Metagenome / Metatranscriptome Family F056098

Basic Information
Family ID	F056098
Family Type	Metagenome / Metatranscriptome
Number of Sequences	138
Average Sequence Length	39 residues
Representative Sequence	IMYIQRRHWLDYDPVALAVLVIGIGMIELLALII
Number of Associated Samples	113
Number of Associated Scaffolds	138

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	24.63 %
% of genes near scaffold ends (potentially truncated)	71.74 %
% of genes from short scaffolds (< 2000 bps)	90.58 %
Associated GOLD sequencing projects	109
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.45

Most Common Taxonomy
Group	Bacteria (85.507 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (15.942 % of family members)
Environment Ontology (ENVO)	Unclassified (21.739 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (42.754 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 32.26% β-sheet: 0.00% Coil/Unstructured: 67.74%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 138 Family Scaffolds
PF00072	Response_reg	6.52
PF11026	DUF2721	2.17
PF04392	ABC_sub_bind	2.17
PF01925	TauE	1.45
PF13545	HTH_Crp_2	1.45
PF12706	Lactamase_B_2	1.45
PF02839	CBM_5_12	0.72
PF04430	DUF498	0.72
PF05598	DUF772	0.72
PF07750	GcrA	0.72
PF07045	DUF1330	0.72
PF02371	Transposase_20	0.72
PF08734	GYD	0.72
PF09351	DUF1993	0.72
PF13561	adh_short_C2	0.72
PF01381	HTH_3	0.72
PF00589	Phage_integrase	0.72
PF13505	OMP_b-brl	0.72

COG ID	Name	Functional Category	% Frequency in 138 Family Scaffolds
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	2.17
COG0730	Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family	Inorganic ion transport and metabolism [P]	1.45
COG1504	Uncharacterized conserved protein, DUF498 domain	Function unknown [S]	0.72
COG3547	Transposase	Mobilome: prophages, transposons [X]	0.72
COG3737	Uncharacterized protein, contains Mth938-like domain	Function unknown [S]	0.72
COG4274	Uncharacterized conserved protein, contains GYD domain	Function unknown [S]	0.72
COG5352	Uncharacterized conserved protein	Function unknown [S]	0.72
COG5470	Uncharacterized conserved protein, DUF1330 family	Function unknown [S]	0.72

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	85.51 %
Unclassified	root	N/A	14.49 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	85.51 %
Unclassified	root	N/A	14.49 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	85.51 %
Unclassified	root	N/A	14.49 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	77.54 %
Unclassified	root	N/A	14.49 %
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	1.45 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	68.12 %
Unclassified	root	N/A	14.49 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	1.45 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.72 %

Name	Rank	Taxonomy	Distribution
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	58.70 %
Unclassified	root	N/A	14.49 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2.90 %
Patescibacteria group	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group	1.45 %
Rhodobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales	0.72 %
unclassified Betaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria	0.72 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	57.25 %
Unclassified	root	N/A	14.49 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	2.17 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	1.45 %
Parcubacteria group	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group	1.45 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.72 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.72 %
Rhodobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae	0.72 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	57.25 %
Unclassified	root	N/A	14.49 %
Candidatus Kaiserbacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Kaiserbacteria	1.45 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	1.45 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.72 %
Nitrobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter	0.72 %
Rhodovulum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum	0.72 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.72 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.72 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	57.25 %
Unclassified	root	N/A	14.49 %
Candidatus Kaiserbacteria bacterium RIFCSPHIGHO2_02_FULL_55_25	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Kaiserbacteria → Candidatus Kaiserbacteria bacterium RIFCSPHIGHO2_02_FULL_55_25	1.45 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	1.45 %
unclassified Rhodovulum	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum	0.72 %
Nitrobacter hamburgensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter → Nitrobacter hamburgensis	0.72 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.72 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.72 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.72 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	57.25 %
Unclassified	root	N/A	14.49 %
Candidatus Kaiserbacteria bacterium RIFCSPHIGHO2_02_FULL_55_25	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Kaiserbacteria → Candidatus Kaiserbacteria bacterium RIFCSPHIGHO2_02_FULL_55_25	1.45 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	1.45 %
Rhodovulum sp. PH10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	0.72 %
