| Basic Information | |
|---|---|
| Family ID | F056095 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 138 |
| Average Sequence Length | 44 residues |
| Representative Sequence | APAVTGEPTGDRALRSPRTEKQRAGTLAAGARRQAKRDSR |
| Number of Associated Samples | 112 |
| Number of Associated Scaffolds | 138 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.54 % |
| % of genes near scaffold ends (potentially truncated) | 92.75 % |
| % of genes from short scaffolds (< 2000 bps) | 88.41 % |
| Associated GOLD sequencing projects | 110 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (69.565 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (34.783 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.855 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (39.855 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.82% β-sheet: 0.00% Coil/Unstructured: 66.18% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 138 Family Scaffolds |
|---|---|---|
| PF04960 | Glutaminase | 8.70 |
| PF02274 | ADI | 5.07 |
| PF03706 | LPG_synthase_TM | 3.62 |
| PF04993 | TfoX_N | 2.17 |
| PF08281 | Sigma70_r4_2 | 2.17 |
| PF08241 | Methyltransf_11 | 2.17 |
| PF01047 | MarR | 1.45 |
| PF12833 | HTH_18 | 1.45 |
| PF10009 | DUF2252 | 1.45 |
| PF13396 | PLDc_N | 1.45 |
| PF01243 | Putative_PNPOx | 1.45 |
| PF01638 | HxlR | 0.72 |
| PF13365 | Trypsin_2 | 0.72 |
| PF02517 | Rce1-like | 0.72 |
| PF14342 | DUF4396 | 0.72 |
| PF03704 | BTAD | 0.72 |
| PF13469 | Sulfotransfer_3 | 0.72 |
| PF11716 | MDMPI_N | 0.72 |
| PF07883 | Cupin_2 | 0.72 |
| PF05231 | MASE1 | 0.72 |
| PF12697 | Abhydrolase_6 | 0.72 |
| PF07690 | MFS_1 | 0.72 |
| PF01513 | NAD_kinase | 0.72 |
| PF10576 | EndIII_4Fe-2S | 0.72 |
| PF13460 | NAD_binding_10 | 0.72 |
| PF08031 | BBE | 0.72 |
| PF03176 | MMPL | 0.72 |
| PF08327 | AHSA1 | 0.72 |
| PF03640 | Lipoprotein_15 | 0.72 |
| PF02826 | 2-Hacid_dh_C | 0.72 |
| PF02371 | Transposase_20 | 0.72 |
| PF01636 | APH | 0.72 |
| PF03781 | FGE-sulfatase | 0.72 |
| PF12802 | MarR_2 | 0.72 |
| PF06736 | TMEM175 | 0.72 |
| PF13857 | Ank_5 | 0.72 |
| PF13191 | AAA_16 | 0.72 |
| PF00106 | adh_short | 0.72 |
| COG ID | Name | Functional Category | % Frequency in 138 Family Scaffolds |
|---|---|---|---|
| COG2066 | Glutaminase | Amino acid transport and metabolism [E] | 8.70 |
| COG4874 | Uncharacterized conserved protein | Function unknown [S] | 5.07 |
| COG2235 | Arginine deiminase | Amino acid transport and metabolism [E] | 5.07 |
| COG1834 | N-Dimethylarginine dimethylaminohydrolase | Amino acid transport and metabolism [E] | 5.07 |
| COG0392 | Predicted membrane flippase AglD2/YbhN, UPF0104 family | Cell wall/membrane/envelope biogenesis [M] | 3.62 |
| COG3070 | Transcriptional regulator of competence genes, TfoX/Sxy family | Transcription [K] | 2.17 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.72 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.72 |
| COG1262 | Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain | Posttranslational modification, protein turnover, chaperones [O] | 0.72 |
| COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 0.72 |
| COG0642 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.72 |
| COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 0.72 |
| COG3447 | Integral membrane sensor domain MASE1 | Signal transduction mechanisms [T] | 0.72 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.72 |
| COG3548 | Uncharacterized membrane protein | Function unknown [S] | 0.72 |
| COG3629 | DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domain | Transcription [K] | 0.72 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.72 |
| COG3947 | Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains | Transcription [K] | 0.72 |
| COG4315 | Predicted lipoprotein with conserved Yx(FWY)xxD motif (function unknown) | Function unknown [S] | 0.72 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.72 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 70.29 % |
| Unclassified | root | N/A | 29.71 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001384|JGI20190J14840_1010535 | Not Available | 870 | Open in IMG/M |
