NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F056084

Metagenome Family F056084

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F056084
Family Type Metagenome
Number of Sequences 138
Average Sequence Length 44 residues
Representative Sequence QASSYFRLTSFITIGSTEFNLYSLLYQDQTGAVRPIQRSFTPD
Number of Associated Samples 119
Number of Associated Scaffolds 138

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.45 %
% of genes near scaffold ends (potentially truncated) 97.10 %
% of genes from short scaffolds (< 2000 bps) 89.86 %
Associated GOLD sequencing projects 112
AlphaFold2 3D model prediction Yes
3D model pTM-score0.61

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (76.087 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(23.188 % of family members)
Environment Ontology (ENVO) Unclassified
(28.261 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(38.406 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 43.66%    Coil/Unstructured: 56.34%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.61
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 138 Family Scaffolds
PF05134T2SSL 66.67
PF12693GspL_C 19.57
PF04612T2SSM 3.62
PF01203T2SSN 1.45
PF03934T2SSK 0.72
PF02954HTH_8 0.72
PF13361UvrD_C 0.72
PF05977MFS_3 0.72
PF12705PDDEXK_1 0.72
PF01590GAF 0.72

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 138 Family Scaffolds
COG3297Type II secretory pathway, component PulLIntracellular trafficking, secretion, and vesicular transport [U] 66.67
COG3149Type II secretory pathway, component PulMIntracellular trafficking, secretion, and vesicular transport [U] 3.62
COG2814Predicted arabinose efflux permease AraJ, MFS familyCarbohydrate transport and metabolism [G] 0.72
COG3156Type II secretory pathway, component PulKIntracellular trafficking, secretion, and vesicular transport [U] 0.72


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms84.06 %
UnclassifiedrootN/A15.94 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004633|Ga0066395_10962730Not Available519Open in IMG/M
3300005175|Ga0066673_10131711All Organisms → cellular organisms → Bacteria → Proteobacteria1375Open in IMG/M
3300005439|Ga0070711_101083263All Organisms → cellular organisms → Bacteria → Proteobacteria690Open in IMG/M
3300005530|Ga0070679_100352294All Organisms → cellular organisms → Bacteria → Proteobacteria1420Open in IMG/M
3300005554|Ga0066661_10164069All Organisms → cellular organisms → Bacteria → Proteobacteria1365Open in IMG/M
3300005556|Ga0066707_10137667All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1537Open in IMG/M
3300005563|Ga0068855_100096318All Organisms → cellular organisms → Bacteria → Proteobacteria3410Open in IMG/M
3300005614|Ga0068856_102662911All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Lamiales → Oleaceae → Oleeae → Olea → Olea europaea → Olea europaea subsp. europaea506Open in IMG/M
3300005712|Ga0070764_10864752Not Available565Open in IMG/M
3300005844|Ga0068862_101584721All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Lamiales → Oleaceae → Oleeae → Olea → Olea europaea → Olea europaea subsp. europaea662Open in IMG/M
3300005921|Ga0070766_10520818All Organisms → cellular organisms → Bacteria → Proteobacteria792Open in IMG/M
3300006050|Ga0075028_100774194Not Available583Open in IMG/M
3300006163|Ga0070715_11032110Not Available514Open in IMG/M
3300006173|Ga0070716_101235123Not Available601Open in IMG/M
3300006175|Ga0070712_100195617All Organisms → cellular organisms → Bacteria → Proteobacteria1585Open in IMG/M
3300006796|Ga0066665_10757309All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium768Open in IMG/M
3300006797|Ga0066659_10836328All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium765Open in IMG/M
3300006893|Ga0073928_10955668All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Lamiales → Oleaceae → Oleeae → Olea → Olea europaea → Olea europaea subsp. europaea585Open in IMG/M