Nitrobacter hamburgensis X14	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter → Nitrobacter hamburgensis → Nitrobacter hamburgensis X14	0.72 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.72 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.72 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.72 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000156\|NODE_c0568689	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1366	Open in IMG/M
3300000655\|AF_2010_repII_A100DRAFT_1039286	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	859	Open in IMG/M
3300000655\|AF_2010_repII_A100DRAFT_1070219	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	618	Open in IMG/M
3300000956\|JGI10216J12902_105079792	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	978	Open in IMG/M
3300002910\|JGI25615J43890_1049611	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	690	Open in IMG/M
3300004463\|Ga0063356_102712738	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	762	Open in IMG/M
3300005174\|Ga0066680_10152962	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1443	Open in IMG/M
3300005179\|Ga0066684_10591967	All Organisms → cellular organisms → Bacteria → Proteobacteria	744	Open in IMG/M
3300005332\|Ga0066388_101079202	All Organisms → cellular organisms → Bacteria	1356	Open in IMG/M
3300005332\|Ga0066388_102027873	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1032	Open in IMG/M
3300005437\|Ga0070710_10094220	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1771	Open in IMG/M
3300005447\|Ga0066689_10850363	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	565	Open in IMG/M
3300005467\|Ga0070706_101599221	All Organisms → cellular organisms → Bacteria → Proteobacteria	595	Open in IMG/M
3300005540\|Ga0066697_10382224	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	818	Open in IMG/M
3300005543\|Ga0070672_102082809	Not Available	511	Open in IMG/M
3300005559\|Ga0066700_10667424	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	717	Open in IMG/M
3300005559\|Ga0066700_11093640	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	521	Open in IMG/M
3300005587\|Ga0066654_10665819	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	581	Open in IMG/M
3300005618\|Ga0068864_101746599	All Organisms → cellular organisms → Bacteria → Proteobacteria	627	Open in IMG/M
3300005713\|Ga0066905_100243240	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1377	Open in IMG/M
3300005764\|Ga0066903_100951632	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1562	Open in IMG/M
3300005764\|Ga0066903_101292217	Not Available	1362	Open in IMG/M
3300005764\|Ga0066903_102860109	All Organisms → cellular organisms → Bacteria → Proteobacteria	936	Open in IMG/M
3300005764\|Ga0066903_103667429	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	826	Open in IMG/M
3300005764\|Ga0066903_105492796	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	668	Open in IMG/M
3300005764\|Ga0066903_107184443	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	576	Open in IMG/M
3300005764\|Ga0066903_107848428	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	548	Open in IMG/M
3300005843\|Ga0068860_100054979	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	3783	Open in IMG/M
3300006028\|Ga0070717_10074789	All Organisms → cellular organisms → Bacteria → Proteobacteria	2832	Open in IMG/M
3300006032\|Ga0066696_10932887	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	552	Open in IMG/M
3300006058\|Ga0075432_10183985	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	819	Open in IMG/M
3300006163\|Ga0070715_10567087	Not Available	660	Open in IMG/M
3300006175\|Ga0070712_100218020	All Organisms → cellular organisms → Bacteria	1509	Open in IMG/M
3300006175\|Ga0070712_100932515	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	749	Open in IMG/M
3300006794\|Ga0066658_10545172	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	630	Open in IMG/M
3300006844\|Ga0075428_102495043	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	530	Open in IMG/M
3300006880\|Ga0075429_100347701	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	1298	Open in IMG/M
3300006969\|Ga0075419_11464926	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	511	Open in IMG/M
3300007258\|Ga0099793_10151932	All Organisms → cellular organisms → Bacteria	1097	Open in IMG/M
3300007258\|Ga0099793_10655570	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	528	Open in IMG/M
3300009090\|Ga0099827_10847572	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	791	Open in IMG/M
3300009137\|Ga0066709_101519466	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	965	Open in IMG/M
3300009553\|Ga0105249_13416673	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	511	Open in IMG/M
3300009792\|Ga0126374_10041278	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2264	Open in IMG/M
3300010043\|Ga0126380_10215700	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1298	Open in IMG/M
3300010043\|Ga0126380_10924003	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	727	Open in IMG/M
3300010147\|Ga0126319_1545921	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	558	Open in IMG/M
3300010360\|Ga0126372_10007239	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	5590	Open in IMG/M
3300010360\|Ga0126372_10637546	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1029	Open in IMG/M
3300010361\|Ga0126378_11379031	Not Available	798	Open in IMG/M
3300010398\|Ga0126383_10799165	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1026	Open in IMG/M