| 3300001867|JGI12627J18819_10221927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 761 | Open in IMG/M |
| 3300005176|Ga0066679_10999879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 521 | Open in IMG/M |
| 3300005332|Ga0066388_106670324 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 582 | Open in IMG/M |
| 3300005337|Ga0070682_100080779 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2103 | Open in IMG/M |
| 3300005437|Ga0070710_10120188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1589 | Open in IMG/M |
| 3300005524|Ga0070737_10276561 | Not Available | 670 | Open in IMG/M |
| 3300005534|Ga0070735_10924612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 512 | Open in IMG/M |
| 3300005540|Ga0066697_10137216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1440 | Open in IMG/M |
| 3300005616|Ga0068852_102342560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 555 | Open in IMG/M |
| 3300005718|Ga0068866_10226753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1131 | Open in IMG/M |
| 3300005842|Ga0068858_100171549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2045 | Open in IMG/M |
| 3300005842|Ga0068858_100186588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1959 | Open in IMG/M |
| 3300005843|Ga0068860_101854814 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 625 | Open in IMG/M |
| 3300005844|Ga0068862_102015858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 588 | Open in IMG/M |
| 3300005921|Ga0070766_11253496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 513 | Open in IMG/M |
| 3300006034|Ga0066656_10937060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 555 | Open in IMG/M |
| 3300006162|Ga0075030_101564573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 516 | Open in IMG/M |
| 3300006163|Ga0070715_10656714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 621 | Open in IMG/M |
| 3300006175|Ga0070712_100204355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1554 | Open in IMG/M |
| 3300006175|Ga0070712_101864233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 526 | Open in IMG/M |
| 3300006176|Ga0070765_100452561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1203 | Open in IMG/M |
| 3300006237|Ga0097621_101406357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 660 | Open in IMG/M |
| 3300006755|Ga0079222_11565479 | Not Available | 622 | Open in IMG/M |
| 3300006804|Ga0079221_10873501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 656 | Open in IMG/M |
| 3300006806|Ga0079220_10463251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 852 | Open in IMG/M |
| 3300006903|Ga0075426_10212697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1402 | Open in IMG/M |
| 3300006954|Ga0079219_10196732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1137 | Open in IMG/M |
| 3300009011|Ga0105251_10359298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 665 | Open in IMG/M |
| 3300009177|Ga0105248_10554542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1296 | Open in IMG/M |
| 3300010048|Ga0126373_10541184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1211 | Open in IMG/M |
| 3300010048|Ga0126373_11576667 | Not Available | 721 | Open in IMG/M |
| 3300010360|Ga0126372_10039820 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3064 | Open in IMG/M |
| 3300010360|Ga0126372_12282923 | Not Available | 591 | Open in IMG/M |
| 3300010360|Ga0126372_13115305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 515 | Open in IMG/M |
| 3300010361|Ga0126378_12922718 | Not Available | 545 | Open in IMG/M |
| 3300010379|Ga0136449_100832277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 1518 | Open in IMG/M |
| 3300012201|Ga0137365_10972163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces paucisporeus | 617 | Open in IMG/M |
| 3300012209|Ga0137379_10704553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 915 | Open in IMG/M |