3300007258|Ga0099793_10164839All Organisms → cellular organisms → Bacteria → Proteobacteria1054Open in IMG/M
3300009177|Ga0105248_13102022Not Available529Open in IMG/M
3300009551|Ga0105238_11269691All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Lamiales → Oleaceae → Oleeae → Olea → Olea europaea → Olea europaea subsp. europaea762Open in IMG/M
3300009826|Ga0123355_12044217All Organisms → cellular organisms → Bacteria → Proteobacteria529Open in IMG/M
3300010048|Ga0126373_12119619Not Available624Open in IMG/M
3300010048|Ga0126373_12284590Not Available601Open in IMG/M
3300010048|Ga0126373_13029116All Organisms → cellular organisms → Bacteria → Proteobacteria524Open in IMG/M
3300010359|Ga0126376_12940322All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300010373|Ga0134128_10234835All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2059Open in IMG/M
3300010373|Ga0134128_12125112Not Available618Open in IMG/M
3300012202|Ga0137363_10150892All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1826Open in IMG/M
3300012210|Ga0137378_11651520All Organisms → cellular organisms → Bacteria → Proteobacteria548Open in IMG/M
3300012582|Ga0137358_10085516All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2126Open in IMG/M
3300012683|Ga0137398_10284897All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1107Open in IMG/M
3300012685|Ga0137397_10021510All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria4534Open in IMG/M
3300012924|Ga0137413_11459556All Organisms → cellular organisms → Bacteria → Proteobacteria554Open in IMG/M
3300012925|Ga0137419_11098729All Organisms → cellular organisms → Bacteria → Proteobacteria662Open in IMG/M
3300012948|Ga0126375_11721211All Organisms → cellular organisms → Bacteria → Proteobacteria544Open in IMG/M
3300013100|Ga0157373_11511949All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Lamiales → Oleaceae → Oleeae → Olea → Olea europaea → Olea europaea subsp. europaea513Open in IMG/M
3300013296|Ga0157374_11985996All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Lamiales → Oleaceae → Oleeae → Olea → Olea europaea → Olea europaea subsp. europaea608Open in IMG/M
3300013296|Ga0157374_12596631All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Lamiales → Oleaceae → Oleeae → Olea → Olea europaea → Olea europaea subsp. europaea534Open in IMG/M
3300014655|Ga0181516_10678763Not Available533Open in IMG/M
3300015241|Ga0137418_10007554All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli9992Open in IMG/M
3300015264|Ga0137403_10192815All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1975Open in IMG/M
3300015372|Ga0132256_100254757All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1826Open in IMG/M
3300016341|Ga0182035_11869728All Organisms → cellular organisms → Bacteria → Proteobacteria544Open in IMG/M
3300016357|Ga0182032_11715374Not Available548Open in IMG/M
3300016357|Ga0182032_11985884All Organisms → cellular organisms → Bacteria → Proteobacteria510Open in IMG/M
3300016387|Ga0182040_10466990All Organisms → cellular organisms → Bacteria → Proteobacteria1003Open in IMG/M
3300016387|Ga0182040_11773178All Organisms → cellular organisms → Bacteria → Proteobacteria528Open in IMG/M
3300016422|Ga0182039_10374318All Organisms → cellular organisms → Bacteria → Proteobacteria1202Open in IMG/M
3300016422|Ga0182039_10469629All Organisms → cellular organisms → Bacteria → Proteobacteria1081Open in IMG/M
3300017930|Ga0187825_10303300All Organisms → cellular organisms → Bacteria → Proteobacteria596Open in IMG/M
3300017959|Ga0187779_11094751All Organisms → cellular organisms → Bacteria → Proteobacteria556Open in IMG/M
3300017972|Ga0187781_11232784All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria551Open in IMG/M
3300017973|Ga0187780_11168038Not Available564Open in IMG/M
3300017975|Ga0187782_10117886All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1961Open in IMG/M
3300018060|Ga0187765_11012738All Organisms → cellular organisms → Bacteria → Proteobacteria570Open in IMG/M
