| Basic Information | |
|---|---|
| Family ID | F056105 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 138 |
| Average Sequence Length | 50 residues |
| Representative Sequence | MPRAGRRELLSAALTHLEAAAKLLEEAEEEVLADEARELTDKVDVVALAEAA |
| Number of Associated Samples | 114 |
| Number of Associated Scaffolds | 138 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 58.39 % |
| % of genes near scaffold ends (potentially truncated) | 47.10 % |
| % of genes from short scaffolds (< 2000 bps) | 86.23 % |
| Associated GOLD sequencing projects | 104 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (52.899 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (18.841 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.507 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (63.043 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 86.54% β-sheet: 0.00% Coil/Unstructured: 13.46% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 138 Family Scaffolds |
|---|---|---|
| PF17200 | sCache_2 | 9.42 |
| PF00072 | Response_reg | 8.70 |
| PF09361 | Phasin_2 | 7.97 |
| PF04226 | Transgly_assoc | 1.45 |
| PF07369 | DUF1488 | 1.45 |
| PF06863 | DUF1254 | 0.72 |
| PF13704 | Glyco_tranf_2_4 | 0.72 |
| PF12833 | HTH_18 | 0.72 |
| COG ID | Name | Functional Category | % Frequency in 138 Family Scaffolds |
|---|---|---|---|
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 1.45 |
| COG5361 | Uncharacterized conserved protein | Mobilome: prophages, transposons [X] | 0.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 52.90 % |
| All Organisms | root | All Organisms | 47.10 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_17308098 | Not Available | 1631 | Open in IMG/M |
| 2140918013|NODE_529129_length_1056_cov_4.882576 | Not Available | 1088 | Open in IMG/M |
| 3300000955|JGI1027J12803_103774748 | Not Available | 504 | Open in IMG/M |
| 3300000955|JGI1027J12803_107602890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium | 1134 | Open in IMG/M |
| 3300001593|JGI12635J15846_10750898 | Not Available | 560 | Open in IMG/M |
| 3300001979|JGI24740J21852_10081721 | Not Available | 846 | Open in IMG/M |
| 3300001991|JGI24743J22301_10013546 | Not Available | 1494 | Open in IMG/M |
| 3300004114|Ga0062593_102939165 | Not Available | 545 | Open in IMG/M |
| 3300004463|Ga0063356_102061941 | Not Available | 865 | Open in IMG/M |
| 3300004479|Ga0062595_100776347 | Not Available | 785 | Open in IMG/M |
| 3300004798|Ga0058859_10076895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 866 | Open in IMG/M |
| 3300005327|Ga0070658_10649882 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 915 | Open in IMG/M |
| 3300005328|Ga0070676_10057869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 2295 | Open in IMG/M |
| 3300005331|Ga0070670_100036427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4234 | Open in IMG/M |
| 3300005332|Ga0066388_100424822 | All Organisms → Viruses → Predicted Viral | 1972 | Open in IMG/M |
| 3300005332|Ga0066388_101363809 | Not Available | 1228 | Open in IMG/M |
| 3300005332|Ga0066388_105262097 | Not Available | 656 | Open in IMG/M |
| 3300005332|Ga0066388_105730457 | Not Available | 628 | Open in IMG/M |
| 3300005335|Ga0070666_10046098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2924 | Open in IMG/M |
| 3300005434|Ga0070709_10001811 | All Organisms → cellular organisms → Bacteria | 11582 | Open in IMG/M |
| 3300005455|Ga0070663_100115295 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2023 | Open in IMG/M |
| 3300005457|Ga0070662_100349905 | Not Available | 1210 | Open in IMG/M |
| 3300005471|Ga0070698_101153430 | Not Available | 724 | Open in IMG/M |
| 3300005536|Ga0070697_101343704 | Not Available | 638 | Open in IMG/M |
| 3300005543|Ga0070672_100004144 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 9464 | Open in IMG/M |
| 3300005543|Ga0070672_100434914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1128 | Open in IMG/M |
| 3300005617|Ga0068859_100316090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1655 | Open in IMG/M |