| 3300012212|Ga0150985_111897883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 507 | Open in IMG/M |
| 3300012971|Ga0126369_10358415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1483 | Open in IMG/M |
| 3300012971|Ga0126369_11353848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 802 | Open in IMG/M |
| 3300012971|Ga0126369_11377745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 795 | Open in IMG/M |
| 3300012971|Ga0126369_12626868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 588 | Open in IMG/M |
| 3300013307|Ga0157372_10890240 | Not Available | 1033 | Open in IMG/M |
| 3300013308|Ga0157375_11981427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 692 | Open in IMG/M |
| 3300014969|Ga0157376_11104908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 819 | Open in IMG/M |
| 3300015371|Ga0132258_11814273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1537 | Open in IMG/M |
| 3300015372|Ga0132256_101751404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 730 | Open in IMG/M |
| 3300016357|Ga0182032_11202633 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300016357|Ga0182032_11238329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 643 | Open in IMG/M |
| 3300016422|Ga0182039_12046515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 527 | Open in IMG/M |
| 3300017959|Ga0187779_10027916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3238 | Open in IMG/M |
| 3300017959|Ga0187779_10224465 | Not Available | 1182 | Open in IMG/M |
| 3300017966|Ga0187776_10071838 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2007 | Open in IMG/M |
| 3300017970|Ga0187783_10514602 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300018060|Ga0187765_11117307 | Not Available | 548 | Open in IMG/M |
| 3300018085|Ga0187772_10467548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 886 | Open in IMG/M |
| 3300020579|Ga0210407_11349733 | Not Available | 531 | Open in IMG/M |
| 3300021178|Ga0210408_11504204 | Not Available | 504 | Open in IMG/M |
| 3300021374|Ga0213881_10243756 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300021401|Ga0210393_11509839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Dermacoccaceae → Allobranchiibius → Allobranchiibius huperziae | 535 | Open in IMG/M |
| 3300021474|Ga0210390_11080322 | Not Available | 652 | Open in IMG/M |
| 3300021478|Ga0210402_11740159 | Not Available | 550 | Open in IMG/M |
| 3300021560|Ga0126371_12228529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 661 | Open in IMG/M |
| 3300022467|Ga0224712_10226002 | Not Available | 858 | Open in IMG/M |
| 3300025906|Ga0207699_10476679 | Not Available | 898 | Open in IMG/M |
| 3300025916|Ga0207663_10473373 | Not Available | 969 | Open in IMG/M |
| 3300025921|Ga0207652_10818565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 826 | Open in IMG/M |
| 3300025924|Ga0207694_11582309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 552 | Open in IMG/M |
| 3300025929|Ga0207664_11406745 | Not Available | 618 | Open in IMG/M |
| 3300025931|Ga0207644_10459696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1046 | Open in IMG/M |
| 3300025935|Ga0207709_10831551 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300026078|Ga0207702_11884009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 589 | Open in IMG/M |
| 3300027680|Ga0207826_1096526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 813 | Open in IMG/M |
| 3300027812|Ga0209656_10080305 | All Organisms → cellular organisms → Bacteria | 1756 | Open in IMG/M |
| 3300027911|Ga0209698_10705996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 768 | Open in IMG/M |
| 3300028793|Ga0307299_10242204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 678 | Open in IMG/M |
| 3300031543|Ga0318516_10738033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 558 | Open in IMG/M |
| 3300031546|Ga0318538_10399219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium novocastrense | 744 | Open in IMG/M |
| 3300031546|Ga0318538_10680551 | Not Available | 558 | Open in IMG/M |