3300012201\|Ga0137365_10670987	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	758	Open in IMG/M
3300012202\|Ga0137363_10116082	All Organisms → cellular organisms → Bacteria	2058	Open in IMG/M
3300012204\|Ga0137374_10914553	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	643	Open in IMG/M
3300012205\|Ga0137362_10046591	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3513	Open in IMG/M
3300012209\|Ga0137379_10206987	All Organisms → cellular organisms → Bacteria	1875	Open in IMG/M
3300012210\|Ga0137378_11172245	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	684	Open in IMG/M
3300012210\|Ga0137378_11827488	All Organisms → cellular organisms → Bacteria → Proteobacteria	511	Open in IMG/M
3300012212\|Ga0150985_106650954	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	519	Open in IMG/M
3300012212\|Ga0150985_109019165	All Organisms → cellular organisms → Bacteria → Proteobacteria	773	Open in IMG/M
3300012212\|Ga0150985_114330268	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	571	Open in IMG/M
3300012212\|Ga0150985_114950020	Not Available	640	Open in IMG/M
3300012212\|Ga0150985_118715003	Not Available	573	Open in IMG/M
3300012212\|Ga0150985_119878672	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter → Nitrobacter hamburgensis → Nitrobacter hamburgensis X14	765	Open in IMG/M
3300012285\|Ga0137370_10681624	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	638	Open in IMG/M
3300012353\|Ga0137367_11187052	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	511	Open in IMG/M
3300012358\|Ga0137368_10686537	All Organisms → cellular organisms → Bacteria → Proteobacteria	645	Open in IMG/M
3300012359\|Ga0137385_10185088	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1823	Open in IMG/M
3300012362\|Ga0137361_10551806	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1057	Open in IMG/M
3300012362\|Ga0137361_11881241	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	515	Open in IMG/M
3300012371\|Ga0134022_1112339	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	571	Open in IMG/M
3300012469\|Ga0150984_108918861	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	792	Open in IMG/M
3300012469\|Ga0150984_110526205	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1151	Open in IMG/M
3300012582\|Ga0137358_10393731	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	937	Open in IMG/M
3300012922\|Ga0137394_10159051	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1924	Open in IMG/M
3300012955\|Ga0164298_10434386	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	859	Open in IMG/M
3300012957\|Ga0164303_11415182	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	521	Open in IMG/M
3300012985\|Ga0164308_10576983	Not Available	953	Open in IMG/M
3300012987\|Ga0164307_10734547	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	777	Open in IMG/M
3300014325\|Ga0163163_11634386	All Organisms → cellular organisms → Bacteria	705	Open in IMG/M
3300014968\|Ga0157379_12213092	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	546	Open in IMG/M
3300015373\|Ga0132257_101553031	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	846	Open in IMG/M
3300016319\|Ga0182033_11317525	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	649	Open in IMG/M
3300016387\|Ga0182040_10553341	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	926	Open in IMG/M
3300017792\|Ga0163161_10338332	All Organisms → cellular organisms → Bacteria	1193	Open in IMG/M
3300017965\|Ga0190266_11108492	Not Available	540	Open in IMG/M
3300018000\|Ga0184604_10057136	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	1097	Open in IMG/M
3300018067\|Ga0184611_1205543	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	700	Open in IMG/M
3300018469\|Ga0190270_10673647	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1021	Open in IMG/M
3300018482\|Ga0066669_11814243	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	564	Open in IMG/M
3300018482\|Ga0066669_12184788	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	524	Open in IMG/M
3300020001\|Ga0193731_1059270	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	1005	Open in IMG/M
3300020170\|Ga0179594_10161392	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	832	Open in IMG/M
3300020579\|Ga0210407_11418629	All Organisms → cellular organisms → Bacteria → Proteobacteria	515	Open in IMG/M
3300021178\|Ga0210408_10950944	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	667	Open in IMG/M
3300025910\|Ga0207684_10144661	Not Available	2045	Open in IMG/M
3300025961\|Ga0207712_10994665	All Organisms → cellular organisms → Bacteria → Proteobacteria	744	Open in IMG/M
3300026324\|Ga0209470_1064212	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1724	Open in IMG/M
3300026343\|Ga0209159_1276101	All Organisms → cellular organisms → Bacteria	512	Open in IMG/M
3300026377\|Ga0257171_1016209	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1244	Open in IMG/M
3300026528\|Ga0209378_1067863	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1652	Open in IMG/M
3300027874\|Ga0209465_10308701	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	792	Open in IMG/M
3300027882\|Ga0209590_10706286	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	645	Open in IMG/M
3300028047\|Ga0209526_10389520	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	927	Open in IMG/M
3300028721\|Ga0307315_10078477	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	951	Open in IMG/M
