| Ga0075371_114563982 | 3300030974 | Soil | MKTKNMRELEKMWAKKASEQSNPQKKAGTPTRQAPTHTTRAARKSSRGR |
| Ga0170834_1043978652 | 3300031057 | Forest Soil | MDMKTKNMRELEKMWAKKASEQSNPQKKAGTPVRQTPTHTTRAARKSSRGR |
| Ga0170823_101966342 | 3300031128 | Forest Soil | MGMKTKNMRELEKMWAKKASEQSNPQKKAGTPTRQAPTHTTR |
| Ga0170819_126399741 | 3300031469 | Forest Soil | PDYGILMGMKTKNMRELEKMWAKKASEQSNPQKKAGTPVRQTPTHTTRAARKSSRGR |
| Ga0310813_112726572 | 3300031716 | Soil | MKTKNMRELEKMWAKKAMEQRNPQQKGGAPTRQTVTPAPRIARKSSRGS |
| Ga0307479_102366975 | 3300031962 | Hardwood Forest Soil | MKTKNMRELEKMWAKKAVEQSNPQQKGGAPTRQTVTHAPRI |
| ⦗Top⦘ |