| 3300031549|Ga0318571_10063291 | Not Available | 1134 | Open in IMG/M |
| 3300031564|Ga0318573_10175344 | All Organisms → cellular organisms → Bacteria | 1131 | Open in IMG/M |
| 3300031564|Ga0318573_10365163 | Not Available | 775 | Open in IMG/M |
| 3300031680|Ga0318574_10187793 | Not Available | 1185 | Open in IMG/M |
| 3300031723|Ga0318493_10416630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 736 | Open in IMG/M |
| 3300031723|Ga0318493_10589868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 619 | Open in IMG/M |
| 3300031748|Ga0318492_10193708 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
| 3300031751|Ga0318494_10578509 | Not Available | 656 | Open in IMG/M |
| 3300031765|Ga0318554_10259637 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
| 3300031765|Ga0318554_10794691 | Not Available | 529 | Open in IMG/M |
| 3300031769|Ga0318526_10296370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium novocastrense | 662 | Open in IMG/M |
| 3300031770|Ga0318521_10501034 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300031770|Ga0318521_10557565 | Not Available | 691 | Open in IMG/M |
| 3300031779|Ga0318566_10076035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 1627 | Open in IMG/M |
| 3300031779|Ga0318566_10089439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1503 | Open in IMG/M |
| 3300031779|Ga0318566_10349828 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300031781|Ga0318547_10026577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2924 | Open in IMG/M |
| 3300031781|Ga0318547_10077541 | Not Available | 1855 | Open in IMG/M |
| 3300031794|Ga0318503_10117488 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300031796|Ga0318576_10636361 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales | 502 | Open in IMG/M |
| 3300031805|Ga0318497_10325740 | Not Available | 857 | Open in IMG/M |
| 3300031819|Ga0318568_10697755 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 631 | Open in IMG/M |
| 3300031831|Ga0318564_10495907 | Not Available | 530 | Open in IMG/M |
| 3300031846|Ga0318512_10468339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium novocastrense | 637 | Open in IMG/M |
| 3300031846|Ga0318512_10500502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → Kribbella soli | 616 | Open in IMG/M |
| 3300031890|Ga0306925_10902556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 909 | Open in IMG/M |
| 3300031890|Ga0306925_10942065 | Not Available | 885 | Open in IMG/M |
| 3300031910|Ga0306923_11120069 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300031910|Ga0306923_11369972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 747 | Open in IMG/M |
| 3300031941|Ga0310912_10265781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1323 | Open in IMG/M |
| 3300031946|Ga0310910_10767842 | Not Available | 760 | Open in IMG/M |
| 3300031954|Ga0306926_10588581 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Coccoidea → Coccidae → Rhodococcus | 1360 | Open in IMG/M |
| 3300031954|Ga0306926_10963020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1018 | Open in IMG/M |
| 3300032041|Ga0318549_10132452 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium novocastrense | 1103 | Open in IMG/M |
| 3300032043|Ga0318556_10399171 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300032066|Ga0318514_10010740 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3931 | Open in IMG/M |
| 3300032066|Ga0318514_10654020 | Not Available | 559 | Open in IMG/M |
| 3300032067|Ga0318524_10725448 | Not Available | 525 | Open in IMG/M |
| 3300032068|Ga0318553_10284777 | Not Available | 864 | Open in IMG/M |
| 3300032068|Ga0318553_10379301 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300032076|Ga0306924_12505510 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 517 | Open in IMG/M |
| 3300032089|Ga0318525_10097514 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1497 | Open in IMG/M |
| 3300032261|Ga0306920_102384544 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300032783|Ga0335079_11554376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Phenylobacterium → unclassified Phenylobacterium → Phenylobacterium sp. J367 | 652 | Open in IMG/M |