3300028809\|Ga0247824_10623710	Not Available	650	Open in IMG/M
3300028819\|Ga0307296_10492117	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	671	Open in IMG/M
3300028878\|Ga0307278_10294096	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	718	Open in IMG/M
3300028881\|Ga0307277_10003696	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	5875	Open in IMG/M
3300029636\|Ga0222749_10312864	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	815	Open in IMG/M
3300030829\|Ga0308203_1033059	All Organisms → cellular organisms → Bacteria → Proteobacteria	729	Open in IMG/M
3300031058\|Ga0308189_10357240	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	590	Open in IMG/M
3300031091\|Ga0308201_10161958	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	710	Open in IMG/M
3300031094\|Ga0308199_1168189	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	534	Open in IMG/M
3300031446\|Ga0170820_16204282	All Organisms → cellular organisms → Bacteria → Proteobacteria	539	Open in IMG/M
3300031545\|Ga0318541_10260315	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	964	Open in IMG/M
3300031573\|Ga0310915_10044994	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2827	Open in IMG/M
3300031736\|Ga0318501_10694756	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	561	Open in IMG/M
3300031777\|Ga0318543_10349681	Not Available	662	Open in IMG/M
3300031796\|Ga0318576_10047341	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1851	Open in IMG/M
3300031835\|Ga0318517_10105929	Not Available	1237	Open in IMG/M
3300031835\|Ga0318517_10426665	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	599	Open in IMG/M
3300031880\|Ga0318544_10041574	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1635	Open in IMG/M
3300031890\|Ga0306925_10632537	Not Available	1127	Open in IMG/M
3300031893\|Ga0318536_10449212	All Organisms → cellular organisms → Bacteria	649	Open in IMG/M
3300031912\|Ga0306921_10964287	Not Available	964	Open in IMG/M
3300031945\|Ga0310913_10736559	Not Available	696	Open in IMG/M
3300031945\|Ga0310913_11033089	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	575	Open in IMG/M
3300031946\|Ga0310910_11453981	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	526	Open in IMG/M
3300031947\|Ga0310909_11087071	Not Available	650	Open in IMG/M
3300031954\|Ga0306926_10466494	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Kaiserbacteria → Candidatus Kaiserbacteria bacterium RIFCSPHIGHO2_02_FULL_55_25	1554	Open in IMG/M
3300031981\|Ga0318531_10212277	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	872	Open in IMG/M
3300032065\|Ga0318513_10073706	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Kaiserbacteria → Candidatus Kaiserbacteria bacterium RIFCSPHIGHO2_02_FULL_55_25	1566	Open in IMG/M
3300033290\|Ga0318519_10856688	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	560	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	83.33%
Host-Associated	Host-Associated	15.94%
Engineered	Engineered	0.72%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	81.16%
Plants	Host-Associated → Plants	15.94%
Aquatic	Environmental → Aquatic	2.17%
Solid Waste	Engineered → Solid Waste	0.72%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	81.16%
Rhizosphere	Host-Associated → Plants → Rhizosphere	7.25%
Rhizoplane	Host-Associated → Plants → Rhizoplane	7.97%
Sediment	Environmental → Aquatic → Sediment	1.45%
Freshwater	Environmental → Aquatic → Freshwater	0.72%
Roots	Host-Associated → Plants → Roots	0.72%
Grass	Engineered → Solid Waste → Grass	0.72%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	66.67%
Loam	Environmental → Terrestrial → Soil → Loam	14.49%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	5.07%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	5.07%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	2.90%
Soil	Host-Associated → Plants → Rhizosphere → Soil	2.17%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	1.45%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	0.72%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.72%
Composting	Engineered → Solid Waste → Grass → Composting	0.72%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	32.61%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	21.01%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	12.32%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	9.42%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	5.07%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	5.07%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	5.07%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	2.90%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	2.17%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	1.45%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	0.72%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	0.72%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.72%
Bioreactor	Engineered → Solid Waste → Grass → Composting → Bioreactor	0.72%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	15.22%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	15.94%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	10.87%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	9.42%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	8.70%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	5.07%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	5.07%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	4.35%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	3.62%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	2.90%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	2.90%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	2.17%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	1.45%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.45%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.45%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	1.45%