3300018433|Ga0066667_12059703All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium526Open in IMG/M
3300020199|Ga0179592_10259975All Organisms → cellular organisms → Bacteria → Proteobacteria777Open in IMG/M
3300020581|Ga0210399_10561281All Organisms → cellular organisms → Bacteria → Proteobacteria946Open in IMG/M
3300021180|Ga0210396_10618550All Organisms → cellular organisms → Bacteria → Proteobacteria941Open in IMG/M
3300021362|Ga0213882_10067639All Organisms → cellular organisms → Bacteria → Proteobacteria1425Open in IMG/M
3300021402|Ga0210385_11344925All Organisms → cellular organisms → Bacteria → Proteobacteria547Open in IMG/M
3300021432|Ga0210384_10502221All Organisms → cellular organisms → Bacteria → Proteobacteria1092Open in IMG/M
3300021444|Ga0213878_10276091All Organisms → cellular organisms → Bacteria → Proteobacteria718Open in IMG/M
3300021444|Ga0213878_10562520Not Available504Open in IMG/M
3300021479|Ga0210410_11270461All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium628Open in IMG/M
3300021559|Ga0210409_10679492All Organisms → cellular organisms → Bacteria → Proteobacteria900Open in IMG/M
3300021559|Ga0210409_11286388All Organisms → cellular organisms → Bacteria → Proteobacteria607Open in IMG/M
3300024330|Ga0137417_1284766All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Lamiales → Oleaceae → Oleeae → Olea → Olea europaea → Olea europaea subsp. europaea688Open in IMG/M
3300025321|Ga0207656_10546313All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Lamiales → Oleaceae → Oleeae → Olea → Olea europaea → Olea europaea subsp. europaea590Open in IMG/M
3300025905|Ga0207685_10019241All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2247Open in IMG/M
3300025912|Ga0207707_11416674All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Lamiales → Oleaceae → Oleeae → Olea → Olea europaea → Olea europaea subsp. europaea554Open in IMG/M
3300025914|Ga0207671_10558770All Organisms → cellular organisms → Bacteria → Proteobacteria912Open in IMG/M
3300025915|Ga0207693_10678951Not Available799Open in IMG/M
3300025921|Ga0207652_10416412All Organisms → cellular organisms → Bacteria → Proteobacteria1212Open in IMG/M
3300025924|Ga0207694_10365501All Organisms → cellular organisms → Bacteria → Proteobacteria1196Open in IMG/M
3300025924|Ga0207694_10876106All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Lamiales → Oleaceae → Oleeae → Olea → Olea europaea → Olea europaea subsp. europaea759Open in IMG/M
3300025981|Ga0207640_10084421Not Available2181Open in IMG/M
3300026067|Ga0207678_10748082All Organisms → cellular organisms → Bacteria → Proteobacteria862Open in IMG/M
3300026342|Ga0209057_1044191All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2170Open in IMG/M
3300026527|Ga0209059_1122862All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans991Open in IMG/M
3300026527|Ga0209059_1122992All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium990Open in IMG/M
3300026551|Ga0209648_10835911All Organisms → cellular organisms → Bacteria → Proteobacteria504Open in IMG/M
3300027591|Ga0209733_1047653All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1137Open in IMG/M
3300027889|Ga0209380_10660729All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria602Open in IMG/M
3300028379|Ga0268266_10544558All Organisms → cellular organisms → Bacteria → Proteobacteria1111Open in IMG/M
3300028381|Ga0268264_10355210All Organisms → cellular organisms → Bacteria → Proteobacteria1396Open in IMG/M
3300028381|Ga0268264_11958373All Organisms → cellular organisms → Bacteria → Proteobacteria595Open in IMG/M
3300028801|Ga0302226_10153334All Organisms → cellular organisms → Bacteria → Proteobacteria1000Open in IMG/M
3300030520|Ga0311372_11771122All Organisms → cellular organisms → Bacteria → Proteobacteria739Open in IMG/M
3300030524|Ga0311357_11451715Not Available582Open in IMG/M
3300030906|Ga0302314_10675228All Organisms → cellular organisms → Bacteria → Proteobacteria1061Open in IMG/M
3300030906|Ga0302314_11266740All Organisms → cellular organisms → Bacteria → Proteobacteria685Open in IMG/M
3300031231|Ga0170824_113466660All Organisms → cellular organisms → Bacteria → Proteobacteria1185Open in IMG/M
3300031232|Ga0302323_100474353All Organisms → cellular organisms → Bacteria → Proteobacteria1337Open in IMG/M
3300031234|Ga0302325_12156610All Organisms → cellular organisms → Bacteria → Proteobacteria680Open in IMG/M
3300031544|Ga0318534_10805905Not Available528Open in IMG/M
3300031544|Ga0318534_10850739All Organisms → cellular organisms → Bacteria → Proteobacteria511Open in IMG/M
3300031549|Ga0318571_10383393Not Available545Open in IMG/M
3300031561|Ga0318528_10066850All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1845Open in IMG/M
3300031708|Ga0310686_103411642Not Available618Open in IMG/M
3300031708|Ga0310686_118041708All Organisms → cellular organisms → Bacteria → Proteobacteria648Open in IMG/M
3300031718|Ga0307474_10915741All Organisms → cellular organisms → Bacteria → Proteobacteria694Open in IMG/M
3300031720|Ga0307469_12455125Not Available509Open in IMG/M
3300031744|Ga0306918_11132585All Organisms → cellular organisms → Bacteria → Proteobacteria605Open in IMG/M
3300031753|Ga0307477_10147525All Organisms → cellular organisms → Bacteria → Proteobacteria1641Open in IMG/M
3300031768|Ga0318509_10261495All Organisms → cellular organisms → Bacteria → Proteobacteria967Open in IMG/M
3300031771|Ga0318546_10578796All Organisms → cellular organisms → Bacteria → Proteobacteria789Open in IMG/M
3300031792|Ga0318529_10265378All Organisms → cellular organisms → Bacteria → Proteobacteria799Open in IMG/M
3300031793|Ga0318548_10101723All Organisms → cellular organisms → Bacteria → Proteobacteria1376Open in IMG/M
3300031796|Ga0318576_10301003All Organisms → cellular organisms → Bacteria → Proteobacteria757Open in IMG/M
3300031797|Ga0318550_10033397All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2229Open in IMG/M
3300031798|Ga0318523_10290993All Organisms → cellular organisms → Bacteria → Proteobacteria815Open in IMG/M
3300031820|Ga0307473_10022580All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2596Open in IMG/M
3300031831|Ga0318564_10092845All Organisms → cellular organisms → Bacteria → Proteobacteria1337Open in IMG/M
3300031832|Ga0318499_10210931All Organisms → cellular organisms → Bacteria → Proteobacteria756Open in IMG/M
3300031845|Ga0318511_10267179All Organisms → cellular organisms → Bacteria → Proteobacteria769Open in IMG/M
3300031846|Ga0318512_10051383All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1841Open in IMG/M
3300031860|Ga0318495_10326767All Organisms → cellular organisms → Bacteria → Proteobacteria681Open in IMG/M
3300031890|Ga0306925_10524562All Organisms → cellular organisms → Bacteria → Proteobacteria1259Open in IMG/M
3300031910|Ga0306923_10575232All Organisms → cellular organisms → Bacteria → Proteobacteria1267Open in IMG/M
3300031912|Ga0306921_10447766All Organisms → cellular organisms → Bacteria → Proteobacteria1504Open in IMG/M
3300031912|Ga0306921_11076744All Organisms → cellular organisms → Bacteria → Proteobacteria902Open in IMG/M
3300031942|Ga0310916_10124770All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2099Open in IMG/M
3300031954|Ga0306926_10151638All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2870Open in IMG/M
3300031954|Ga0306926_11673397All Organisms → cellular organisms → Bacteria → Proteobacteria727Open in IMG/M
3300031959|Ga0318530_10381154Not Available584Open in IMG/M
3300031962|Ga0307479_10112668All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2647Open in IMG/M
3300031962|Ga0307479_10463845All Organisms → cellular organisms → Bacteria → Proteobacteria1251Open in IMG/M
3300032041|Ga0318549_10230511All Organisms → cellular organisms → Bacteria → Proteobacteria832Open in IMG/M
3300032041|Ga0318549_10486591Not Available555Open in IMG/M