| 3300032783|Ga0335079_11946069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 568 | Open in IMG/M |
| 3300032828|Ga0335080_10780207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 989 | Open in IMG/M |
| 3300032955|Ga0335076_11808572 | Not Available | 500 | Open in IMG/M |
| 3300033158|Ga0335077_10006600 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 14339 | Open in IMG/M |
| 3300033290|Ga0318519_10792463 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 34.78% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.70% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.35% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.35% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.62% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.90% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.17% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.45% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.45% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.45% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.45% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.45% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.45% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.45% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.45% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.45% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.72% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.72% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.72% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.72% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.72% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.72% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.72% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.72% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.72% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.72% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.72% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001384 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 shallow-072012 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005524 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen10_05102014_R1 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI20190J14840_10105351 | 3300001384 | Arctic Peat Soil | KQGRGPGTRAAAPAGRTGPAVTGEPAGDRALRSPASEKRRGGTVALGARRQAKRDNR* |
| JGI12627J18819_102219271 | 3300001867 | Forest Soil | GAPGTGPAELAAGRKGPSVTAEPTGDRALRSPRTEKQRAGTLAAGARRQAKKDSR* |
| C688J35102_1207278381 | 3300002568 | Soil | QGHGPGAAPATPAVIPEGPMLTGEPTGDLALRSPRTEKQRASTLAAGARRQAKRDSR* |
| Ga0066679_109998792 | 3300005176 | Soil | GPAVTPEPTGDRALRSPATEKNRAGTRALGARRQAKRDSR* |
| Ga0066388_1066703241 | 3300005332 | Tropical Forest Soil | GPEAPRAVPAASRPAPAVTGEPTGDRALRSPRTEKQRASALAAGARRQAKRDSR* |
| Ga0070682_1000807794 | 3300005337 | Corn Rhizosphere | VGRKGPSVTAEPTGDRALRSPRTEKQRAGTLASGARRQAKRDSR* |
| Ga0070710_101201881 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | PAVTGEPTGDRALRSPASAKRRASTRATQARRQAKRDTS* |
| Ga0070737_102765613 | 3300005524 | Surface Soil | DPTGTADPIGGRALRTPASEKRRAGTRALGDRRQAKRDSR* |
| Ga0070735_109246121 | 3300005534 | Surface Soil | GPGAQEAAPAAGRQGPAVTAPGAGDRALHSPVSKKQRASTRAAGARQQAKRDSR* |
| Ga0066697_101372161 | 3300005540 | Soil | AVTAEPTGDRALRSPALAKRRASTRATGARRQARRDSR* |
| Ga0068852_1023425602 | 3300005616 | Corn Rhizosphere | AARSSNAPVGDRALRSPATQKARASTQAAGARRQAKRDSR* |
| Ga0068866_102267532 | 3300005718 | Miscanthus Rhizosphere | EPTGDRALRSPRTEKQRAGTLASGARRQAKRDSR* |
| Ga0068858_1001715494 | 3300005842 | Switchgrass Rhizosphere | GTGPADAAVGRKGPSVTAEPTGDRALRSPRTEKQRAGTLAAGARRQAKRDSR* |
| Ga0068858_1001865881 | 3300005842 | Switchgrass Rhizosphere | RKEPTATGEPAGARPLRTPASEKRRAGTLAMGARRQARKDSR* |
| Ga0068860_1018548141 | 3300005843 | Switchgrass Rhizosphere | VTAEPTGDRALRSPRTEKQRAGTLAAGARRQAKKDSR* |