Soil	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil	0.72%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.72%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	0.72%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.72%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.72%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	0.72%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.72%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.72%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.72%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.72%
Sugar Cane Bagasse Incubating Bioreactor	Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor	0.72%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000156	Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic	Engineered	Open in IMG/M
3300000655	Forest soil microbial communities from Amazon forest - 2010 replicate II A100	Environmental	Open in IMG/M
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental	Open in IMG/M
3300002910	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm	Environmental	Open in IMG/M
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated	Open in IMG/M
3300005174	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129	Environmental	Open in IMG/M
3300005179	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Environmental	Open in IMG/M
3300005447	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138	Environmental	Open in IMG/M
3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Environmental	Open in IMG/M
3300005540	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146	Environmental	Open in IMG/M
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated	Open in IMG/M
3300005559	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149	Environmental	Open in IMG/M
3300005587	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103	Environmental	Open in IMG/M
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Environmental	Open in IMG/M
3300006032	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145	Environmental	Open in IMG/M
3300006058	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Host-Associated	Open in IMG/M
3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Environmental	Open in IMG/M
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental	Open in IMG/M
3300006794	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107	Environmental	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006880	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Host-Associated	Open in IMG/M
3300006969	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3	Host-Associated	Open in IMG/M
3300007258	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3	Environmental	Open in IMG/M
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010147	Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300012096	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG	Environmental	Open in IMG/M
3300012201	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG	Environmental	Open in IMG/M
3300012202	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG	Environmental	Open in IMG/M
3300012204	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG	Environmental	Open in IMG/M
3300012205	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG	Environmental	Open in IMG/M
3300012209	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG	Environmental	Open in IMG/M
3300012210	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012285	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG	Environmental	Open in IMG/M
3300012353	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG	Environmental	Open in IMG/M
3300012358	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG	Environmental	Open in IMG/M
3300012359	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG	Environmental	Open in IMG/M
3300012362	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG	Environmental	Open in IMG/M
3300012371	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_0_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated	Open in IMG/M
3300012582	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG	Environmental	Open in IMG/M
3300012922	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG	Environmental	Open in IMG/M
3300012955	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG	Environmental	Open in IMG/M
3300012957	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG	Environmental	Open in IMG/M
3300012985	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG	Environmental	Open in IMG/M
3300012987	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG	Environmental	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300016319	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H	Environmental	Open in IMG/M
3300016387	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176	Environmental	Open in IMG/M
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated	Open in IMG/M
3300017965	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T	Environmental	Open in IMG/M