3300032043|Ga0318556_10137239All Organisms → cellular organisms → Bacteria → Proteobacteria1257Open in IMG/M
3300032054|Ga0318570_10097397All Organisms → cellular organisms → Bacteria → Proteobacteria1281Open in IMG/M
3300032064|Ga0318510_10283681All Organisms → cellular organisms → Bacteria → Proteobacteria687Open in IMG/M
3300032065|Ga0318513_10008942All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria3822Open in IMG/M
3300032180|Ga0307471_102615401All Organisms → cellular organisms → Bacteria → Proteobacteria639Open in IMG/M
3300032515|Ga0348332_14163182All Organisms → cellular organisms → Bacteria → Proteobacteria893Open in IMG/M
3300033290|Ga0318519_10609134All Organisms → cellular organisms → Bacteria → Proteobacteria664Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil23.19%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil10.14%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.07%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil5.07%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.35%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa4.35%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.62%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.62%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.90%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.90%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.17%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.17%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.17%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.45%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.45%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil1.45%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.45%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.45%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.72%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.72%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.72%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.72%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.72%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.72%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.72%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.72%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.72%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.72%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.72%
Termite GutHost-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut0.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.72%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.72%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.72%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.72%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009826Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1Host-AssociatedOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300014655Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaGEnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021362Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09EnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021444Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02EnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300024330Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025321Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026342Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes)EnvironmentalOpen in IMG/M
3300026527Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes)EnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300027591Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028801Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3EnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030524II_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030906Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0066395_1096273023300004633Tropical Forest SoilVQSKFTETSGYFRLTSFITIGSAEFNSYSLLYRDATGAVRPIQRSFTPD*
Ga0066673_1013171123300005175SoilKIAQASSYFRLTSIITIGSTEFTLYSLLYQERGGDAKVRPILRSFTPD*
Ga0070711_10108326323300005439Corn, Switchgrass And Miscanthus RhizosphereFRLTSHVTIGTTEFNLYSLLYLESGTGTTRPILRSYSPD*
Ga0070679_10035229413300005530Corn RhizosphereSSYFRLTSHITIGSTEFNLYSLLYQEGTGNVRPIQRSFAPD*
Ga0066661_1016406913300005554SoilTSFITIGSAEFNLYSLLYQDQNSVRPILRSFTPD*
Ga0066707_1013766713300005556SoilKVDAKIAQASSYFRLTSIITIGSTEFTLYSLLYQERGGDAKVRPILRSFTPD*
Ga0068855_10009631813300005563Corn RhizosphereSYFRLTSHITIGSTEFNLYSLLYQDGTGNVRPIQRSFAPD*
Ga0068856_10266291113300005614Corn RhizosphereLTSHITIGSTEFNLYSLLYQEGTGNVRPIQRSFAPD*
Ga0070764_1086475213300005712SoilLTSVVSIGSTEINLYSLLFQDPQAQMVRPIQRSFTPD*
Ga0068862_10158472123300005844Switchgrass RhizosphereYFRLSSLITIGSAEFNLYSLLYLDNQNFVHPIQRSFSPD*
Ga0070766_1052081813300005921SoilLKIAQVSNYFRLTSFITIGSAEFNLYSLLFQDGSGKARPIQRSFTPD*
Ga0075028_10077419413300006050WatershedsVSQSFTETSSYFRLTSLVTIGSAEFNLYSLLYQDGSGAARPILRSFTPQ*
Ga0070715_1103211023300006163Corn, Switchgrass And Miscanthus RhizosphereYFRLTSFITIGSAEFNLYSLLYQDGTGAARPIQRSFTPD*
Ga0070716_10123512323300006173Corn, Switchgrass And Miscanthus RhizosphereFNQFSTYFRLTSFITIGGAEFNLYSLLYRDATGAVRPIQRSFTPD*
Ga0070712_10019561713300006175Corn, Switchgrass And Miscanthus RhizosphereSKFAQVSSYFRLTSIVSIGSTEFNLYSLLYLDQQQQIRPVQRSFTPD*
Ga0066665_1075730913300006796SoilFRLTSIITIGSTEFTLYSLLYQERGGDAQVRPILRSFTPD*
Ga0066659_1083632813300006797SoilDPQLKTKVDAKIAQASSYFRLTSIITIGSTEFTLYSLLYQDRGGLGAKVRPILRTFTPD*
Ga0073928_1095566823300006893Iron-Sulfur Acid SpringNSSYFRLTSFVTIGSTEFNLYRLLYQDATGSVRPLLRSYTPD*
Ga0099793_1016483913300007258Vadose Zone SoilSFITIGSAEFNLYSLLYQDPNGGGTVRPIQRSFTPD*
Ga0105248_1310202223300009177Switchgrass RhizosphereYFKLTSYITINTTEFNLYSLLFQEGSGKVRPILRSYTPD*
Ga0105238_1126969113300009551Corn RhizosphereSLITIGTTEFNLYSLLYVDQQGHYAHPLQRSFSPD*
Ga0123355_1204421723300009826Termite GutSAGGSAAFAETTTYFRLTSFITIGSAQFNLYSLLYQDQTGALRPIQRSFTAD*
Ga0126373_1211961913300010048Tropical Forest SoilNSVYFRLTSFITIGSAEFNLYSLLYRDQTGAVRPIQRSFAPD*
Ga0126373_1228459023300010048Tropical Forest SoilQNSVYFRLSSFITVGSTQFSLYSLLFRDNTGAVRPIQRSFTPD*
Ga0126373_1302911613300010048Tropical Forest SoilPKKWAAAQPKFGQNSTYFRLTSFITIGSTQFSLYSLLYRDATGAVRPIQRSFTPD*
Ga0126376_1294032223300010359Tropical Forest SoilMTSHYFQLKSFITIGSTEFNLYSLLYQDGTQMVRPIQRSFTAD*
Ga0134128_1023483513300010373Terrestrial SoilFGTTSQYFRLTSFITIGSAEFNLYSLLYQDGTGAVRPIQRSFTPD*
Ga0134128_1212511213300010373Terrestrial SoilAVRSKFNQFSTYFRLTSFITIGGAEFNLYSLLYRDATGTVRPIQRSFTPD*
Ga0137363_1015089233300012202Vadose Zone SoilYFRLTSFITIGSAEFNLYSLLYQDPNTGGAVRPILRGFTPD*
Ga0137378_1165152013300012210Vadose Zone SoilQVSSYFRLTSFITIGSAEFNLYSLLYQDQYGGGAVRPILRSFTPD*
Ga0137358_1008551643300012582Vadose Zone SoilFRLTSFITIGSAEFNLYSLLYQDPNGGGTVRPILRSFTPD*
Ga0137398_1028489723300012683Vadose Zone SoilIITIGSTEFTLYSLLYQERGGDAKVRPILRSFTPD*
Ga0137397_1002151013300012685Vadose Zone SoilPKLLLQVRPKIAQVSSYFRLTSFITIGSAEFNLYSLLYQDPQGAGTVRPILRSFTPD*
Ga0137413_1145955623300012924Vadose Zone SoilSMNSGYFRLTSFVTIGSAEFNLYSLLYQDATGTVRTLLRSYTPD*
Ga0137419_1109872913300012925Vadose Zone SoilKIAQVSSYFRLTSFITIGSAEFNLYSLLYQDPNGGGTVRPILRSFTPD*
Ga0126375_1172121123300012948Tropical Forest SoilSTYFRLTSFVTIGGAQFNLYSLMYRDATGAVRPIQRSFTPD*
Ga0157373_1151194923300013100Corn RhizosphereLTSHITIGSTEFNLYSLLYQDGTGNVRPIQRSFAPD*
Ga0157374_1198599613300013296Miscanthus RhizosphereFSETSMYFKLTSFITIGTTEFNLYSLLTQDQTGNVRPILRSYTPD*
Ga0157374_1259663123300013296Miscanthus RhizosphereRLSSLITIGSAEFNLYSLLYLDNQNFVHPIQRSFSPD*
Ga0181516_1067876313300014655BogPGLQSKFGQTSSYFRLTSVVSIGSTEINLYSLLYQDSQAQMVRPIQRSFTPD*
Ga0137418_1000755413300015241Vadose Zone SoilVRPKIAQVSSYFRLTSFITIGSAEFNLYSLLYQDPNGGGTVRPILRSFTPD*
Ga0137403_1019281533300015264Vadose Zone SoilRLTSFITIGSAEFNLYSLLYQDPQGAGTVRPILRSFTPD*
Ga0132256_10025475713300015372Arabidopsis RhizosphereVQQKLGQTSAYFRLTSFVTIGGAEFNLYSLLYRDATGAVRPIQRSFTPD*
Ga0182035_1186972823300016341SoilYFRLTSFITIGSAQFNLYSLLYQDATGAVRPIQRSFTAD