| Ga0068862_1020158582 | 3300005844 | Switchgrass Rhizosphere | GTGPAEPAVGRKGPSVTGEPTGDRALRSPRTEKQRAGTLASGARRQAKRDSR* |
| Ga0070766_112534962 | 3300005921 | Soil | AVTAERTGDRALRSPASNKRRASTHAAGARQQAKRDSR* |
| Ga0066656_109370602 | 3300006034 | Soil | ALGTGSAEPAVGRKGPSVTGEPTGDRALRSPRTEKQRAGTLASGARRQAKRDSR* |
| Ga0075030_1015645731 | 3300006162 | Watersheds | PAVTGESTGDRALHSPATAKRRASTRAAGARRQAKRDSRP* |
| Ga0070715_106567141 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | TGRAAPKGDRSLRSPASEKNRAGTKALGAKRQAKRDSR* |
| Ga0070712_1002043553 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | GDRALRSPASEKERAGIRAKGARWQARRDSKSAG* |
| Ga0070712_1018642332 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | KGPSVTAEPTGDRALRSPRTEKQRAGTLASGARRQAKRDSR* |
| Ga0070765_1004525611 | 3300006176 | Soil | EPTGDRALRSPASEKNRAGTRALGDRRQAKRDSR* |
| Ga0097621_1014063571 | 3300006237 | Miscanthus Rhizosphere | KGPSVTAEPTGDRALRSPRTEKQRAGTLAAGARRQAKKDSR* |
| Ga0079222_115654791 | 3300006755 | Agricultural Soil | EPTGDRALRSPASEKERAGIRAKGARWQARRDSKSAG* |
| Ga0079221_108735011 | 3300006804 | Agricultural Soil | RKGPAVTPEPTGDRALRSPASEKNRAGTRALGDRRQAKRDSR* |
| Ga0079220_104632512 | 3300006806 | Agricultural Soil | TRRAATGSARKGPAVTPEPTGDRALRSPASEKNRAGTRALGDRRQAKRDSR* |
| Ga0075426_102126973 | 3300006903 | Populus Rhizosphere | PSVTAEPTGDRALRSPRTEKQRAGTLASGARRQAKRDSR* |
| Ga0079219_101967321 | 3300006954 | Agricultural Soil | GEPTGDRALRSPASEKERAGIRAKGARWQARRDSKSAG* |
| Ga0105251_103592981 | 3300009011 | Switchgrass Rhizosphere | KGPSVTTEPTGDRALRSPRTEKQRAGTLAAGARRQAKRDSR* |
| Ga0105248_105545421 | 3300009177 | Switchgrass Rhizosphere | AGQQGRTVTGEPTGDRALRSPASAKRRASTRATGARQQAKRDSR* |
| Ga0126373_105411843 | 3300010048 | Tropical Forest Soil | GRQGPAVTGEPTGDRALRSPASQKQRASTRAMGARQQAKRDSR* |
| Ga0126373_115766671 | 3300010048 | Tropical Forest Soil | SGPVTGEPVGDRALRSPARAQERASTRAAGARRQAKRDSR* |
| Ga0126372_100398201 | 3300010360 | Tropical Forest Soil | EPTGDRALRSPASQKQRASTRAMGARQQAKRDSR* |
| Ga0126372_122829231 | 3300010360 | Tropical Forest Soil | GEPTGDRALRSPASQKQRASTRAMGARQQAKRDSR* |
| Ga0126372_131153052 | 3300010360 | Tropical Forest Soil | VTGEPTGDRALRSPASEKRRASTRATDARQQAKRDSR* |
| Ga0126378_129227181 | 3300010361 | Tropical Forest Soil | GGPEAPMAVPAASRPAPAVTGEPTGDRALRSPRTEKQRASTLAAGARRQAKRDSR* |
| Ga0126379_125451001 | 3300010366 | Tropical Forest Soil | QGRGPMVGAAVPGAGRQGPAVTGEPTGDRALRSPRTEKQRASTLASGARAQAKRDSR* |
| Ga0136449_1008322771 | 3300010379 | Peatlands Soil | QAGSGRATSKQPIGDRALRSPATETRRASTRSMGARRQAKRDSR* |
| Ga0126383_118471931 | 3300010398 | Tropical Forest Soil | PSLRQRASRTAGSVTAETPGDRAPRSPATQMRRASTRAADARQQAKRDSRG* |
| Ga0137365_109721631 | 3300012201 | Vadose Zone Soil | MGEPTGDRALRSPATEKRRGGARAPGARPQAKRGNR |
| Ga0137379_107045532 | 3300012209 | Vadose Zone Soil | PSAVPAVTGEPTGDRAPRSPASEKRRAGTLAQGARRQAKRDSR* |
| Ga0150985_1118978832 | 3300012212 | Avena Fatua Rhizosphere | DGRRGDRSLKSPSSEKRRATAQASGARKQAKRDSR* |
| Ga0126369_103584153 | 3300012971 | Tropical Forest Soil | GPAVTGEPTGDRALRSPALAKRRASTRAAGDRRQAKRDSR* |
| Ga0126369_113538481 | 3300012971 | Tropical Forest Soil | GPRVTGEPAGDRALRSPAQAKRRASTRAAGARQQAARDSR* |
| Ga0126369_113777452 | 3300012971 | Tropical Forest Soil | EPIGDRALRSPASERQRASTRAQGARRQAKRDSR* |
| Ga0126369_126268681 | 3300012971 | Tropical Forest Soil | AAQVPDRASPTPDLQKRRATTRAMGARRQAKKDSR* |
| Ga0157372_108902401 | 3300013307 | Corn Rhizosphere | RREGPPATPQPRGDRALRSPDREKERAGTQASGARWQAAKDSRRPASG* |
| Ga0157375_119814272 | 3300013308 | Miscanthus Rhizosphere | GEPTGDRALRSPASAKRRASTRATGARQQAKRDSR* |
| Ga0157376_111049081 | 3300014969 | Miscanthus Rhizosphere | AAVGRKGPSVTAEPTGDRALRSPRTEKQRAGTLAAGARRQAKKDSR* |
| Ga0132258_118142731 | 3300015371 | Arabidopsis Rhizosphere | GRAPGTGPADAAVGRKGPPVTAEPTGDRALRSPRTEKQRAGTLASGARRQAKKDNR* |
| Ga0132256_1017514041 | 3300015372 | Arabidopsis Rhizosphere | IGRKGPSVTGEPTGDRALRSPRTEKERAGTLASGARRQAKKDSR* |
| Ga0182036_110334872 | 3300016270 | Soil | RAAKQGHGPAAPAAEPAASRPAPQVTGEPTGDRALRSPRTEKQRAGTLASGARSQAKRDS |
| Ga0182032_112026332 | 3300016357 | Soil | VPAAGPKGPAVTGEPTGDRALRSPVMAKRRASTRASGARRQAKRDSR |
| Ga0182032_112383291 | 3300016357 | Soil | PAAARKGPAVTGEPVGDRALRSPATAKRRASTRAAGARRQAKRDSG |
| Ga0182039_120465153 | 3300016422 | Soil | GEPTGDRALRSPATTKLRASTRAAGARRQARRDSR |
| Ga0187779_100279164 | 3300017959 | Tropical Peatland | MTPSAPTGDLALRSPRTEKQRASILAAGARQQAKRDSR |
| Ga0187779_102244652 | 3300017959 | Tropical Peatland | VSGEPTGDRALRSPRTEKQRAGTLAAGARRQAKKDSRG |
| Ga0187776_100718381 | 3300017966 | Tropical Peatland | TGSAVPGVSRKGPPVTGEPAGDRALQSPASQKRRASTRATGARQQAKRDSR |
| Ga0187783_105146022 | 3300017970 | Tropical Peatland | AVSAAGRKGPAVTGERTGDRALHSPASKKRRASTRATGARQQAQRDSRQRRAKDTFG |
| Ga0187765_111173071 | 3300018060 | Tropical Peatland | AAPATAPGRTGPAVTGEPTGDRALRSPASAKRRASVRAMDARQQASRDSR |
| Ga0187772_104675482 | 3300018085 | Tropical Peatland | AGVRGPTVTGGPTGDRALRSPRTEKQRAGALASGARRQAKRDSL |
| Ga0210407_113497332 | 3300020579 | Soil | TGEPTGDRALRSPATEKRRAGTSAQGARRQAKRDSR |
| Ga0210408_115042042 | 3300021178 | Soil | APGPRQAKPASARKGPPVTGEPAGDRALRSPRTEKQRAGALASGARRQAKRDSR |
| Ga0213881_102437562 | 3300021374 | Exposed Rock | VTGEATADRALRSPATMKRRASTRAATARQQAKRDSR |
| Ga0210393_115098392 | 3300021401 | Soil | AEPTGGRALRTPASEKRRAGTRALGDRRQAKRDSR |
| Ga0210390_110803221 | 3300021474 | Soil | RKGLAVIAERTGDRALRSPASNKRRASTRAAGARQQAKRDSR |
| Ga0210402_117401591 | 3300021478 | Soil | ARSGPAVMPEPTGDRALRSPSLAKRRASTRAADARQQAKRDSR |
| Ga0126371_122285291 | 3300021560 | Tropical Forest Soil | RGPAAQAAEPAASRPGPQVTGEPTGDRALRSPASEKRRASTRATDARQQAKRDSR |
| Ga0224712_102260021 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | PRREGPPATPQPRGDRALRSPDREKERAGTQASGARWQAAKDSRRPASG |
| Ga0207699_104766793 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | LTEEPTGDRALRSPASEKERAGIRAKGARWQARRDSKSAG |
| Ga0207663_104733731 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | GPALTEEPAGDRALRSPASEKERAGIRAKGARWQARRDSKSAG |
| Ga0207652_108185651 | 3300025921 | Corn Rhizosphere | GPAELAAGRKGPSVTAEPTGDRALRSPRTEKQRAGTLAAGARRQAKKDSR |
| Ga0207694_115823091 | 3300025924 | Corn Rhizosphere | TGEPAGARPLRTPASEKRRAGTKALGARRQAKRDSR |
| Ga0207664_114067452 | 3300025929 | Agricultural Soil | PTGDRALRSPASEKERAGIRAKGARWQARRDSKSAG |
| Ga0207644_104596962 | 3300025931 | Switchgrass Rhizosphere | PAELAAGRKGPSVTAEPTGDRALRSPRTEKQRAGTLAAGARRQAKKDSR |
| Ga0207709_108315512 | 3300025935 | Miscanthus Rhizosphere | VGTAVLVAGQQGPTVTGQPTGDRALRSPASAKRRASTRATGARQQAKRDSR |
| Ga0207702_118840091 | 3300026078 | Corn Rhizosphere | EGPPATPQPRGDRALRSPDREKERAGTQASGARWQAAKDSRRPASG |
| Ga0207826_10965263 | 3300027680 | Tropical Forest Soil | AAVPAARRKGPAVTPAPTGDRALRSPASAKRRASTRAVGARQQAKRDSR |
| Ga0209656_100803052 | 3300027812 | Bog Forest Soil | MNATLLAALHSPVSKKQRASTRAAGARQQAKRDSR |
| Ga0209698_107059962 | 3300027911 | Watersheds | PAVTGESTGDRALHSPATAKRRASTRAAGARRQAKRDSRP |
| Ga0307299_102422042 | 3300028793 | Soil | VTAEPTGDRALRSPRTEKQRAGTLASGARRQAKRDSR |
| Ga0318516_107380332 | 3300031543 | Soil | RQGPTVTGEPTGDRALRSPRTEKQRAGTLAAGARRQAKKDSR |
| Ga0318534_108579151 | 3300031544 | Soil | ATKQGRGPRAQGAAPGEVREGPMVTGVPTGDRALRSPRTEKQRASTLASGARAQAKRDSR |
| Ga0318538_103992191 | 3300031546 | Soil | RPAPAVTGEPTGDRALRSPRTEKQRAGTLAAGARRQAKRDSR |
| Ga0318538_106805512 | 3300031546 | Soil | PQEPAPVADRTGPTVTGEPTGDRALRSPRTEKQRASTLAAGARRQAKRDSR |
| Ga0318571_100632912 | 3300031549 | Soil | AEPTGDRALRSPALAKRRASTRAAGDRRQAKQDSR |
| Ga0318573_101753442 | 3300031564 | Soil | QSQGPGPEQAPEKAEPAAGRQGPPVTAEPTGDRALRSPRTEKQRAGTLAAGARRQAKRDS |
| Ga0318573_103651631 | 3300031564 | Soil | VTGEPTGDRALRSPRTEKQRAGTLASGARSQAKRDSR |
| Ga0318574_101877932 | 3300031680 | Soil | VTGEPSGDRALRSPRTEKQRAATLASGARSQAKRDSR |
| Ga0318493_104166302 | 3300031723 | Soil | PDTPDDRAPRSPATQMRRATTRAAGARQQAKRDSRG |
| Ga0318493_105898682 | 3300031723 | Soil | GHGPGAPEATPAVSRQGPTVTGEPTGDRALRSPRTEKQRAGTLAAGARRQAKKDSR |
| Ga0318492_101937082 | 3300031748 | Soil | QAPEKAEPAAGRQGPPVTAEPTGDRALRSPRTEKQRAGTLAAGARRQAKRDSR |
| Ga0318494_105785092 | 3300031751 | Soil | AVTVGPTGDRALRSPRTEKQRASTLAAGARRQAKRDSR |
| Ga0318554_102596372 | 3300031765 | Soil | TGEPTGDRALRSPASAKRRAGTRATGARQQAKRDSR |
| Ga0318554_107946912 | 3300031765 | Soil | RPGPPVTGEPTGDRALRSPRTEKQRAGTLAAGARRQAKRDSR |
| Ga0318526_102963701 | 3300031769 | Soil | AASRPAPAVTGEPTGDRALRSPRTEKQRAGTLAAGARRQAKRDSR |
| Ga0318521_105010341 | 3300031770 | Soil | PEQAPEKAEPAAGRQGPPVTAEPTGDRALRSPRTEKQRAGTLAAGARRQAKRDSR |
| Ga0318521_105575652 | 3300031770 | Soil | SRPAPQVTGEPSGDRALRSPRTEKQRAATLASGARSQAKRDSR |
| Ga0318566_100760351 | 3300031779 | Soil | VLALAAAPAEGRQGPVLSGEPIGDRALRSPASARTRASTRARGARQQAKRDSR |
| Ga0318566_100894393 | 3300031779 | Soil | GQQGPALTEEPIGDRALRSPASERRRAGTRAEGARWQARRDSR |
| Ga0318566_103498282 | 3300031779 | Soil | EPAAGRQGPPVTAEPTGDRALRSPRTEKQRAGTLAAGARRQAKRDSR |
| Ga0318547_100265771 | 3300031781 | Soil | ARKAPAAADRKGPTVTGEPTGDRALHSPASQKRRASTRAAGARGQAKRDSR |
| Ga0318547_100775414 | 3300031781 | Soil | PRPVPAASRPAPAVTGEPTGDRALRSPRTEKQRAGTLAAGARRQAKRDSR |
| Ga0318503_101174881 | 3300031794 | Soil | EKAEPAAGRQGPPVTAEPTGDRALRSPRTEKQRAGTLAAGARRQAKRDSR |
| Ga0318576_106363611 | 3300031796 | Soil | GPTVTGEPTGDRALRSPASQKRRASTRAAGARGQAKRDSR |
| Ga0318497_103257401 | 3300031805 | Soil | GPAAGRPGPPVTGEPTGDRALRSPRTEKQRAGTLAAGARRQAKRDSR |
| Ga0318568_106977551 | 3300031819 | Soil | PGPAVTTEPTGDRALHSPASKKRRASTRAAGARQQAKRDSR |
| Ga0318564_104959072 | 3300031831 | Soil | PAASRPAPQVTGEPTGDRALRSPRTEKQRAGTLASGARSQAKRDSR |
| Ga0318512_104683391 | 3300031846 | Soil | APAVTGEPTGDRALRSPRTEKQRAGTLAAGARRQAKRDSR |
| Ga0318512_105005021 | 3300031846 | Soil | PTGDRALRSPALAKRRAGTRATGARRQAKRDSRNTPRPAD |
| Ga0306925_109025561 | 3300031890 | Soil | APGTPAAAPATARTGPAVTPEPTGDRALRSPALAKRRASTRAADARQQAKRDSR |
| Ga0306925_109420651 | 3300031890 | Soil | QVTGEPTGDRALRSPRTEKQRAGTLASGARSQAKRDSR |
| Ga0306923_111200691 | 3300031910 | Soil | KQGRGPGVGAAVPAAGRTGPMVTGEPTGDRALRSPASAKRRAGTRATGARQQAKRDSR |
| Ga0306923_113699721 | 3300031910 | Soil | DRALRSPALAKRRASTRATGARRQAKRDSRNTPRAAD |
| Ga0310912_102657811 | 3300031941 | Soil | AADRKRPTVTGEPTGDRALRSPVSQKRRASTRAAGARGQAKRDSR |
| Ga0310912_112064412 | 3300031941 | Soil | RAAKQGHGPAAPAAEPATSRPAPQVTGEPSGDRALRSPRTEKQRAATLASGARSQAKRDS |
| Ga0310910_107678422 | 3300031946 | Soil | GPAVTGEPTGDRALRSPALAKRRASTRAAGARRQAARDSR |
| Ga0306926_105885811 | 3300031954 | Soil | PQAEPAAGRKGPTVTAEPTGDRALRSPRTEKQRASTLAAGARRQAKRDSR |
| Ga0306926_109630202 | 3300031954 | Soil | PGTPAAAPATARTGPAVTPEPTGDRALRSPALAKRRASTRAADARQQAKRDSR |
| Ga0318563_105717141 | 3300032009 | Soil | VAVVKLLQQREAGRQLGPAVTGEPTGDRALRSPRTEKQRASTLAAGARRQAKRDSR |
| Ga0318569_105099881 | 3300032010 | Soil | LRAERIAAARAARQGRDPAKSGAEPTGGRKGPAVTGEPTGDRALRSPRTEKQRASTLAAGDRRQAKKDSR |
| Ga0318549_101324521 | 3300032041 | Soil | PAASRPAPAVTGEPTGDRALRSPRTEKQRAGTLAAGARRQAKRDSR |
| Ga0318556_103991711 | 3300032043 | Soil | AAGRQGPPVTEEPTGDRALRSPRTEKQRAGTLAAGARRQAKRDSR |
| Ga0318514_100107406 | 3300032066 | Soil | EPPGDRAPRSPATQMRRASTRAADARQQAKRDSRG |
| Ga0318514_106540201 | 3300032066 | Soil | TGQQGPALTEEPIGDRALRSPASERRRAGTRAEGARWQARRDSR |
| Ga0318524_107254481 | 3300032067 | Soil | AVTGEPTGDRALRSPRTEKQRASTLASGDRRQAKKDSR |
| Ga0318553_102847773 | 3300032068 | Soil | GPAVTGEPTGDRALRSPRTEKQRASTLAAGARRQAKRDSRPAPSG |
| Ga0318553_103793012 | 3300032068 | Soil | GRKGPAVTGEPTGDRALRSPNMEKRRAGTRAAGARTQAKRDSR |
| Ga0306924_125055102 | 3300032076 | Soil | PEPTGDRALRSPALAKRRASTRAADARRQAKRDSR |
| Ga0318525_100975143 | 3300032089 | Soil | AAPAAGPAASRPAPQVTGEPTGDRALRSPRTEKQRAGTLASGARSQAKRDSR |
| Ga0306920_1023845441 | 3300032261 | Soil | AAGPKGPAVTGEPTGDRALRSPALAKRRASTRATGARRQAKRDSRNTPRAAD |
| Ga0335079_115543762 | 3300032783 | Soil | GPAVTGEPKGDRALRSPRTEKQRAGTLAAGARRQAKRDSR |
| Ga0335079_119460693 | 3300032783 | Soil | GQPTGDRALRSPASAKRRASTRASGARQQARRDSR |
| Ga0335080_107802071 | 3300032828 | Soil | GSTVTGEPIGDRALRSPASAKRRASTRATGARQQAKRDSR |
| Ga0335076_118085722 | 3300032955 | Soil | GPKKAEPAAGRQGPPVTAEPTGDRALRSPRTEKQRAGTLAAGARRQAKRDSR |
| Ga0335077_1000660018 | 3300033158 | Soil | GEPTGDRALRSPRTEKQRAGTLAAGARRQAKRDSR |
| Ga0318519_107924632 | 3300033290 | Soil | PAPARTGPAVTPEPTGDRALRSPALAKRRASTRATGARRQAKRDSRNTPRAAD |
| ⦗Top⦘ |