3300018000	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex	Environmental	Open in IMG/M
3300018067	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex	Environmental	Open in IMG/M
3300018469	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T	Environmental	Open in IMG/M
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental	Open in IMG/M
3300019789	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)	Environmental	Open in IMG/M
3300020001	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2	Environmental	Open in IMG/M
3300020170	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300020579	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M	Environmental	Open in IMG/M
3300021178	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M	Environmental	Open in IMG/M
3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026324	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)	Environmental	Open in IMG/M
3300026343	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes)	Environmental	Open in IMG/M
3300026377	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B	Environmental	Open in IMG/M
3300026528	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes)	Environmental	Open in IMG/M
3300027680	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes)	Environmental	Open in IMG/M
3300027874	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)	Environmental	Open in IMG/M
3300027882	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300028047	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)	Environmental	Open in IMG/M
3300028721	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355	Environmental	Open in IMG/M
3300028809	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48	Environmental	Open in IMG/M
3300028819	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153	Environmental	Open in IMG/M
3300028878	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117	Environmental	Open in IMG/M
3300028881	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116	Environmental	Open in IMG/M
3300029636	Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030829	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_357 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031058	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031091	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031094	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031446	Fir Summer Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031545	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26	Environmental	Open in IMG/M
3300031573	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111	Environmental	Open in IMG/M
3300031736	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21	Environmental	Open in IMG/M
3300031777	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24	Environmental	Open in IMG/M
3300031796	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24	Environmental	Open in IMG/M
3300031835	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21	Environmental	Open in IMG/M
3300031880	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25	Environmental	Open in IMG/M
3300031890	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)	Environmental	Open in IMG/M
3300031893	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28	Environmental	Open in IMG/M
3300031912	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)	Environmental	Open in IMG/M
3300031945	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082	Environmental	Open in IMG/M
3300031946	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172	Environmental	Open in IMG/M
3300031947	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H	Environmental	Open in IMG/M
3300031954	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)	Environmental	Open in IMG/M
3300031981	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25	Environmental	Open in IMG/M
3300032065	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20	Environmental	Open in IMG/M
3300033290	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.45
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.45
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F056098

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
NODE_05686895	3300000156	Sugar Cane Bagasse Incubating Bioreactor	RIMYIQRRHWLDYDPVAFTVLVLGIGVVELLALII*
AF_2010_repII_A100DRAFT_10392863	3300000655	Forest Soil	ETSNRLTATMYVQRPHWLDYDPVALAVLVIGIGIIELLALII*
AF_2010_repII_A100DRAFT_10702191	3300000655	Forest Soil	VQTTYVQKPHWLDYDPVALAVLVIGIGIIELLALII*
JGI10216J12902_1050797922	3300000956	Soil	MTGRRVMYIQRRHWLDYDPVALAVLVIGIAIIELLALII*
JGI25615J43890_10496112	3300002910	Grasslands Soil	MYIRTDVNRRTGWRIMYIQRRHWLDYDPVALAVLVIGIGMIELLALII*
Ga0063356_1027127382	3300004463	Arabidopsis Thaliana Rhizosphere	NRRTGWRIMYIQRRHWLDYDSVALAVLVIGIGVIELLAWGI*
Ga0066680_101529623	3300005174	Soil	VNRRTGWRIMYIQRRHWLDYDPVALAVLVIGIGMIELLAMII*
Ga0066684_105919671	3300005179	Soil	RTGWRIMYIQRRHWLDYDPVALAVLVIGIGMIELLALII*
Ga0066388_1010792021	3300005332	Tropical Forest Soil	TGNRSRATMYVQKPHWLDYDPVALAVLVIGIGIIELLALII*
Ga0066388_1020278731	3300005332	Tropical Forest Soil	ATTYVQTMHVQKPHWLDYDPVALAVLVIGIGIIELLALII*
Ga0070710_100942203	3300005437	Corn, Switchgrass And Miscanthus Rhizosphere	VNRRTGWRIMYIQRWHWLDYDPVALAVLAIGIGMIEVLALII*
Ga0066689_108503632	3300005447	Soil	VNRRTGWRIMYIQRRHWLDYDSVALAVLVIGIGVIELLAWGI*