| 3300005713|Ga0066905_101240746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium | 668 | Open in IMG/M |
| 3300005764|Ga0066903_100590227 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1921 | Open in IMG/M |
| 3300005764|Ga0066903_102231280 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1056 | Open in IMG/M |
| 3300006058|Ga0075432_10067657 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1280 | Open in IMG/M |
| 3300006058|Ga0075432_10191703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 805 | Open in IMG/M |
| 3300006163|Ga0070715_10439956 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300006175|Ga0070712_101656410 | Not Available | 560 | Open in IMG/M |
| 3300006175|Ga0070712_101916827 | Not Available | 519 | Open in IMG/M |
| 3300006196|Ga0075422_10451296 | Not Available | 577 | Open in IMG/M |
| 3300006755|Ga0079222_10198679 | Not Available | 1203 | Open in IMG/M |
| 3300006804|Ga0079221_10412738 | Not Available | 842 | Open in IMG/M |
| 3300006844|Ga0075428_101995375 | Not Available | 601 | Open in IMG/M |
| 3300006845|Ga0075421_101582563 | Not Available | 713 | Open in IMG/M |
| 3300006847|Ga0075431_100618686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1065 | Open in IMG/M |
| 3300006847|Ga0075431_101415752 | Not Available | 654 | Open in IMG/M |
| 3300006847|Ga0075431_101691527 | Not Available | 590 | Open in IMG/M |
| 3300006852|Ga0075433_10733220 | Not Available | 865 | Open in IMG/M |
| 3300006854|Ga0075425_101103504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 903 | Open in IMG/M |
| 3300006871|Ga0075434_100234123 | All Organisms → cellular organisms → Bacteria | 1856 | Open in IMG/M |
| 3300006880|Ga0075429_101191768 | Not Available | 665 | Open in IMG/M |
| 3300006903|Ga0075426_10487973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 914 | Open in IMG/M |
| 3300006904|Ga0075424_102192592 | Not Available | 581 | Open in IMG/M |
| 3300006914|Ga0075436_100564067 | Not Available | 837 | Open in IMG/M |
| 3300006914|Ga0075436_101274027 | Not Available | 556 | Open in IMG/M |
| 3300006954|Ga0079219_10034784 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2030 | Open in IMG/M |
| 3300009098|Ga0105245_10059992 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3426 | Open in IMG/M |
| 3300009100|Ga0075418_10923925 | Not Available | 944 | Open in IMG/M |
| 3300009100|Ga0075418_11645152 | Not Available | 698 | Open in IMG/M |
| 3300009101|Ga0105247_10853435 | Not Available | 699 | Open in IMG/M |
| 3300009147|Ga0114129_12085441 | Not Available | 684 | Open in IMG/M |
| 3300009147|Ga0114129_12400178 | Not Available | 632 | Open in IMG/M |
| 3300009147|Ga0114129_13032824 | Not Available | 551 | Open in IMG/M |
| 3300009156|Ga0111538_10249348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2248 | Open in IMG/M |
| 3300009162|Ga0075423_11461816 | Not Available | 733 | Open in IMG/M |
| 3300009174|Ga0105241_10125053 | All Organisms → cellular organisms → Bacteria | 2076 | Open in IMG/M |
| 3300009176|Ga0105242_10154760 | Not Available | 2002 | Open in IMG/M |
| 3300009177|Ga0105248_12052315 | Not Available | 650 | Open in IMG/M |
| 3300009551|Ga0105238_10371460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 1420 | Open in IMG/M |
| 3300009553|Ga0105249_13020748 | Not Available | 540 | Open in IMG/M |
| 3300010373|Ga0134128_10292085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1827 | Open in IMG/M |
| 3300010373|Ga0134128_12399832 | Not Available | 581 | Open in IMG/M |
| 3300010373|Ga0134128_13202598 | Not Available | 503 | Open in IMG/M |
| 3300010376|Ga0126381_105119862 | Not Available | 502 | Open in IMG/M |
| 3300010399|Ga0134127_13658119 | Not Available | 505 | Open in IMG/M |
| 3300012582|Ga0137358_10566222 | Not Available | 763 | Open in IMG/M |
| 3300012891|Ga0157305_10248311 | Not Available | 534 | Open in IMG/M |
| 3300012899|Ga0157299_10145090 | Not Available | 665 | Open in IMG/M |
| 3300012901|Ga0157288_10080232 | Not Available | 841 | Open in IMG/M |
| 3300012908|Ga0157286_10473620 | Not Available | 502 | Open in IMG/M |
| 3300012915|Ga0157302_10034727 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1351 | Open in IMG/M |
| 3300012930|Ga0137407_11064591 | Not Available | 766 | Open in IMG/M |
| 3300012951|Ga0164300_10055757 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1581 | Open in IMG/M |
| 3300012961|Ga0164302_10504928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 854 | Open in IMG/M |
| 3300012988|Ga0164306_11713838 | Not Available | 545 | Open in IMG/M |
| 3300012989|Ga0164305_10121328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 1722 | Open in IMG/M |
| 3300013096|Ga0157307_1013413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1290 | Open in IMG/M |
| 3300013102|Ga0157371_10410188 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300013296|Ga0157374_10809854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 953 | Open in IMG/M |
| 3300013306|Ga0163162_10041830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 4585 | Open in IMG/M |
| 3300013306|Ga0163162_10235318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 1962 | Open in IMG/M |
| 3300014969|Ga0157376_10539177 | Not Available | 1153 | Open in IMG/M |
| 3300015077|Ga0173483_10136010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1068 | Open in IMG/M |
| 3300015371|Ga0132258_11333882 | Not Available | 1813 | Open in IMG/M |
| 3300015371|Ga0132258_11950483 | Not Available | 1478 | Open in IMG/M |
| 3300015373|Ga0132257_104635692 | Not Available | 500 | Open in IMG/M |
| 3300015374|Ga0132255_100862546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 1352 | Open in IMG/M |
| 3300015374|Ga0132255_101770685 | Not Available | 938 | Open in IMG/M |
| 3300018429|Ga0190272_10372605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1150 | Open in IMG/M |
| 3300019356|Ga0173481_10007174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 3034 | Open in IMG/M |
| 3300019362|Ga0173479_10016226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2037 | Open in IMG/M |
| 3300020069|Ga0197907_10368033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1040 | Open in IMG/M |
| 3300020070|Ga0206356_11257362 | Not Available | 508 | Open in IMG/M |
| 3300020078|Ga0206352_11108021 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1208 | Open in IMG/M |
| 3300020080|Ga0206350_10498337 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1282 | Open in IMG/M |
| 3300020081|Ga0206354_11328049 | Not Available | 772 | Open in IMG/M |
| 3300021560|Ga0126371_11938345 | Not Available | 708 | Open in IMG/M |
| 3300022467|Ga0224712_10088659 | All Organisms → cellular organisms → Bacteria | 1292 | Open in IMG/M |
| 3300022886|Ga0247746_1051769 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 947 | Open in IMG/M |
| 3300023057|Ga0247797_1055978 | Not Available | 573 | Open in IMG/M |
| 3300023066|Ga0247793_1019320 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 979 | Open in IMG/M |
| 3300023073|Ga0247744_1081342 | Not Available | 563 | Open in IMG/M |
| 3300023077|Ga0247802_1019994 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 937 | Open in IMG/M |
| 3300023263|Ga0247800_1046060 | Not Available | 785 | Open in IMG/M |
| 3300025911|Ga0207654_10877279 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300025913|Ga0207695_10381735 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1295 | Open in IMG/M |
| 3300025918|Ga0207662_10074793 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2057 | Open in IMG/M |
| 3300025920|Ga0207649_10713400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 778 | Open in IMG/M |
| 3300025923|Ga0207681_11842529 | Not Available | 504 | Open in IMG/M |
| 3300025925|Ga0207650_10170522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 1729 | Open in IMG/M |
| 3300025936|Ga0207670_10142558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1768 | Open in IMG/M |
| 3300025940|Ga0207691_10120602 | All Organisms → cellular organisms → Bacteria | 2325 | Open in IMG/M |
| 3300025960|Ga0207651_10526159 | Not Available | 1025 | Open in IMG/M |
| 3300025961|Ga0207712_10452847 | Not Available | 1089 | Open in IMG/M |
| 3300025972|Ga0207668_11344615 | Not Available | 643 | Open in IMG/M |
| 3300026023|Ga0207677_10244320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1454 | Open in IMG/M |
| 3300026075|Ga0207708_12030889 | Not Available | 503 | Open in IMG/M |
| 3300026078|Ga0207702_10624763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1058 | Open in IMG/M |
| 3300026118|Ga0207675_100050898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3866 | Open in IMG/M |
| 3300026814|Ga0207586_104776 | Not Available | 533 | Open in IMG/M |
| 3300027775|Ga0209177_10029153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1435 | Open in IMG/M |
| 3300027775|Ga0209177_10068800 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1052 | Open in IMG/M |
| 3300027907|Ga0207428_10071074 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2734 | Open in IMG/M |
| 3300027907|Ga0207428_10362886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 1065 | Open in IMG/M |
| 3300027907|Ga0207428_10972039 | Not Available | 598 | Open in IMG/M |
| 3300031547|Ga0310887_11066449 | Not Available | 517 | Open in IMG/M |
| 3300031716|Ga0310813_10261571 | Not Available | 1445 | Open in IMG/M |
| 3300031716|Ga0310813_10805320 | Not Available | 846 | Open in IMG/M |
| 3300031740|Ga0307468_100758486 | Not Available | 821 | Open in IMG/M |
| 3300031892|Ga0310893_10063642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1264 | Open in IMG/M |
| 3300034819|Ga0373958_0022748 | All Organisms → cellular organisms → Bacteria | 1174 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 18.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.59% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.07% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.07% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 5.07% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 4.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.35% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.62% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.62% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.90% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.90% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.90% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.17% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.45% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.45% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.45% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.45% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.45% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.45% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.45% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.45% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.72% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.72% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.72% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.72% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.72% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.72% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2140918013 | Soil microbial communities from Great Prairies - Iowa soil (MSU Assemblies) | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Host-Associated | Open in IMG/M |
| 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Host-Associated | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012891 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2 | Environmental | Open in IMG/M |
| 3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
| 3300012901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1 | Environmental | Open in IMG/M |
| 3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013096 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022886 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5 | Environmental | Open in IMG/M |
| 3300023057 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S136-409B-6 | Environmental | Open in IMG/M |
| 3300023066 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S223-509R-6 | Environmental | Open in IMG/M |
| 3300023073 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S154-409C-5 | Environmental | Open in IMG/M |
| 3300023077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S076-202R-6 | Environmental | Open in IMG/M |
| 3300023263 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S092-311B-6 | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026814 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G08A3-10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
| 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_01058550 | 2088090014 | Soil | MPRAERRELLSAALTHLEAVAKLLEEAEEEVLADEARELTDKVDVVAIAEAA |
| Iowa-Corn-GraphCirc_00184490 | 2140918013 | Soil | MKKAERRELLSAALTHLEAVANLLKEAEEEVLANEARELIDKVDVVALAEAA |
| JGI1027J12803_1037747482 | 3300000955 | Soil | IAMPRAGRRELLSAALTHLEAAAKLLEEAEEEVLADAARELTDKVDVVALAEAA* |
| JGI1027J12803_1076028901 | 3300000955 | Soil | THLEAAAKLLEEADEEVLADEARELTDKVDVVALAEAA* |
| JGI12635J15846_107508981 | 3300001593 | Forest Soil | MTKGEKKMELLSAALTHLEAVAKLLREAEEEVLADEVGELADKVDIVAISRAA* |
| JGI24740J21852_100817211 | 3300001979 | Corn Rhizosphere | HLEAAAKLLEEAEEEVLADEARELTDKVDVVALAEAA* |
| JGI24743J22301_100135463 | 3300001991 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRAGRRELLSAALTHLEAAAKLLEEAEEEVLADEARELTDXVDVVALAEAA* |
| Ga0062593_1029391651 | 3300004114 | Soil | MTRAERTALLSAALTHLDAAAKLLEEAEEEVLAEEAQELTDKVNVVALAEVA* |
| Ga0063356_1020619412 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MTRAGRRELLSAALTHLEAAAKLLEEAEEEVLADEARELTDKVDVVALAEAA* |
| Ga0062595_1007763472 | 3300004479 | Soil | MTRAERTALLSAALTHLDAAAKLLEEAEEEVLAEEARELTDKVNVVALAEAA* |
| Ga0058859_100768951 | 3300004798 | Host-Associated | SAALTHLEAAAKLLEEAEEEVLADEARELTDKVDVVALAEAA* |
| Ga0070658_106498822 | 3300005327 | Corn Rhizosphere | MTRAGRRELLSAALTHLEAAAKLLEEAEEEVLADEARELTDKVDVVAIAEAA* |
| Ga0070676_100578693 | 3300005328 | Miscanthus Rhizosphere | MPRAGRRELLSAALTHLEAAAKLLEEAEEEVLADEARELTDKVDVVALAEAA* |
| Ga0070670_1000364274 | 3300005331 | Switchgrass Rhizosphere | MPRAGRRELLSAALTHLEAAAKLLEEAEEEVLADKARELTDKVDVVALAEAA* |
| Ga0066388_1004248222 | 3300005332 | Tropical Forest Soil | MTKAERKELLTAALTHLDAAANLLEEAEEEVLAEEARELTDKVDVVALAEAA* |
| Ga0066388_1013638092 | 3300005332 | Tropical Forest Soil | MTRAERRELLTAGLTHLDAAANLLEKAEEGVLAEEARELDDKVDVVALAEPA* |
| Ga0066388_1052620971 | 3300005332 | Tropical Forest Soil | MTRAERRELLTTALTHLDAAANLLQEAEEEVLAEEARELNDKVDVVALAEPASPHAV* |
| Ga0066388_1057304572 | 3300005332 | Tropical Forest Soil | ELLTAALTHLDAAANLLEEAEEGVLAEEARELNDKVDVVTLAEPADPQAV* |
| Ga0070666_100460986 | 3300005335 | Switchgrass Rhizosphere | MPRAERRELLSAALTHLEAVAKLLEEAEEEVLADEARELTDKVDVVALAEAA* |
| Ga0070709_1000181116 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | PRAERRELLSAALTHLEAVAKLLEEAEEEVLADEARELTDKVDVVALAEAA* |
| Ga0070663_1001152953 | 3300005455 | Corn Rhizosphere | MPRAERRELLSAALTHLEAVAKLLEEAEEEVLADEARELTDKVDVVAIAEAA* |
| Ga0070662_1003499052 | 3300005457 | Corn Rhizosphere | LSAALTHLEAAAKLLEEAEEEVLADEARELTDKVDVVALAEAA* |
| Ga0070698_1011534301 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MPRAGRRELLSAALTHLEAAAKLLEEAEEEVLADEARELTDKVDV |
| Ga0070697_1013437042 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MPRAERRELLSAALTHLEAVAKLLEEAEEEVLADEARELTDKVDV |
| Ga0070672_10000414413 | 3300005543 | Miscanthus Rhizosphere | ELLSAALTHLEAAAKLLEEAEEEVLADEARELTDKVDVVALAEAA* |
| Ga0070672_1004349141 | 3300005543 | Miscanthus Rhizosphere | THLEAAAKLLEEAEEEVLADEARELTDKVDVVALAEAA* |
| Ga0068859_1003160905 | 3300005617 | Switchgrass Rhizosphere | LLSAALTHLEAAAKLLEEAEEEVLADEARELTDKVDVVALAEAA* |
| Ga0066905_1012407462 | 3300005713 | Tropical Forest Soil | LNQEVSMRKAERRELLSAVLTHLEAAANLLKEAEEEVLADETRALTDKVDVVALAEAA* |
| Ga0066903_1005902272 | 3300005764 | Tropical Forest Soil | MTRAERRELLTAVLTHLDAAANLLEKAEEGVLAEEARELNDKVDVVALAEPA* |
| Ga0066903_1022312802 | 3300005764 | Tropical Forest Soil | MTKAERRELLTAALTHLDAAANLLEEAEEGVLAEEARELNDKVDVVTLAEPADPQAV* |
| Ga0075432_100676573 | 3300006058 | Populus Rhizosphere | AALTHLEAAAKLLEEAEEEVLADEARELTDKVDVVALAEAA* |
| Ga0075432_101917033 | 3300006058 | Populus Rhizosphere | LSAALTHLEAVAKLLEEAEEEVLADEARELTDKVDVVALAEAA* |
| Ga0070715_104399561 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | AMTRAERRDLLTAALTHLDAAANLLEEAEEGVLAEEARELNDKVDVVALVEPASLHAV* |
| Ga0070712_1016564102 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRAERRDLLTAALTHLDAAANLLEEAEEGVLAEEARELNDKVDVVALVEPASLHAV* |
| Ga0070712_1019168271 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MTKAEQRRELLSAALTHLDAAAKLLEEAEEGVLADEAQELTDKVDVVALAEAA* |
| Ga0075422_104512962 | 3300006196 | Populus Rhizosphere | MPRAGRRELLSAALTHLEAAAKLLEEAEEEVLADQARELTDKVDVVALAEAA* |
| Ga0079222_101986793 | 3300006755 | Agricultural Soil | MTRAERTALLSAALTHLDAAAKLLEEAEEEVLAEEAQELTDKVNVVALA |
| Ga0079221_104127382 | 3300006804 | Agricultural Soil | MTRAERTALLSAALTHLDAAAKLLEEAEEEVLAEEAQELTDKVNVV |
| Ga0075428_1019953751 | 3300006844 | Populus Rhizosphere | AMPRAGRRELLSAALTHLEAAAKLLEEAEEEVLADEARELTDKVDVVALAEAA* |
| Ga0075421_1015825631 | 3300006845 | Populus Rhizosphere | VLKPRGIAMPRAGRRELLSAALTHLEAAAKLLEEAEEEVLADEARELTDKVDVVALAEAA |
| Ga0075431_1006186863 | 3300006847 | Populus Rhizosphere | AMPRAERRELLSAALTHLEAAAKLLEEADEEVLADEARELTDKVDVVALAEAA* |
| Ga0075431_1014157523 | 3300006847 | Populus Rhizosphere | RRELLSAALTHLEAAAKLLEEAEEEVLADEARELTDKVDVVALAEAA* |
| Ga0075431_1016915271 | 3300006847 | Populus Rhizosphere | MPRAERRELLSAALTHLEAAAKLLEEAGEEVLADEARELTDKVDVVALAEAA* |
| Ga0075433_107332203 | 3300006852 | Populus Rhizosphere | LSAALAHLEAAAKLLEETEEEVLADEARELTDKVDVVALAEAA* |
| Ga0075425_1011035041 | 3300006854 | Populus Rhizosphere | MTRAGRRELLSAALTHLEAAAKLLEEAEEEVLADEARELTDKVDVVALAEA |
| Ga0075434_1002341231 | 3300006871 | Populus Rhizosphere | KPRGIAMPRAERRELLSAALTHLEAAAKLLEEAGEEVLADEARELTDKVDVVALAEAA* |
| Ga0075429_1011917682 | 3300006880 | Populus Rhizosphere | MPRAGRRELLSAALTHLEAVAKLLEEAEEEVLADEARELTDKVD |
| Ga0075426_104879733 | 3300006903 | Populus Rhizosphere | PRGIAMPRAERRELLSAALTHLEAVAKLLEEAEEEVLADEARELTDKVDVVALAEAA* |
| Ga0075424_1021925921 | 3300006904 | Populus Rhizosphere | MPRAGRRELLSAALTHLEAAAKLLEEADEEVLADEARELTDKVDVVALAEAA* |
| Ga0075436_1005640672 | 3300006914 | Populus Rhizosphere | MTRAGRRELLSAALTHLEAVAKLLEEAEEEVLADEARELTDKVDAVALAEAA* |
| Ga0075436_1012740272 | 3300006914 | Populus Rhizosphere | MTRAGRRELLSAALTHLEAAAKLLEEAEEEVLADEARELTDKVDVVALAE |
| Ga0079219_100347843 | 3300006954 | Agricultural Soil | MPRAGRRELLSAALTHLEAAAKLLEEAEEEVLADEARELTDKVDVVALAVAA* |
| Ga0105245_100599921 | 3300009098 | Miscanthus Rhizosphere | LEAAAKLLEEAEEEVLADEARELTDKVDVVALAEAA* |
| Ga0075418_109239251 | 3300009100 | Populus Rhizosphere | MTRAERTALLSAALTHLDAAAKLLEEAEEEVLAEEAQELTDKVNVVALAEAA* |
| Ga0075418_116451521 | 3300009100 | Populus Rhizosphere | LSAALTHLEAVAKLLEEAEEEVLADEARKLTDKVDVVALAEAA* |
| Ga0105247_108534352 | 3300009101 | Switchgrass Rhizosphere | MPRAERRELLSAALTQLEAVAKLLEEAEEEVLADEARELTDKVDVVAIAEAA* |
| Ga0114129_120854411 | 3300009147 | Populus Rhizosphere | LTHLEAAAKLLEEAGEEVLADEARELTDKVHVVALAEAA* |
| Ga0114129_124001781 | 3300009147 | Populus Rhizosphere | LTHLEAAAKLLEEAEEEVLADEARELTDKVDVVALAEAA* |
| Ga0114129_130328241 | 3300009147 | Populus Rhizosphere | MPRAERRELLSAALTHLEAAAKLLEEADEEVLADEARELTDKVDVVALAEAA* |
| Ga0111538_102493481 | 3300009156 | Populus Rhizosphere | LTHLEAAAKLLEEAEEEVLADEARELTDKVDAVALAEAA* |
| Ga0075423_114618161 | 3300009162 | Populus Rhizosphere | MTRAERRDLLSAALAHLEAAAKLLEETEEEVLADEARELTDKVDVVALAEAA* |
| Ga0105241_101250531 | 3300009174 | Corn Rhizosphere | RAGRRELLSAALTHLEAAAKLLEEAEEEVLADEARELTDKVDVVALAEAA* |
| Ga0105242_101547602 | 3300009176 | Miscanthus Rhizosphere | MTRAGRRELLTAALTHLEAAAKLLEEAEEEVLADEARELTDKVDVVALAEAA* |
| Ga0105248_120523151 | 3300009177 | Switchgrass Rhizosphere | MTRAERTALLSAALTHLDAAAKLLEEAEEEVLAEEAQELTDKVHVAALAEAA* |
| Ga0105238_103714602 | 3300009551 | Corn Rhizosphere | MPRAERRELLSAALTHLEAAAKLLEEAEEEVLADEARELTDKVDVVALAEAA* |
| Ga0105249_130207481 | 3300009553 | Switchgrass Rhizosphere | LGAALTHLEAAAKLLEEAEEKVLADEARELTDKVDVVALAEAA* |
| Ga0134128_102920851 | 3300010373 | Terrestrial Soil | VLKPRGIATTRAGRRELLSAALTHLEAAAKLLEEAEEEVLADEARELTDKVDVVALAEAA |
| Ga0134128_123998322 | 3300010373 | Terrestrial Soil | PRVLKPRGIAMPRAGRRELLSAALTHLEAAAKLLEEAEEEVLADEARELTDKVDVVALAEAA* |
| Ga0134128_132025981 | 3300010373 | Terrestrial Soil | LTHLDAAAKLLEEAEEEVLAEEAQELTDKVNVVALAEVA* |
| Ga0126381_1051198622 | 3300010376 | Tropical Forest Soil | MTKAERKELLTAALTHLDAAANLLEEAEEGVLAEEARELNDKVDVVALVEPA* |
| Ga0134127_136581192 | 3300010399 | Terrestrial Soil | KPRGIAMPRAGRRELLSAALTHLEAAAKLLEEAEEEILADEARELTDKVDVVALAEAA* |
| Ga0137358_105662222 | 3300012582 | Vadose Zone Soil | MTRVERRALLSAALTHLEAAAKLLEEAEEKVLADEARELTDKVDVVALAEAA* |
| Ga0157305_102483111 | 3300012891 | Soil | PGRSELLSAALTHLEAAAKLLEEADEEVLADEARELTDKVDVVALAEAA* |
| Ga0157299_101450903 | 3300012899 | Soil | AGRRELLSAALTHLEAAAKLLEEAEEEVLADEARELTDKVDVVALAEAA* |
| Ga0157288_100802322 | 3300012901 | Soil | MPRAGRRELLSAALTHLEAAAKLLEEAEEEVLADEARELTDKVDVVAIAEAA* |
| Ga0157286_104736202 | 3300012908 | Soil | AAAKLLEEAEEEVLADEARELTDKVDVVALAQAA* |
| Ga0157302_100347273 | 3300012915 | Soil | VLPSRTEAAAKLLEEAEEEVLADEARELTDKVDVVALAEAA* |
| Ga0137407_110645911 | 3300012930 | Vadose Zone Soil | QRELLSAALTHWDAAAKLLEEAEEQVLADEARELTDKVDVVALAEAA* |
| Ga0164300_100557573 | 3300012951 | Soil | MPRAGRRELLSAALTHLEAAAKLLEEAEEEVLADEARELTDKMDVVALAEAA* |
| Ga0164302_105049282 | 3300012961 | Soil | MPRAGRRELLSAALTHLEAAAKLLEEAEEEVLADEARELTDKVDVVAIAEVA* |
| Ga0164306_117138381 | 3300012988 | Soil | MPRAGRRELLSAALTHLEAVAKLLEEAEEEVLADEARELTDKVDVVAIAEAA* |
| Ga0164305_101213282 | 3300012989 | Soil | MPRAGRRELLSAAITHLEAAAKLLEEAEEEVLADEARELTDKVDVVALAEAA* |
| Ga0157307_10134131 | 3300013096 | Soil | MPRAGRRELLSAALTHLEAAAKLLEEADEEVLADEARELTDKVDVVAIAEAA* |
| Ga0157371_104101881 | 3300013102 | Corn Rhizosphere | MTRAGRRELLSAALAHLEAAAKLLEEAEEEVLADEARELTDKVDVVALAEAA* |
| Ga0157374_108098541 | 3300013296 | Miscanthus Rhizosphere | VLKPRGIAMPRAGRRELLSAALTHLEAVAKLLEEAEEEVLADEARELTDKVDVVAIAEAA |
| Ga0163162_100418304 | 3300013306 | Switchgrass Rhizosphere | VLEPRGIAMPRAERRELLSAALTHLEAVAKLLEEAEEEVLADEARELTDKVDVVAIAEAA |
| Ga0163162_102353184 | 3300013306 | Switchgrass Rhizosphere | MPRAGRRELLSAALTHLEAAAKLLEEAEEEVLADEARELTDKVHVVALAEAA* |
| Ga0157376_105391772 | 3300014969 | Miscanthus Rhizosphere | MPRAERRELLSAALTHLEAVAKLLEEAEEEVLADEARELTDKVDVVAIA |
| Ga0173483_101360103 | 3300015077 | Soil | LLSAALTHLEAVAKLLEEAEEEVLADEARELTDKVDVVAIAEAA* |
| Ga0132258_113338823 | 3300015371 | Arabidopsis Rhizosphere | MTRAGRRELLSAALTHLEAAAKLLEEAEEEVLAEEAQELTDKVNVVALAEVA* |
| Ga0132258_119504833 | 3300015371 | Arabidopsis Rhizosphere | SVLEPRGIAMPRAERRELLSAALTHLEAAAKLLEEADEEVLADEARELTDKVDVVALAEAA* |
| Ga0132257_1046356922 | 3300015373 | Arabidopsis Rhizosphere | MTRAERRELLTAALMHLDVAANLLEEAEEGVLAEEARELNDKVDVVALVEPA* |
| Ga0132255_1008625462 | 3300015374 | Arabidopsis Rhizosphere | MPRAERRELLSAALTHLEAAAKLLEEAEEELLADKARELTDKVDVVALEEAA* |
| Ga0132255_1017706852 | 3300015374 | Arabidopsis Rhizosphere | LEAAAKLLEEAEEEVLAEEAQELTDKVNVVALAEVA* |
| Ga0190272_103726052 | 3300018429 | Soil | LEAVAKLLQEADEEVLADEAGELAHKVDVVAIAKAA |
| Ga0173481_100071745 | 3300019356 | Soil | MPRAGRRELLSAALTHLEAAAKLLEEAEEEVLADEARELTDKVDVVALAEAA |
| Ga0173479_100162263 | 3300019362 | Soil | MPRAGRRELLSAALTHLEAAAKLLEEAEEEVLADEARERTDKVDVVALAEAA |
| Ga0197907_103680333 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | GPRVLKPRGIAMTRAGRRELLSAALTHLEAAAKLLEEAEEEVLADEARELTDKVDVVALAEAA |
| Ga0206356_112573622 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | LKPRGIAMTRAGRRELLSAALTHLEAAAKLLEEAEEEVLADEARELTDKVDVVALAEAA |
| Ga0206352_111080213 | 3300020078 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRAGRRELLSAALTHLEAAAKLLEEAEEEVLADEARELTDKVDVVALAEAA |
| Ga0206350_104983373 | 3300020080 | Corn, Switchgrass And Miscanthus Rhizosphere | VLEPRGIAMPRAERRELLSAALTHLEAVAKLLEEAEEEVLADEARELTDKVDVVALAEAA |
| Ga0206354_113280493 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | PRVLKPRGIAMPRAGRRELLSAALTHLEAAAKLLEEAEEEVLADEARELTDKVDVVALAEAA |
| Ga0126371_119383451 | 3300021560 | Tropical Forest Soil | MTRAERRELLTTALTHLDAAANLLQEAEEEVLAEEARELNDKVDVVALAEPASPHAV |
| Ga0224712_100886594 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | PRVLKPRGIAMTRAGRRELLSAALAHLEAAAKLLEEAEEEVLADEARELTDKVDVVALAEAA |
| Ga0247746_10517692 | 3300022886 | Soil | MPRAGRRELLSAALTHLEAAAKLLEEAEEEVLADEARELTDKVDVVAIAEAA |
| Ga0247797_10559781 | 3300023057 | Soil | LSAALTHLEAAAKLLEEAEEEVLADEARELTDKVDVVALAEAA |
| Ga0247793_10193202 | 3300023066 | Soil | MPRAGPRELLSAALTHLEAAAKLLEEAEEEVLADEARELTDKVDVVALAEAA |
| Ga0247744_10813421 | 3300023073 | Soil | THLEAAAKLLEEAEEEVLADEARELTDKVDVVALAEAA |
| Ga0247802_10199942 | 3300023077 | Soil | MPRAERRELLSAALTHLEAAAKLLEEAEEEVLADEARELTDKVDVVALAEAA |
| Ga0247800_10460601 | 3300023263 | Soil | MPRAERRELLSAALTHLEAVAKLLEEGEEEVLADEARELTDKVDVVAIAEAA |
| Ga0207654_108772791 | 3300025911 | Corn Rhizosphere | RAGRRELLSAALTHLEAAAKLLEEAEEEVLADEARELTDKVDVVALAEAA |
| Ga0207695_103817351 | 3300025913 | Corn Rhizosphere | KPRGIAMPRAGRRELLSAALTHLEAAAKLLEEAEEEVLADEARELTDKVDVVALAEAA |
| Ga0207662_100747934 | 3300025918 | Switchgrass Rhizosphere | RGIAMPRAERRELLSAALTHLEAAAKLLEEADEEVLADEARELTDKVDVVALAEAA |
| Ga0207649_107134001 | 3300025920 | Corn Rhizosphere | AMTRAGRRELLSAALTHLEAAAKLLEEAEEEVLADEARELTDKVDVVALAEAA |
| Ga0207681_118425291 | 3300025923 | Switchgrass Rhizosphere | AGRRELLSAALTHLEAAAKLLEEAEEEVLADEARELTDKVDVVALAEAA |
| Ga0207650_101705221 | 3300025925 | Switchgrass Rhizosphere | MPRAGRRELLSAALTHLEAAAKLLEEAEEEVLADEARELTDKVDVVALAEA |
| Ga0207650_101753203 | 3300025925 | Switchgrass Rhizosphere | MTRAGRRELLSAALTHLEAAAKLLEEAEEEVLADEARELTDKWTLWP |
| Ga0207670_101425583 | 3300025936 | Switchgrass Rhizosphere | MTRAGRRELLSAALTHLEAAAKLLEEAEEEVLADEARELTDKVDVV |
| Ga0207691_101206021 | 3300025940 | Miscanthus Rhizosphere | LLSAALTHLEAAAKLLEEAEEEVLADEARELTDKVDVVALAEAA |
| Ga0207651_105261591 | 3300025960 | Switchgrass Rhizosphere | SAALTHLEAAAKLLEEAEEEVLADEARELTDKVDVVALAEAA |
| Ga0207712_104528473 | 3300025961 | Switchgrass Rhizosphere | MPRAERRELLSAALTHLEAVAKLLEEAEEEVLADEARELTDKVDVV |
| Ga0207668_113446151 | 3300025972 | Switchgrass Rhizosphere | LTHLEAAAKLLEEAEEEVLADEARELTDKVDVVALAEAA |
| Ga0207677_102443203 | 3300026023 | Miscanthus Rhizosphere | RELLSAALTHLEAAAKLLEEAEEEVLADEARELTDKVDVVALAEAA |
| Ga0207708_120308891 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MPRAERRELLSAALTHLEAVAKLLEEAEEEVLADEARELTDKVD |
| Ga0207702_106247633 | 3300026078 | Corn Rhizosphere | GIAMPRAGRRELLSAALTHLEAAAKLLEEAEEEVLADEARELTDKVDVVALAEAA |
| Ga0207675_1000508985 | 3300026118 | Switchgrass Rhizosphere | MTRAGRRELLTAALTHLEAAAKLLEEAEEEVLADEARELTDKVDVVALAEAA |
| Ga0207586_1047762 | 3300026814 | Soil | MPRAERRELLSAALTHLEAVAKLLKEAEEEVLADEARELTDKVDVVALAEAA |
| Ga0209177_100291533 | 3300027775 | Agricultural Soil | MTRAERTALLSAALTHLDAAAKLLEEAEEEVLAEEAQELTDKVNVVALAEAA |
| Ga0209177_100688002 | 3300027775 | Agricultural Soil | MPRAGRRELLSAALTHLEAAAKLLEEAEEEVLADEARELTDKVDVVALAVAA |
| Ga0207428_100710746 | 3300027907 | Populus Rhizosphere | RRELLSAALTHLEAAAKLLEEAEEEVLADEARELTDKVDVVALAEAA |
| Ga0207428_103628861 | 3300027907 | Populus Rhizosphere | MPRAGRRELLSAALTHLEAAAKLLEEAEEEILADEARELTDKVDVVALAEAA |
| Ga0207428_109720392 | 3300027907 | Populus Rhizosphere | IAMPRAERRELLSAALTHLEAVAKLLEEAEEEVLADEARELTDKVDVVALAEAA |
| Ga0310887_110664491 | 3300031547 | Soil | ALTHLEAAAKLLEEAEEEVLADEARELTDKVDVVALAEAA |
| Ga0310813_102615711 | 3300031716 | Soil | MTRVERRELLSAALTHLEAAAKLLEEAEEQVLADEARELTDKVDVVALAEAA |
| Ga0310813_108053201 | 3300031716 | Soil | MPRAERRELLSAALTHLEAAAKLLEEADEEVLADEARELTDKVDVVAIAEAA |
| Ga0307468_1007584861 | 3300031740 | Hardwood Forest Soil | MPRAGRRELLSAALTHLEAAAKLLEEAEEEVLADEARELTDKVDVGAIAEAA |
| Ga0310893_100636423 | 3300031892 | Soil | ERGPRVLKPRGIAMTRAGRRELLSAALTHLEAAAKLLEEAEEEVLADEARELTDKVDVVALAEAA |
| Ga0373958_0022748_232_342 | 3300034819 | Rhizosphere Soil | LEAAAKLLEEAEEEVLADEARELTDKVDVVALAEAA |
| ⦗Top⦘ |