Ga0182032_1171537413300016357SoilTVYFRLTSYIAIGSAQFNLYSLLYRDATGAVRPIQRSFTPD
Ga0182032_1198588423300016357SoilLTSLITVGSAEFNLYSLLYRDATGAVRPIQRSFTSD
Ga0182040_1046699023300016387SoilFRLTSFITIGSTEFNLYSLMYRDGTGVVRPIQRSFTPD
Ga0182040_1177317813300016387SoilTSFITVGSAEFNLYSLLYRDATGAVRPIQRSFTPD
Ga0182039_1037431823300016422SoilVQTLILVSFGSAAQKSFGQNSVYFRLTSFITIGSAEFNLYSLLFRDNTGAVRPIQRSFAP
Ga0182039_1046962923300016422SoilTSFITIGSTQFSLYSLMYRDGTGAVRPIQRSFTPD
Ga0187825_1030330023300017930Freshwater SedimentAYFRLTSFITIGSAEFNLYSLMFQDGTGMARPIQRSFTPD
Ga0187779_1109475123300017959Tropical PeatlandFSQTSNYFRLTSFITIGSTEFSLYSLMYQDATNAVRPIQRSFTPE
Ga0187781_1123278413300017972Tropical PeatlandMNSSYFRLKSYITIGSTEISLYSLLYQDGTGMTRPILRS
Ga0187780_1116803823300017973Tropical PeatlandQSLITIGSTEFNLYSLLLQDPTGQVRPILRSYTPD
Ga0187782_1011788613300017975Tropical PeatlandLANTFGQTSQYFRLTSFITIGSAEFNLYSLLYQDTNGTVRPIQRSFTPD
Ga0187765_1101273823300018060Tropical PeatlandMSNYFSQTSSYFRLTSFITIGSTEFSLYSLLYQDSTSAVRPIQRSFTPE
Ga0066667_1205970313300018433Grasslands SoilIITIGSTEFTLYSLLYQERGGDAKVRPILRSFTPD
Ga0179592_1025997513300020199Vadose Zone SoilFITIGSAEFNLYSLLYQDPQGAGTVRPILRSFTPD
Ga0210399_1056128123300020581SoilWKNISGKLQMTSSYFRLTSLIAIGSSEFNLYSLLLQDPTGQVRPILRSYTPD
Ga0210396_1061855023300021180SoilNSNYFRLTSFVTIGSTEFNVYSLLLMDANGTGSVRAILRTYTPD
Ga0213882_1006763923300021362Exposed RockLTSFITIGSTEFNLYSLLYQDGNTGFGVRPIQRSFTPD
Ga0210385_1134492513300021402SoilNYFRLTSFITIGSAEFNLYSLLYQDTTGSVRPIQRSFTPD
Ga0210384_1050222123300021432SoilSRQPGTQGAQSKFAQVSSYFRLTSIVSIGSTEFNLYSLLYQDATMQQVRPIQRSFTPD
Ga0213878_1027609123300021444Bulk SoilKLQMTSSYFRLTSLITIGSTEFNLYSLLLQDPTGQVRPILRSYTPD
Ga0213878_1056252023300021444Bulk SoilLTSLITIGSTEFNLYSLLLQDPTGQVRPILRSYTPD
Ga0210410_1127046113300021479SoilGGANKKFGMTSNYFRLSSFITIGSAEFNLYSLLYQDNAGAGAVRPILRSYTPE
Ga0210409_1067949213300021559SoilGAQGKFGQTSSYFRLTSIVSIGSTEFNLYSLLYQDATMQQVRPIQRSFTPD
Ga0210409_1128638813300021559SoilFRLTSFITIGSAEFNLYSLLFQDGSGRVRPIQRSFTPD
Ga0137417_128476623300024330Vadose Zone SoilSKYFRLSSLVTIGTAEFNLYSLLLMDNNQGYFIHPIQRSFSPD
Ga0207656_1054631323300025321Corn RhizosphereSVVAESIQKKQTSPYFRLSSLITIGSAEFNLYSLLYLDNQNFVHPIQRSFSPD
Ga0207685_1001924113300025905Corn, Switchgrass And Miscanthus RhizosphereTSQYFRLTSFVTIGGAEFNLYSLLYRDATGAVRPIQRSFTPD
Ga0207707_1141667413300025912Corn RhizosphereVTGSVGAQTSRLVQTSPYFRLSSLITIGSAEFNLYSLLYLDQQNFVHPIQRSFSPD
Ga0207671_1055877013300025914Corn RhizosphereTSNYFRLSSLVTIGSAEFNLYSLLYLDNNGYFVHPIQRSFSPD
Ga0207693_1067895113300025915Corn, Switchgrass And Miscanthus RhizosphereQVSSYFRLTSIVSIGSTEFNLYSLLYLDQQQQIRPVQRSFTPD
Ga0207652_1041641213300025921Corn RhizosphereQVQGELKETSSYFRLTSHITIGSTEFNLYSLLYQEGTGNVRPIQRSFAPD
Ga0207694_1036550123300025924Corn RhizosphereRLTSHVTIGTTEFNLYSLLFLDQNGTSRPILRSYSPD
Ga0207694_1087610613300025924Corn RhizosphereSLITIGTTEFNLYSLLYVDQQGHYAHPLQRSFSPD
Ga0207640_1008442143300025981Corn RhizosphereVQTSSYFRLSSLITIGSAEFNLYSLLYLDQQNFVHPIQRSFSPD
Ga0207678_1074808223300026067Corn RhizosphereSYFRLSSLITIGSAEFNLYSLLYLDQQNFVHPIQRSFSPD
Ga0209057_104419113300026342SoilVDAKIAQASSYFRLTSIITIGSTEFTLYSLLYQERGGDAKVRPILRSFTPD
Ga0209059_112286223300026527SoilDAKIAQASSYFRLTSIITIGSTEFTLYSLLYQDRGSDAKVRPILRSFTPD
Ga0209059_112299223300026527SoilDAKIAQASSYFRLTSIITIGSTEFTLYSLLYQERGGDAKVRPILRSFTPD
Ga0209648_1083591123300026551Grasslands SoilTSSYFRLTSFITIGSAEFNLYSLLYQDQNSVRPILRSFTPD
Ga0209733_104765313300027591Forest SoilMFAETSNYFRLTSFVTIGSAEFNLYSLLYQDNTGTVRTLLRSYTPD
Ga0209380_1066072923300027889SoilFGTASSYFRLTSFVTIGATEFNLYSLLFQDAQGNVRPLLRSYTPD
Ga0268266_1054455823300028379Switchgrass RhizosphereFRLSSLVTIGTTEFNLYSLLFMNPQYVVFPIQRSFSPD
Ga0268264_1035521013300028381Switchgrass RhizosphereYFRLSSLVTIGTTEFNLYSLLFMNPQYVVFPIQRSFSPD
Ga0268264_1195837323300028381Switchgrass RhizosphereTSFITIGTTEFNLYSLLTQDQTGNVRPILRSYTPD
Ga0302226_1015333423300028801PalsaGTPGLQSKFAQTSSYFRLTSVVSIGSTEINLYSLLYQDSQAQMVRPIQRSFTPD
Ga0311372_1177112213300030520PalsaFGQASSYFRLTSFITIGSTEFNLYSLLYQDQTGAVRPIQRSFTPD
Ga0311357_1145171523300030524PalsaQASSYFRLTSFITIGSTEFNLYSLLYQDQTGAVRPIQRSFTPD
Ga0302314_1067522823300030906PalsaTSFVTIGATEFNLYSLLYQDQTGNVRPLLRTYTPD
Ga0302314_1126674023300030906PalsaFATNSSYFRLTSFVTIGATEFNLYSLLYQDQTGAVRPIQRSFTPD
Ga0170824_11346666023300031231Forest SoilLTSIVSIGSTEFNLYSLLYLDQQQQIRPVQRSFTPD
Ga0302323_10047435313300031232FenSSLVTIGSAEFNLYSLLLLDKQGYFVHAVQRSFSPD
Ga0302325_1215661023300031234PalsaTNSPYFRLTSFVTIGSTEFNLYSLLYQDQTGNVRPLLRTYTPD
Ga0318534_1080590513300031544SoilTSQAVNKFGQNSVYFRLTSFITIGSAQFSLYSLLYRDATGAVRPIQRSFAPD
Ga0318534_1085073913300031544SoilPTVTRFAENSKYFRLTSLITIGGAEFSLYSLMYIDGTGVVRPIQRSFTPD
Ga0318571_1038339323300031549SoilVYFRLTSYIAIGSAQFNLYSLLYRDATGAVRPIQRSFTPD
Ga0318528_1006685033300031561SoilLGQNSAYFRLTSFVTIGGAQFNLYSLLFRDNTGAVRPIQRSFTPD
Ga0310686_10341164213300031708SoilKFGQNSSYFRLTSFITIGSTEFNLYSLLYQDVTGATRPILRSYTAD
Ga0310686_11804170813300031708SoilSYITIGSSEFNLYSLLYQDGQNGGAVRPVLRSYTAD
Ga0307474_1091574113300031718Hardwood Forest SoilLSSLITIGSAEFNLYSLLYMDLNGPLIHPIQRTFAAD
Ga0307469_1245512513300031720Hardwood Forest SoilRLTSFITIGGAEFNLYSLLYRDTTGTVRPIQRSFTPD
Ga0306918_1113258513300031744SoilFVQNSPYFRLRSLITIGSTEFSLYSLLYRDNTGAVRPIQRSFTPD
Ga0307477_1014752513300031753Hardwood Forest SoilQTSFITIGSAQFNLYSLLYQDATGAVRPIQRSFTAD
Ga0318509_1026149523300031768SoilSQGASPFVQNSPYFRLRSLITIGSTEFSLYSLLYRDNTGAVRPIQRSFTPD
Ga0318546_1057879623300031771SoilAWGQVQAKFGQNTVYFRLTSYIAIGSAQFNLYSLLYRDATGAVRPIQRSFTPD
Ga0318529_1026537823300031792SoilQNSAYFRLTSFVTIGGAQFNLYSLLFRDNTGAVRPIQRSFTPD
Ga0318548_1010172313300031793SoilGSPISKFGQSSQYFRLTSFITIGSAEFNLYSLLYRDTTGAVRPIQRSFTPD
Ga0318576_1030100323300031796SoilLSSFITIGSAEFNLYSLLYRDTTGAVRPIQRSFTPD
Ga0318550_1003339743300031797SoilSAYFRLTSFVTIGGAQFNLYSLLFRDNTGAVRPIQRSFTPD
Ga0318523_1029099323300031798SoilFGQSSQYFRLTSFITIGSAEFNLYSLLYRDTTGAVRPIQRSFTPD
Ga0307473_1002258043300031820Hardwood Forest SoilQGKLGQTSAYFRLTSFITIGGAEFNLYSLLYRDTTGTVRPIQRSFTPD
Ga0318564_1009284513300031831SoilQTSTYFRLTSFVTIGGAQFNLYSLLFRDNTGAVRPIQRSFTPD
Ga0318499_1021093123300031832SoilGQNSAYFRLTSFVTIGGAQFNLYSLLFRDNTGAVRPIQRSFTPD
Ga0318511_1026717913300031845SoilTSTYFRLTSFVTIGGAQFNLYSLLFRDNTGAVRPIQRSFTPD
Ga0318512_1005138333300031846SoilPSPLTKFKQTSAYFRLSSFITIGSAEFNLYSLLYRDTTGAVRPIQRSFTPD
Ga0318495_1032676723300031860SoilSQYFRLTSFITIGSTEFNLYSLMYRDGTGVVRPIQRSFTPD
Ga0306925_1052456223300031890SoilRETSKYFRLTSFITIGSAQFNLYSLLYQDATGAVRPIQRSFSAD
Ga0306923_1057523223300031910SoilYFRLSSFITIGSAEFNLYSLLYRDTTGAVRPIQRSFTPD
Ga0306921_1044776623300031912SoilQVQGKLGQNSAYFRLTSFVTIGGAQFNLYSLLFRDNTGAVRPIQRSFTPD
Ga0306921_1107674423300031912SoilKFGQSSAYFRLSSFITIGSAEFNLYSLLYRDTTGAVRPIQRSFTPD
Ga0310916_1012477043300031942SoilTYFRLTSFVTIGGAQFNLYSLLFRDNTGAVRPIQRSFTPD
Ga0306926_1015163853300031954SoilFGQNSVYFRLTSFITIGSAEFNLYSLLFRDNTGAVRPIQRSFAPD
Ga0306926_1167339723300031954SoilFRLTSFITVGSAEFNLYSLLYRDATGAVRPIQRSFTSD
Ga0318530_1038115413300031959SoilGSTASPISNFGQNSVYFRLTSFITIGSAEFNLYSLLFRDNTGAVRPIQRSFAPD
Ga0307479_1011266843300031962Hardwood Forest SoilFRLTSVITIGSTEFTLYSLLYQDRGSDAKVRPILRSFTPD
Ga0307479_1046384523300031962Hardwood Forest SoilKVQMTSSYFRLTSLVTIGSTEFNLYSLLLQDPTGQVRPILRSYTPD
Ga0318549_1023051113300032041SoilRLSSFITIGSAEFNLYSLLYRDTTGAVRPIQRSFTPD
Ga0318549_1048659113300032041SoilFGQTSVYFRLTSFITVGSAEFNLYSLLYRDATGAVRPIQRSFAPD
Ga0318556_1013723923300032043SoilSTYFRLTSFVTIGGAQFNLYSLLFRDNTGAVRPIQRSFTPD
Ga0318570_1009739723300032054SoilWAQTQGKFGQTSAYFRLTSFITVGSAEFNLYSLLYRDATGAVRPIQRSFTSD
Ga0318510_1028368123300032064SoilTQNKFGQTSAYFRLTSFITVGSAEFNLYSLLYRDATGAVRPIQRSFTSD
Ga0318513_1000894213300032065SoilSTASPISNFGQNSVYFRLTSFITIGSAEFNLYSLLFRDNTGAVRPIQRSFAPD
Ga0307471_10261540113300032180Hardwood Forest SoilIADPKLLAQVRPKIAQVSSYFRLTSFITIGSAEFNLYSLLYQDPNGGGAVRPILRSFTPD
Ga0348332_1416318223300032515Plant LitterSSYFRLTSFVTIGATEFNLYSLLYMDATGSVRPLLRSYTPD
Ga0318519_1060913423300033290SoilFRLTSYIAIGSAQFNLYSLLYRDATGAVRPIQRSFTPD


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.