Ga0070706_1015992211	3300005467	Corn, Switchgrass And Miscanthus Rhizosphere	RTGWRIMYIQRRHWLDYDPVAFAVLVLGIGMVELLALII*
Ga0066697_103822241	3300005540	Soil	RIMYIQRRHWLDYDPVALAALVIGIGIIELLALII*
Ga0070672_1020828091	3300005543	Miscanthus Rhizosphere	DSFKGRFQVMHTQRQHWLDYDPVALAVLVIGMIGLLALTI*
Ga0066700_106674242	3300005559	Soil	VNRRTGQRIMYIQRRHWLDYDPVALAALVIGIGIIELLALII*
Ga0066700_110936402	3300005559	Soil	VNRRTGWRIMYIQRRHWLDYDPVALAVLVIGIGVIELLAWGI*
Ga0066654_106658192	3300005587	Soil	NRRTGWRIMYIQRRHWLDYDPVALAVLVIGIGMIELLALII*
Ga0068864_1017465991	3300005618	Switchgrass Rhizosphere	MHILRRHWLDYDPVALAVLVIGIGMIELLAWGIW*
Ga0066905_1002432402	3300005713	Tropical Forest Soil	VTHDLVGHVNRRTGRRIVYIQRRHWLDYDPVALAVLAIGIGMVELLALIL*
Ga0066903_1009516323	3300005764	Tropical Forest Soil	MYAQGPHWLDYDPIALAVLVIGIASFELLALMMI*
Ga0066903_1012922173	3300005764	Tropical Forest Soil	MDHPQKRYLLDYDPVAFAVLVIGIGMVELLALSW*
Ga0066903_1028601092	3300005764	Tropical Forest Soil	MMSRVRVTRRTGWRIMYIERRHWLDYDPVAFTVLVLGIGMVELLALII*
Ga0066903_1036674291	3300005764	Tropical Forest Soil	HVNRRTGWCIMYIQRPHWLDYDPVALAVLVIGIGIIELLALII*
Ga0066903_1054927962	3300005764	Tropical Forest Soil	MGNRLTATMYAQRPHWLDYDPVALAVLVIGIGIIELLALII*
Ga0066903_1071844432	3300005764	Tropical Forest Soil	MYAQTMHVQKPHWLDYDPVAPAVLVIGIGIIELLALII*
Ga0066903_1078484281	3300005764	Tropical Forest Soil	VMYIQRRHWLDYDPVALAVLVIGIGIIELLALII*
Ga0068860_1000549796	3300005843	Switchgrass Rhizosphere	MHLLRRHWLDYDPVALAVLVIGIGMIELLAWGIW*
Ga0070717_100747899	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MYAQTMHVQKPHWLDYDPVALAVLVIGIGIIELLALII*
Ga0066696_109328871	3300006032	Soil	IRMNLQKRYWLDYDPVALAVLVVGIGMIELLAFNI*
Ga0075432_101839852	3300006058	Populus Rhizosphere	MHILRRHWLDYDPVALAVLVIGIGMIELLAWGFW*
Ga0070715_105670874	3300006163	Corn, Switchgrass And Miscanthus Rhizosphere	RIMYIQRWHWLDYDPVALAVLAIGIGMIELLALII*
Ga0070712_1002180203	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	MHILRRHWLDYDPVALAVLVIGIGMIELLAWSIW*
Ga0070712_1009325151	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	DDVNRRTGWRIMYIQRWHWLDYDPVALAVLAIGIGMIEVLALII*
Ga0066658_105451722	3300006794	Soil	PTHVNRRTGKRIMYIQRRHWLDYDPVALAALVIGIGIIELLALII*
Ga0075428_1024950432	3300006844	Populus Rhizosphere	VNRRTGWRIMYMQRWHWLDYDPVALAVLAIGIGMIELLALII*
Ga0075429_1003477014	3300006880	Populus Rhizosphere	RFQVMHTQKQHWLDYDPVALAVLVIGMIGLLALTI*
Ga0075419_114649262	3300006969	Populus Rhizosphere	MYILQRRHWLDYDPVALAVLVIGIGIIELLALII*
Ga0099793_101519324	3300007258	Vadose Zone Soil	HDLSRTDVNRRTGWRIMYIQRRHWLDYDPVAFAVLVLGIGMVELLALII*
Ga0099793_106555701	3300007258	Vadose Zone Soil	MHTQRRHWLDYDPVALAVLVIGIGTIELLAWGIW*
Ga0099827_108475721	3300009090	Vadose Zone Soil	IMYIQRRHWLDYDPVALAVLVIGIGIIELLALII*
Ga0066709_1015194663	3300009137	Grasslands Soil	MYAQTMHVQKPHWLDYNPVAPAVLVIRIGIIELLALII*
Ga0105249_134166731	3300009553	Switchgrass Rhizosphere	IMYIQRRHWLDYDPVALAVLVIGIGMIELLALII*
Ga0126374_100412784	3300009792	Tropical Forest Soil	RRTGWRIMYIQRRHWLDYDPVAFAAVVVGFAMIELLAFII*
Ga0126380_102157001	3300010043	Tropical Forest Soil	MMYIQRRHWLDYDPVAFAAVVVGFAMIELLAFII*
Ga0126380_109240032	3300010043	Tropical Forest Soil	TMYLQRPHWLDYDPVALAVLVIGIGIIELLALII*
Ga0126319_15459211	3300010147	Soil	VMHLLRRHWLDYDPVALAVLVIGIGMIELLAWGIW*
Ga0126372_100072399	3300010360	Tropical Forest Soil	MMYIQRRHWFDYDPVAFAAVVVGFAMIELLAFII*
Ga0126372_106375462	3300010360	Tropical Forest Soil	WRATMYVQTMDVQKPHWLDYDPVALAVLVIGIGIIELLALII*
Ga0126378_113790311	3300010361	Tropical Forest Soil	RATMYVQKPHWLDYDPVALAVLVIGIGIIELLALII*
Ga0126383_107991651	3300010398	Tropical Forest Soil	TTYVQKPHWLDYDPVALAVLVIGIGIIELLALII*
Ga0137389_116269161	3300012096	Vadose Zone Soil	MKSNRVGDIMLKQSRYWLDYDPVALVVLVIGIGAIELLALSI*
Ga0137365_106709873	3300012201	Vadose Zone Soil	GRQHDLGPTHVNRRTGKRIMYIPRRHWLDYDPVALAALVIGIGIIELLALII*
Ga0137363_101160821	3300012202	Vadose Zone Soil	LGRTDVNRRTGWRIMYIQRRHWLDYDPIALAVLVLGIGMIELLAMII*
Ga0137374_109145531	3300012204	Vadose Zone Soil	MHTLRRHWLDYDPVALAVLVIGIGMIELLAWGIW*
Ga0137362_100465914	3300012205	Vadose Zone Soil	MHAQRRHWLEYDPVALAVLVIGIGMIELLAWGIW*
Ga0137379_102069871	3300012209	Vadose Zone Soil	MHAQGRHWLDYDPVALAVLVIGIGMIELLAWGIW*
Ga0137378_111722452	3300012210	Vadose Zone Soil	VNRRTGWRIMYIQRRHWLDYDPVALAVLVIGIGIIELLALII*
Ga0137378_118274882	3300012210	Vadose Zone Soil	RRTGWRIMYIQRRHWLDYDPVALAVLVIGIGMIELLALII*
Ga0150985_1066509541	3300012212	Avena Fatua Rhizosphere	MHLLRRHWLDYDPVALAALVIGIGMIELLAWGIW*
Ga0150985_1090191652	3300012212	Avena Fatua Rhizosphere	MHIQSRHWLDYDPVALAVLVIGIGMIELLAWGIW*
Ga0150985_1143302681	3300012212	Avena Fatua Rhizosphere	TGRRVMHIQSRHWLDYDPVALAVLVIGIGMIELLAWGIW*
Ga0150985_1149500202	3300012212	Avena Fatua Rhizosphere	FRSVMHTQRQHWLDYDPVALAVLVIGMIGLLALTI*
Ga0150985_1187150031	3300012212	Avena Fatua Rhizosphere	RFQVMHTQRQHWLDYDPVALAVLVIGMIGLLALTI*
Ga0150985_1198786724	3300012212	Avena Fatua Rhizosphere	EGFQIMHTQRQHWLDYDPVALAVLVIGMIGLLALTI*
Ga0137370_106816241	3300012285	Vadose Zone Soil	NREGIRMNLQKRYWLDYDPVALAVLVVGIGMIELLAFNI*
Ga0137367_111870521	3300012353	Vadose Zone Soil	NRRTGWRIMYIQRRHWLDYDPVALAVLVIGIGIIELLALII*
Ga0137368_106865371	3300012358	Vadose Zone Soil	WRIMYIQRRHWLDYDPVAFAALVLGIGMVELLALII*
Ga0137385_101850881	3300012359	Vadose Zone Soil	THDLGRTDVNRRTGWRIMYIQRRHWLDYDPVALAVLVIGIGMIELLALII*
Ga0137361_105518061	3300012362	Vadose Zone Soil	DLGRTDVNRRTGQRIMYIQRRHWLDYDPVALAVPVIGIGIIELLALII*
Ga0137361_118812411	3300012362	Vadose Zone Soil	HDLGRTDVNRRTGWRIMYIQRRHWLDYDPVALAVLVIGIGIIELLALII*
Ga0134022_11123391	3300012371	Grasslands Soil	RTGWRIMYIQRRHWLDYDPVALAALVIGIGIIELLALII*
Ga0150984_1089188611	3300012469	Avena Fatua Rhizosphere	TGRRVMHLLRRHWLDYDPVALAVLVIGIGMIELLAWGIW*
Ga0150984_1105262051	3300012469	Avena Fatua Rhizosphere	RFHVMHTQRQHWLDYDPVALAVLVIGMIGLLALTI*
Ga0137358_103937311	3300012582	Vadose Zone Soil	ATIYVQRPHWLDYDPLALAVLVIGIGIIELLALII*
Ga0137394_101590511	3300012922	Vadose Zone Soil	MHAQRRHWLEYDPVALAVLVIGIGTIELLAWGIW*
Ga0164298_104343862	3300012955	Soil	ETLNRASVYEQKPHWLDYDPLALAVLVIGIGIIELLALII*
Ga0164303_114151822	3300012957	Soil	IMYMQRRHWLDYDPVALAVLVIGIGMIELLALII*
Ga0164308_105769832	3300012985	Soil	VCYKGLVEGRFQVMHTQRQHWLDYDPVALAVLVIGMIGLLVLTI*
Ga0164307_107345471	3300012987	Soil	TWFGQVNRRTGWRIMYIQRRHWLDYDPVALAVLVIGIGMIELLALII*
Ga0163163_116343862	3300014325	Switchgrass Rhizosphere	MHIQSRHWLDYDPVALAVLLIGIGMIELLAWGIW*
Ga0157379_122130921	3300014968	Switchgrass Rhizosphere	MHLLRRHWLDYDPVALAILVIGMGMIELLAWGIW*
Ga0132257_1015530311	3300015373	Arabidopsis Rhizosphere	RTGWRIMYIRRRHWLDYDPVALAVLVIGIGMIELFALII*
Ga0182033_113175252	3300016319	Soil	RLMYIQRRHWLEYDPVALAVLVIGIGIIELLALII
Ga0182040_105533412	3300016387	Soil	MYAQTMHVQKSHWLDYDPVALAVLVIGIGIIELLALII
Ga0163161_103383321	3300017792	Switchgrass Rhizosphere	RQNLGLPRRHWLDYDPVALAVLVIGIATIELLALMI
Ga0190266_111084921	3300017965	Soil	MRGTVEGSFLIMHTQRQHWLDYDPVALAVLVIGMVGLLALTI
Ga0184604_100571361	3300018000	Groundwater Sediment	AGTGRRVMHLLRRHWLDYDPVALAVLVIGIGMIELLAWGIW
Ga0184611_12055431	3300018067	Groundwater Sediment	SKTGWRIMYIQRRHWLDYDPVALAVLVIGIGMIELLALII
Ga0190270_106736471	3300018469	Soil	TGWCIMYIQKRHWLDYDPVAFAALVIGIGMIELLALII
Ga0066669_118142431	3300018482	Grasslands Soil	NRRTGWRIMYIQRRHWLDYDPVALAVLVIGIGMIELLALII
Ga0066669_121847881	3300018482	Grasslands Soil	RRTGWRIMYIQGRHWLDYDPVALAVLVIGIGMVELLASII
Ga0137408_13202022	3300019789	Vadose Zone Soil	MAVMRILNRHWLDYDLVALAVLLIGIGIIELLALSI
Ga0193731_10592703	3300020001	Soil	GRRVMHILRRHWLDYDPVALAVLVIGIGMIELLAWGIW
Ga0179594_101613923	3300020170	Vadose Zone Soil	TEEQGRRIMYIQRRHWLDYDPVALAVLVMGIGIIELLALII
Ga0210407_114186291	3300020579	Soil	RIMYIQRRHWLDYDPVALAVLVIGIGMIELLASII
Ga0210408_109509442	3300021178	Soil	RTGQRIMYIQRRHWLDYDPVALAVLVIGIGMIELLALII
Ga0207684_101446615	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	MYAQTMHVQKPHWLDYDPVALAVLVIGIGIIELLALII
Ga0207712_109946651	3300025961	Switchgrass Rhizosphere	HDLGRTDVNRRTGWRIMYIQRRHWLDYDPVALAVLVIGIGMIELLASII
Ga0209470_10642123	3300026324	Soil	RTGWRIMYIQRRHWLDYDPVALAVLVIGIGMIELLALII
Ga0209159_12761012	3300026343	Soil	HVNRRTGKRIMYIQRRHWLDYDPVALAALVIGIGIIELLALII
Ga0257171_10162091	3300026377	Soil	WRIMYIQRRHWLDYDPVALAVLVIGIGMIELLALII
Ga0209378_10678631	3300026528	Soil	TDVNRRTGWRIMYIQRRHWLDYDSVALAVLVIGIGVIELLAWGI
Ga0207826_11895961	3300027680	Tropical Forest Soil	QRLNQQNKGDVMRKQSRYWLDYDPVALVVLLVGIGMVELLALSI
Ga0209465_103087011	3300027874	Tropical Forest Soil	VRVTRRTGWRIMYIERRHWLDYDPVAFTVLVLGIGMVELLALII
Ga0209590_107062861	3300027882	Vadose Zone Soil	WGAGHIMYIQRRHWLDYDPVALAVLVIGIGMIELLALII
Ga0209526_103895201	3300028047	Forest Soil	MGGMDIMRRHWLDYDPVALAVLIIGMGIVELLALII
Ga0307315_100784771	3300028721	Soil	GRFHVMHTQRQHWLDYDPVALAVLVIGMVGLLALTI
Ga0247824_106237101	3300028809	Soil	YKGLVEGRFQVMHTQRQHWLDYDPVALAVLVIGMIGLLVLTI
Ga0307296_104921172	3300028819	Soil	GRRVMHLLRRHWLDYDPLALAVLVIGIGMIELLAWGIW
Ga0307278_102940962	3300028878	Soil	VMHTQRRHWLDYDPVALAVLVIGIGTIELLAWGIW
Ga0307277_1000369611	3300028881	Soil	TVNRATTYVQKPHWLDYDPLALAVLVIGIGIVELLALII
Ga0222749_103128642	3300029636	Soil	DVNRRTGWRIMYIQRWHWLDYDPVALAVLAIGIGMIELLALII
Ga0308203_10330592	3300030829	Soil	VNRRTGWRIMYIQRWHWLDYDPVALAVLVIGIGMIELLASII
Ga0308189_103572401	3300031058	Soil	RTGWRIMYIQRWHWLDYDPVAFAVLVIGIGMIELLASII
Ga0308201_101619582	3300031091	Soil	PEAGTGRRVMHLLRRHWLDYDPVALAVLVIGIGMIELLAWGIW
Ga0308199_11681892	3300031094	Soil	RIMYIKSRHWLDYDPVALAVLVIGIGVIELVALII
Ga0170820_162042821	3300031446	Forest Soil	GWRIMYIQRRHWLDYDPVAFAVLVLGIGMVELLALII
Ga0318541_102603152	3300031545	Soil	MYAQTMHVQKPHWLDYDPVAPAVLVIGIGIIELLALII
Ga0310915_100449941	3300031573	Soil	NRWRATMYVQTTYVQKPHWLDYDPVALAVLVIGIGIIELLALII
Ga0318501_106947561	3300031736	Soil	VQTTYVQKPHWLDYDPVALAVLVIGIGIIELLALII
Ga0318543_103496811	3300031777	Soil	DKGDVMRKYWQWLDYDPVALIVLLVGIGIVELLALSI
Ga0318576_100473411	3300031796	Soil	VQTMHVQKPHWLDYDPVALAVLVIGIGIIELLALII
Ga0318517_101059294	3300031835	Soil	GSVMNLRKRYWLDYDPVALVVLMIGIGMIELIAFSM
Ga0318517_104266652	3300031835	Soil	RVRLMYIQRRHWLEYDPVALAVLVIGIGIIELLALII
Ga0318544_100415745	3300031880	Soil	RAMMNVQWPHWLDYDPVALAVLVIGIGIIELLALII
Ga0306925_106325372	3300031890	Soil	ATMYVQTTYVQKPHWLDYDPVALAVLVIGIGIIELLALII
Ga0318536_104492122	3300031893	Soil	YVQTMHVQKPHWLDYDPVALAVLVIGIGIIELLALII
Ga0306921_109642871	3300031912	Soil	RWRATMYVQTTYVQKPHWLDYDPVALAVLVIGIGIIELLALII
Ga0310913_107365592	3300031945	Soil	VRLMYIQRRHWLEYDPVALAVLVIGIGIIELLALII
Ga0310913_110330891	3300031945	Soil	GWRATMYVQTTYVQKPHWLDYDPVALAVLVIGIGIIELLALII
Ga0310910_114539812	3300031946	Soil	NRWRATMYVQTMHVQKPHWLDYDPVALAVLVIGIGIIELLALII
Ga0310909_106249691	3300031947	Soil	LNMVDIMHRHWLDYDLVALVVLIIGMGLVELLALSI
Ga0310909_110870711	3300031947	Soil	GDVMRKYWQWLDYDPVALIVLLVGIGIVELLALSI
Ga0306926_104664941	3300031954	Soil	MYVQTMHVQKPHWLDYDPVALAVLVIGIGIIELLALII
Ga0318531_102122772	3300031981	Soil	WRSTMYVQTMHVQKPHWLDYDPVALAVLVIGIGIIELLALII
Ga0318513_100737063	3300032065	Soil	NRWRAMMSVQTMHVQKPHWLDYDPVALAVLVIGIGIIELLALII
Ga0318519_108566881	3300033290	Soil	TGNRWRATMYAQTMHVQKPHWLDYDPVAPAVLVIGIGIIELLALII

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign