Basic Information | |
---|---|
Family ID | F056084 |
Family Type | Metagenome |
Number of Sequences | 138 |
Average Sequence Length | 44 residues |
Representative Sequence | QASSYFRLTSFITIGSTEFNLYSLLYQDQTGAVRPIQRSFTPD |
Number of Associated Samples | 119 |
Number of Associated Scaffolds | 138 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 1.45 % |
% of genes near scaffold ends (potentially truncated) | 97.10 % |
% of genes from short scaffolds (< 2000 bps) | 89.86 % |
Associated GOLD sequencing projects | 112 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.61 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (76.087 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (23.188 % of family members) |
Environment Ontology (ENVO) | Unclassified (28.261 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (38.406 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 43.66% Coil/Unstructured: 56.34% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.61 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 138 Family Scaffolds |
---|---|---|
PF05134 | T2SSL | 66.67 |
PF12693 | GspL_C | 19.57 |
PF04612 | T2SSM | 3.62 |
PF01203 | T2SSN | 1.45 |
PF03934 | T2SSK | 0.72 |
PF02954 | HTH_8 | 0.72 |
PF13361 | UvrD_C | 0.72 |
PF05977 | MFS_3 | 0.72 |
PF12705 | PDDEXK_1 | 0.72 |
PF01590 | GAF | 0.72 |
COG ID | Name | Functional Category | % Frequency in 138 Family Scaffolds |
---|---|---|---|
COG3297 | Type II secretory pathway, component PulL | Intracellular trafficking, secretion, and vesicular transport [U] | 66.67 |
COG3149 | Type II secretory pathway, component PulM | Intracellular trafficking, secretion, and vesicular transport [U] | 3.62 |
COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.72 |
COG3156 | Type II secretory pathway, component PulK | Intracellular trafficking, secretion, and vesicular transport [U] | 0.72 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 84.06 % |
Unclassified | root | N/A | 15.94 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300004633|Ga0066395_10962730 | Not Available | 519 | Open in IMG/M |
3300005175|Ga0066673_10131711 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1375 | Open in IMG/M |
3300005439|Ga0070711_101083263 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 690 | Open in IMG/M |
3300005530|Ga0070679_100352294 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1420 | Open in IMG/M |
3300005554|Ga0066661_10164069 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1365 | Open in IMG/M |
3300005556|Ga0066707_10137667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1537 | Open in IMG/M |
3300005563|Ga0068855_100096318 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3410 | Open in IMG/M |
3300005614|Ga0068856_102662911 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Lamiales → Oleaceae → Oleeae → Olea → Olea europaea → Olea europaea subsp. europaea | 506 | Open in IMG/M |
3300005712|Ga0070764_10864752 | Not Available | 565 | Open in IMG/M |
3300005844|Ga0068862_101584721 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Lamiales → Oleaceae → Oleeae → Olea → Olea europaea → Olea europaea subsp. europaea | 662 | Open in IMG/M |
3300005921|Ga0070766_10520818 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 792 | Open in IMG/M |
3300006050|Ga0075028_100774194 | Not Available | 583 | Open in IMG/M |
3300006163|Ga0070715_11032110 | Not Available | 514 | Open in IMG/M |
3300006173|Ga0070716_101235123 | Not Available | 601 | Open in IMG/M |
3300006175|Ga0070712_100195617 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1585 | Open in IMG/M |
3300006796|Ga0066665_10757309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 768 | Open in IMG/M |
3300006797|Ga0066659_10836328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 765 | Open in IMG/M |
3300006893|Ga0073928_10955668 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Lamiales → Oleaceae → Oleeae → Olea → Olea europaea → Olea europaea subsp. europaea | 585 | Open in IMG/M |
3300007258|Ga0099793_10164839 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1054 | Open in IMG/M |
3300009177|Ga0105248_13102022 | Not Available | 529 | Open in IMG/M |
3300009551|Ga0105238_11269691 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Lamiales → Oleaceae → Oleeae → Olea → Olea europaea → Olea europaea subsp. europaea | 762 | Open in IMG/M |
3300009826|Ga0123355_12044217 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 529 | Open in IMG/M |
3300010048|Ga0126373_12119619 | Not Available | 624 | Open in IMG/M |
3300010048|Ga0126373_12284590 | Not Available | 601 | Open in IMG/M |
3300010048|Ga0126373_13029116 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 524 | Open in IMG/M |
3300010359|Ga0126376_12940322 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300010373|Ga0134128_10234835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2059 | Open in IMG/M |
3300010373|Ga0134128_12125112 | Not Available | 618 | Open in IMG/M |
3300012202|Ga0137363_10150892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1826 | Open in IMG/M |
3300012210|Ga0137378_11651520 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 548 | Open in IMG/M |
3300012582|Ga0137358_10085516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2126 | Open in IMG/M |
3300012683|Ga0137398_10284897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1107 | Open in IMG/M |
3300012685|Ga0137397_10021510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4534 | Open in IMG/M |
3300012924|Ga0137413_11459556 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 554 | Open in IMG/M |
3300012925|Ga0137419_11098729 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 662 | Open in IMG/M |
3300012948|Ga0126375_11721211 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 544 | Open in IMG/M |
3300013100|Ga0157373_11511949 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Lamiales → Oleaceae → Oleeae → Olea → Olea europaea → Olea europaea subsp. europaea | 513 | Open in IMG/M |
3300013296|Ga0157374_11985996 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Lamiales → Oleaceae → Oleeae → Olea → Olea europaea → Olea europaea subsp. europaea | 608 | Open in IMG/M |
3300013296|Ga0157374_12596631 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Lamiales → Oleaceae → Oleeae → Olea → Olea europaea → Olea europaea subsp. europaea | 534 | Open in IMG/M |
3300014655|Ga0181516_10678763 | Not Available | 533 | Open in IMG/M |
3300015241|Ga0137418_10007554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli | 9992 | Open in IMG/M |
3300015264|Ga0137403_10192815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1975 | Open in IMG/M |
3300015372|Ga0132256_100254757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1826 | Open in IMG/M |
3300016341|Ga0182035_11869728 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 544 | Open in IMG/M |
3300016357|Ga0182032_11715374 | Not Available | 548 | Open in IMG/M |
3300016357|Ga0182032_11985884 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 510 | Open in IMG/M |
3300016387|Ga0182040_10466990 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1003 | Open in IMG/M |
3300016387|Ga0182040_11773178 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 528 | Open in IMG/M |
3300016422|Ga0182039_10374318 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1202 | Open in IMG/M |
3300016422|Ga0182039_10469629 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1081 | Open in IMG/M |
3300017930|Ga0187825_10303300 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 596 | Open in IMG/M |
3300017959|Ga0187779_11094751 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 556 | Open in IMG/M |
3300017972|Ga0187781_11232784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 551 | Open in IMG/M |
3300017973|Ga0187780_11168038 | Not Available | 564 | Open in IMG/M |
3300017975|Ga0187782_10117886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1961 | Open in IMG/M |
3300018060|Ga0187765_11012738 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 570 | Open in IMG/M |
3300018433|Ga0066667_12059703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 526 | Open in IMG/M |
3300020199|Ga0179592_10259975 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 777 | Open in IMG/M |
3300020581|Ga0210399_10561281 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 946 | Open in IMG/M |
3300021180|Ga0210396_10618550 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 941 | Open in IMG/M |
3300021362|Ga0213882_10067639 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1425 | Open in IMG/M |
3300021402|Ga0210385_11344925 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 547 | Open in IMG/M |
3300021432|Ga0210384_10502221 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1092 | Open in IMG/M |
3300021444|Ga0213878_10276091 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 718 | Open in IMG/M |
3300021444|Ga0213878_10562520 | Not Available | 504 | Open in IMG/M |
3300021479|Ga0210410_11270461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 628 | Open in IMG/M |
3300021559|Ga0210409_10679492 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 900 | Open in IMG/M |
3300021559|Ga0210409_11286388 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 607 | Open in IMG/M |
3300024330|Ga0137417_1284766 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Lamiales → Oleaceae → Oleeae → Olea → Olea europaea → Olea europaea subsp. europaea | 688 | Open in IMG/M |
3300025321|Ga0207656_10546313 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Lamiales → Oleaceae → Oleeae → Olea → Olea europaea → Olea europaea subsp. europaea | 590 | Open in IMG/M |
3300025905|Ga0207685_10019241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2247 | Open in IMG/M |
3300025912|Ga0207707_11416674 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Lamiales → Oleaceae → Oleeae → Olea → Olea europaea → Olea europaea subsp. europaea | 554 | Open in IMG/M |
3300025914|Ga0207671_10558770 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 912 | Open in IMG/M |
3300025915|Ga0207693_10678951 | Not Available | 799 | Open in IMG/M |
3300025921|Ga0207652_10416412 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1212 | Open in IMG/M |
3300025924|Ga0207694_10365501 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1196 | Open in IMG/M |
3300025924|Ga0207694_10876106 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Lamiales → Oleaceae → Oleeae → Olea → Olea europaea → Olea europaea subsp. europaea | 759 | Open in IMG/M |
3300025981|Ga0207640_10084421 | Not Available | 2181 | Open in IMG/M |
3300026067|Ga0207678_10748082 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 862 | Open in IMG/M |
3300026342|Ga0209057_1044191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2170 | Open in IMG/M |
3300026527|Ga0209059_1122862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 991 | Open in IMG/M |
3300026527|Ga0209059_1122992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 990 | Open in IMG/M |
3300026551|Ga0209648_10835911 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 504 | Open in IMG/M |
3300027591|Ga0209733_1047653 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1137 | Open in IMG/M |
3300027889|Ga0209380_10660729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 602 | Open in IMG/M |
3300028379|Ga0268266_10544558 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1111 | Open in IMG/M |
3300028381|Ga0268264_10355210 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1396 | Open in IMG/M |
3300028381|Ga0268264_11958373 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 595 | Open in IMG/M |
3300028801|Ga0302226_10153334 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1000 | Open in IMG/M |
3300030520|Ga0311372_11771122 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 739 | Open in IMG/M |
3300030524|Ga0311357_11451715 | Not Available | 582 | Open in IMG/M |
3300030906|Ga0302314_10675228 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1061 | Open in IMG/M |
3300030906|Ga0302314_11266740 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 685 | Open in IMG/M |
3300031231|Ga0170824_113466660 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1185 | Open in IMG/M |
3300031232|Ga0302323_100474353 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1337 | Open in IMG/M |
3300031234|Ga0302325_12156610 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 680 | Open in IMG/M |
3300031544|Ga0318534_10805905 | Not Available | 528 | Open in IMG/M |
3300031544|Ga0318534_10850739 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 511 | Open in IMG/M |
3300031549|Ga0318571_10383393 | Not Available | 545 | Open in IMG/M |
3300031561|Ga0318528_10066850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1845 | Open in IMG/M |
3300031708|Ga0310686_103411642 | Not Available | 618 | Open in IMG/M |
3300031708|Ga0310686_118041708 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 648 | Open in IMG/M |
3300031718|Ga0307474_10915741 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 694 | Open in IMG/M |
3300031720|Ga0307469_12455125 | Not Available | 509 | Open in IMG/M |
3300031744|Ga0306918_11132585 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 605 | Open in IMG/M |
3300031753|Ga0307477_10147525 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1641 | Open in IMG/M |
3300031768|Ga0318509_10261495 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 967 | Open in IMG/M |
3300031771|Ga0318546_10578796 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 789 | Open in IMG/M |
3300031792|Ga0318529_10265378 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 799 | Open in IMG/M |
3300031793|Ga0318548_10101723 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1376 | Open in IMG/M |
3300031796|Ga0318576_10301003 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 757 | Open in IMG/M |
3300031797|Ga0318550_10033397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2229 | Open in IMG/M |
3300031798|Ga0318523_10290993 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 815 | Open in IMG/M |
3300031820|Ga0307473_10022580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2596 | Open in IMG/M |
3300031831|Ga0318564_10092845 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1337 | Open in IMG/M |
3300031832|Ga0318499_10210931 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 756 | Open in IMG/M |
3300031845|Ga0318511_10267179 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 769 | Open in IMG/M |
3300031846|Ga0318512_10051383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1841 | Open in IMG/M |
3300031860|Ga0318495_10326767 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 681 | Open in IMG/M |
3300031890|Ga0306925_10524562 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1259 | Open in IMG/M |
3300031910|Ga0306923_10575232 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1267 | Open in IMG/M |
3300031912|Ga0306921_10447766 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1504 | Open in IMG/M |
3300031912|Ga0306921_11076744 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 902 | Open in IMG/M |
3300031942|Ga0310916_10124770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2099 | Open in IMG/M |
3300031954|Ga0306926_10151638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2870 | Open in IMG/M |
3300031954|Ga0306926_11673397 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 727 | Open in IMG/M |
3300031959|Ga0318530_10381154 | Not Available | 584 | Open in IMG/M |
3300031962|Ga0307479_10112668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2647 | Open in IMG/M |
3300031962|Ga0307479_10463845 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1251 | Open in IMG/M |
3300032041|Ga0318549_10230511 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 832 | Open in IMG/M |
3300032041|Ga0318549_10486591 | Not Available | 555 | Open in IMG/M |
3300032043|Ga0318556_10137239 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1257 | Open in IMG/M |
3300032054|Ga0318570_10097397 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1281 | Open in IMG/M |
3300032064|Ga0318510_10283681 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 687 | Open in IMG/M |
3300032065|Ga0318513_10008942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3822 | Open in IMG/M |
3300032180|Ga0307471_102615401 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 639 | Open in IMG/M |
3300032515|Ga0348332_14163182 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 893 | Open in IMG/M |
3300033290|Ga0318519_10609134 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 664 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.19% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.14% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.70% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.07% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.07% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.35% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.35% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.62% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.62% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.90% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.90% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.17% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.17% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.17% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.45% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.45% |
Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 1.45% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.45% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.45% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.72% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.72% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.72% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.72% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.72% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.72% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.72% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.72% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.72% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.72% |
Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.72% |
Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.72% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.72% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.72% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.72% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.72% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.72% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Host-Associated | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028801 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3 | Environmental | Open in IMG/M |
3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300030906 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3 | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0066395_109627302 | 3300004633 | Tropical Forest Soil | VQSKFTETSGYFRLTSFITIGSAEFNSYSLLYRDATGAVRPIQRSFTPD* |
Ga0066673_101317112 | 3300005175 | Soil | KIAQASSYFRLTSIITIGSTEFTLYSLLYQERGGDAKVRPILRSFTPD* |
Ga0070711_1010832632 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | FRLTSHVTIGTTEFNLYSLLYLESGTGTTRPILRSYSPD* |
Ga0070679_1003522941 | 3300005530 | Corn Rhizosphere | SSYFRLTSHITIGSTEFNLYSLLYQEGTGNVRPIQRSFAPD* |
Ga0066661_101640691 | 3300005554 | Soil | TSFITIGSAEFNLYSLLYQDQNSVRPILRSFTPD* |
Ga0066707_101376671 | 3300005556 | Soil | KVDAKIAQASSYFRLTSIITIGSTEFTLYSLLYQERGGDAKVRPILRSFTPD* |
Ga0068855_1000963181 | 3300005563 | Corn Rhizosphere | SYFRLTSHITIGSTEFNLYSLLYQDGTGNVRPIQRSFAPD* |
Ga0068856_1026629111 | 3300005614 | Corn Rhizosphere | LTSHITIGSTEFNLYSLLYQEGTGNVRPIQRSFAPD* |
Ga0070764_108647521 | 3300005712 | Soil | LTSVVSIGSTEINLYSLLFQDPQAQMVRPIQRSFTPD* |
Ga0068862_1015847212 | 3300005844 | Switchgrass Rhizosphere | YFRLSSLITIGSAEFNLYSLLYLDNQNFVHPIQRSFSPD* |
Ga0070766_105208181 | 3300005921 | Soil | LKIAQVSNYFRLTSFITIGSAEFNLYSLLFQDGSGKARPIQRSFTPD* |
Ga0075028_1007741941 | 3300006050 | Watersheds | VSQSFTETSSYFRLTSLVTIGSAEFNLYSLLYQDGSGAARPILRSFTPQ* |
Ga0070715_110321102 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | YFRLTSFITIGSAEFNLYSLLYQDGTGAARPIQRSFTPD* |
Ga0070716_1012351232 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | FNQFSTYFRLTSFITIGGAEFNLYSLLYRDATGAVRPIQRSFTPD* |
Ga0070712_1001956171 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | SKFAQVSSYFRLTSIVSIGSTEFNLYSLLYLDQQQQIRPVQRSFTPD* |
Ga0066665_107573091 | 3300006796 | Soil | FRLTSIITIGSTEFTLYSLLYQERGGDAQVRPILRSFTPD* |
Ga0066659_108363281 | 3300006797 | Soil | DPQLKTKVDAKIAQASSYFRLTSIITIGSTEFTLYSLLYQDRGGLGAKVRPILRTFTPD* |
Ga0073928_109556682 | 3300006893 | Iron-Sulfur Acid Spring | NSSYFRLTSFVTIGSTEFNLYRLLYQDATGSVRPLLRSYTPD* |
Ga0099793_101648391 | 3300007258 | Vadose Zone Soil | SFITIGSAEFNLYSLLYQDPNGGGTVRPIQRSFTPD* |
Ga0105248_131020222 | 3300009177 | Switchgrass Rhizosphere | YFKLTSYITINTTEFNLYSLLFQEGSGKVRPILRSYTPD* |
Ga0105238_112696911 | 3300009551 | Corn Rhizosphere | SLITIGTTEFNLYSLLYVDQQGHYAHPLQRSFSPD* |
Ga0123355_120442172 | 3300009826 | Termite Gut | SAGGSAAFAETTTYFRLTSFITIGSAQFNLYSLLYQDQTGALRPIQRSFTAD* |
Ga0126373_121196191 | 3300010048 | Tropical Forest Soil | NSVYFRLTSFITIGSAEFNLYSLLYRDQTGAVRPIQRSFAPD* |
Ga0126373_122845902 | 3300010048 | Tropical Forest Soil | QNSVYFRLSSFITVGSTQFSLYSLLFRDNTGAVRPIQRSFTPD* |
Ga0126373_130291161 | 3300010048 | Tropical Forest Soil | PKKWAAAQPKFGQNSTYFRLTSFITIGSTQFSLYSLLYRDATGAVRPIQRSFTPD* |
Ga0126376_129403222 | 3300010359 | Tropical Forest Soil | MTSHYFQLKSFITIGSTEFNLYSLLYQDGTQMVRPIQRSFTAD* |
Ga0134128_102348351 | 3300010373 | Terrestrial Soil | FGTTSQYFRLTSFITIGSAEFNLYSLLYQDGTGAVRPIQRSFTPD* |
Ga0134128_121251121 | 3300010373 | Terrestrial Soil | AVRSKFNQFSTYFRLTSFITIGGAEFNLYSLLYRDATGTVRPIQRSFTPD* |
Ga0137363_101508923 | 3300012202 | Vadose Zone Soil | YFRLTSFITIGSAEFNLYSLLYQDPNTGGAVRPILRGFTPD* |
Ga0137378_116515201 | 3300012210 | Vadose Zone Soil | QVSSYFRLTSFITIGSAEFNLYSLLYQDQYGGGAVRPILRSFTPD* |
Ga0137358_100855164 | 3300012582 | Vadose Zone Soil | FRLTSFITIGSAEFNLYSLLYQDPNGGGTVRPILRSFTPD* |
Ga0137398_102848972 | 3300012683 | Vadose Zone Soil | IITIGSTEFTLYSLLYQERGGDAKVRPILRSFTPD* |
Ga0137397_100215101 | 3300012685 | Vadose Zone Soil | PKLLLQVRPKIAQVSSYFRLTSFITIGSAEFNLYSLLYQDPQGAGTVRPILRSFTPD* |
Ga0137413_114595562 | 3300012924 | Vadose Zone Soil | SMNSGYFRLTSFVTIGSAEFNLYSLLYQDATGTVRTLLRSYTPD* |
Ga0137419_110987291 | 3300012925 | Vadose Zone Soil | KIAQVSSYFRLTSFITIGSAEFNLYSLLYQDPNGGGTVRPILRSFTPD* |
Ga0126375_117212112 | 3300012948 | Tropical Forest Soil | STYFRLTSFVTIGGAQFNLYSLMYRDATGAVRPIQRSFTPD* |
Ga0157373_115119492 | 3300013100 | Corn Rhizosphere | LTSHITIGSTEFNLYSLLYQDGTGNVRPIQRSFAPD* |
Ga0157374_119859961 | 3300013296 | Miscanthus Rhizosphere | FSETSMYFKLTSFITIGTTEFNLYSLLTQDQTGNVRPILRSYTPD* |
Ga0157374_125966312 | 3300013296 | Miscanthus Rhizosphere | RLSSLITIGSAEFNLYSLLYLDNQNFVHPIQRSFSPD* |
Ga0181516_106787631 | 3300014655 | Bog | PGLQSKFGQTSSYFRLTSVVSIGSTEINLYSLLYQDSQAQMVRPIQRSFTPD* |
Ga0137418_100075541 | 3300015241 | Vadose Zone Soil | VRPKIAQVSSYFRLTSFITIGSAEFNLYSLLYQDPNGGGTVRPILRSFTPD* |
Ga0137403_101928153 | 3300015264 | Vadose Zone Soil | RLTSFITIGSAEFNLYSLLYQDPQGAGTVRPILRSFTPD* |
Ga0132256_1002547571 | 3300015372 | Arabidopsis Rhizosphere | VQQKLGQTSAYFRLTSFVTIGGAEFNLYSLLYRDATGAVRPIQRSFTPD* |
Ga0182035_118697282 | 3300016341 | Soil | YFRLTSFITIGSAQFNLYSLLYQDATGAVRPIQRSFTAD |
Ga0182032_117153741 | 3300016357 | Soil | TVYFRLTSYIAIGSAQFNLYSLLYRDATGAVRPIQRSFTPD |
Ga0182032_119858842 | 3300016357 | Soil | LTSLITVGSAEFNLYSLLYRDATGAVRPIQRSFTSD |
Ga0182040_104669902 | 3300016387 | Soil | FRLTSFITIGSTEFNLYSLMYRDGTGVVRPIQRSFTPD |
Ga0182040_117731781 | 3300016387 | Soil | TSFITVGSAEFNLYSLLYRDATGAVRPIQRSFTPD |
Ga0182039_103743182 | 3300016422 | Soil | VQTLILVSFGSAAQKSFGQNSVYFRLTSFITIGSAEFNLYSLLFRDNTGAVRPIQRSFAP |
Ga0182039_104696292 | 3300016422 | Soil | TSFITIGSTQFSLYSLMYRDGTGAVRPIQRSFTPD |
Ga0187825_103033002 | 3300017930 | Freshwater Sediment | AYFRLTSFITIGSAEFNLYSLMFQDGTGMARPIQRSFTPD |
Ga0187779_110947512 | 3300017959 | Tropical Peatland | FSQTSNYFRLTSFITIGSTEFSLYSLMYQDATNAVRPIQRSFTPE |
Ga0187781_112327841 | 3300017972 | Tropical Peatland | MNSSYFRLKSYITIGSTEISLYSLLYQDGTGMTRPILRS |
Ga0187780_111680382 | 3300017973 | Tropical Peatland | QSLITIGSTEFNLYSLLLQDPTGQVRPILRSYTPD |
Ga0187782_101178861 | 3300017975 | Tropical Peatland | LANTFGQTSQYFRLTSFITIGSAEFNLYSLLYQDTNGTVRPIQRSFTPD |
Ga0187765_110127382 | 3300018060 | Tropical Peatland | MSNYFSQTSSYFRLTSFITIGSTEFSLYSLLYQDSTSAVRPIQRSFTPE |
Ga0066667_120597031 | 3300018433 | Grasslands Soil | IITIGSTEFTLYSLLYQERGGDAKVRPILRSFTPD |
Ga0179592_102599751 | 3300020199 | Vadose Zone Soil | FITIGSAEFNLYSLLYQDPQGAGTVRPILRSFTPD |
Ga0210399_105612812 | 3300020581 | Soil | WKNISGKLQMTSSYFRLTSLIAIGSSEFNLYSLLLQDPTGQVRPILRSYTPD |
Ga0210396_106185502 | 3300021180 | Soil | NSNYFRLTSFVTIGSTEFNVYSLLLMDANGTGSVRAILRTYTPD |
Ga0213882_100676392 | 3300021362 | Exposed Rock | LTSFITIGSTEFNLYSLLYQDGNTGFGVRPIQRSFTPD |
Ga0210385_113449251 | 3300021402 | Soil | NYFRLTSFITIGSAEFNLYSLLYQDTTGSVRPIQRSFTPD |
Ga0210384_105022212 | 3300021432 | Soil | SRQPGTQGAQSKFAQVSSYFRLTSIVSIGSTEFNLYSLLYQDATMQQVRPIQRSFTPD |
Ga0213878_102760912 | 3300021444 | Bulk Soil | KLQMTSSYFRLTSLITIGSTEFNLYSLLLQDPTGQVRPILRSYTPD |
Ga0213878_105625202 | 3300021444 | Bulk Soil | LTSLITIGSTEFNLYSLLLQDPTGQVRPILRSYTPD |
Ga0210410_112704611 | 3300021479 | Soil | GGANKKFGMTSNYFRLSSFITIGSAEFNLYSLLYQDNAGAGAVRPILRSYTPE |
Ga0210409_106794921 | 3300021559 | Soil | GAQGKFGQTSSYFRLTSIVSIGSTEFNLYSLLYQDATMQQVRPIQRSFTPD |
Ga0210409_112863881 | 3300021559 | Soil | FRLTSFITIGSAEFNLYSLLFQDGSGRVRPIQRSFTPD |
Ga0137417_12847662 | 3300024330 | Vadose Zone Soil | SKYFRLSSLVTIGTAEFNLYSLLLMDNNQGYFIHPIQRSFSPD |
Ga0207656_105463132 | 3300025321 | Corn Rhizosphere | SVVAESIQKKQTSPYFRLSSLITIGSAEFNLYSLLYLDNQNFVHPIQRSFSPD |
Ga0207685_100192411 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | TSQYFRLTSFVTIGGAEFNLYSLLYRDATGAVRPIQRSFTPD |
Ga0207707_114166741 | 3300025912 | Corn Rhizosphere | VTGSVGAQTSRLVQTSPYFRLSSLITIGSAEFNLYSLLYLDQQNFVHPIQRSFSPD |
Ga0207671_105587701 | 3300025914 | Corn Rhizosphere | TSNYFRLSSLVTIGSAEFNLYSLLYLDNNGYFVHPIQRSFSPD |
Ga0207693_106789511 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | QVSSYFRLTSIVSIGSTEFNLYSLLYLDQQQQIRPVQRSFTPD |
Ga0207652_104164121 | 3300025921 | Corn Rhizosphere | QVQGELKETSSYFRLTSHITIGSTEFNLYSLLYQEGTGNVRPIQRSFAPD |
Ga0207694_103655012 | 3300025924 | Corn Rhizosphere | RLTSHVTIGTTEFNLYSLLFLDQNGTSRPILRSYSPD |
Ga0207694_108761061 | 3300025924 | Corn Rhizosphere | SLITIGTTEFNLYSLLYVDQQGHYAHPLQRSFSPD |
Ga0207640_100844214 | 3300025981 | Corn Rhizosphere | VQTSSYFRLSSLITIGSAEFNLYSLLYLDQQNFVHPIQRSFSPD |
Ga0207678_107480822 | 3300026067 | Corn Rhizosphere | SYFRLSSLITIGSAEFNLYSLLYLDQQNFVHPIQRSFSPD |
Ga0209057_10441911 | 3300026342 | Soil | VDAKIAQASSYFRLTSIITIGSTEFTLYSLLYQERGGDAKVRPILRSFTPD |
Ga0209059_11228622 | 3300026527 | Soil | DAKIAQASSYFRLTSIITIGSTEFTLYSLLYQDRGSDAKVRPILRSFTPD |
Ga0209059_11229922 | 3300026527 | Soil | DAKIAQASSYFRLTSIITIGSTEFTLYSLLYQERGGDAKVRPILRSFTPD |
Ga0209648_108359112 | 3300026551 | Grasslands Soil | TSSYFRLTSFITIGSAEFNLYSLLYQDQNSVRPILRSFTPD |
Ga0209733_10476531 | 3300027591 | Forest Soil | MFAETSNYFRLTSFVTIGSAEFNLYSLLYQDNTGTVRTLLRSYTPD |
Ga0209380_106607292 | 3300027889 | Soil | FGTASSYFRLTSFVTIGATEFNLYSLLFQDAQGNVRPLLRSYTPD |
Ga0268266_105445582 | 3300028379 | Switchgrass Rhizosphere | FRLSSLVTIGTTEFNLYSLLFMNPQYVVFPIQRSFSPD |
Ga0268264_103552101 | 3300028381 | Switchgrass Rhizosphere | YFRLSSLVTIGTTEFNLYSLLFMNPQYVVFPIQRSFSPD |
Ga0268264_119583732 | 3300028381 | Switchgrass Rhizosphere | TSFITIGTTEFNLYSLLTQDQTGNVRPILRSYTPD |
Ga0302226_101533342 | 3300028801 | Palsa | GTPGLQSKFAQTSSYFRLTSVVSIGSTEINLYSLLYQDSQAQMVRPIQRSFTPD |
Ga0311372_117711221 | 3300030520 | Palsa | FGQASSYFRLTSFITIGSTEFNLYSLLYQDQTGAVRPIQRSFTPD |
Ga0311357_114517152 | 3300030524 | Palsa | QASSYFRLTSFITIGSTEFNLYSLLYQDQTGAVRPIQRSFTPD |
Ga0302314_106752282 | 3300030906 | Palsa | TSFVTIGATEFNLYSLLYQDQTGNVRPLLRTYTPD |
Ga0302314_112667402 | 3300030906 | Palsa | FATNSSYFRLTSFVTIGATEFNLYSLLYQDQTGAVRPIQRSFTPD |
Ga0170824_1134666602 | 3300031231 | Forest Soil | LTSIVSIGSTEFNLYSLLYLDQQQQIRPVQRSFTPD |
Ga0302323_1004743531 | 3300031232 | Fen | SSLVTIGSAEFNLYSLLLLDKQGYFVHAVQRSFSPD |
Ga0302325_121566102 | 3300031234 | Palsa | TNSPYFRLTSFVTIGSTEFNLYSLLYQDQTGNVRPLLRTYTPD |
Ga0318534_108059051 | 3300031544 | Soil | TSQAVNKFGQNSVYFRLTSFITIGSAQFSLYSLLYRDATGAVRPIQRSFAPD |
Ga0318534_108507391 | 3300031544 | Soil | PTVTRFAENSKYFRLTSLITIGGAEFSLYSLMYIDGTGVVRPIQRSFTPD |
Ga0318571_103833932 | 3300031549 | Soil | VYFRLTSYIAIGSAQFNLYSLLYRDATGAVRPIQRSFTPD |
Ga0318528_100668503 | 3300031561 | Soil | LGQNSAYFRLTSFVTIGGAQFNLYSLLFRDNTGAVRPIQRSFTPD |
Ga0310686_1034116421 | 3300031708 | Soil | KFGQNSSYFRLTSFITIGSTEFNLYSLLYQDVTGATRPILRSYTAD |
Ga0310686_1180417081 | 3300031708 | Soil | SYITIGSSEFNLYSLLYQDGQNGGAVRPVLRSYTAD |
Ga0307474_109157411 | 3300031718 | Hardwood Forest Soil | LSSLITIGSAEFNLYSLLYMDLNGPLIHPIQRTFAAD |
Ga0307469_124551251 | 3300031720 | Hardwood Forest Soil | RLTSFITIGGAEFNLYSLLYRDTTGTVRPIQRSFTPD |
Ga0306918_111325851 | 3300031744 | Soil | FVQNSPYFRLRSLITIGSTEFSLYSLLYRDNTGAVRPIQRSFTPD |
Ga0307477_101475251 | 3300031753 | Hardwood Forest Soil | QTSFITIGSAQFNLYSLLYQDATGAVRPIQRSFTAD |
Ga0318509_102614952 | 3300031768 | Soil | SQGASPFVQNSPYFRLRSLITIGSTEFSLYSLLYRDNTGAVRPIQRSFTPD |
Ga0318546_105787962 | 3300031771 | Soil | AWGQVQAKFGQNTVYFRLTSYIAIGSAQFNLYSLLYRDATGAVRPIQRSFTPD |
Ga0318529_102653782 | 3300031792 | Soil | QNSAYFRLTSFVTIGGAQFNLYSLLFRDNTGAVRPIQRSFTPD |
Ga0318548_101017231 | 3300031793 | Soil | GSPISKFGQSSQYFRLTSFITIGSAEFNLYSLLYRDTTGAVRPIQRSFTPD |
Ga0318576_103010032 | 3300031796 | Soil | LSSFITIGSAEFNLYSLLYRDTTGAVRPIQRSFTPD |
Ga0318550_100333974 | 3300031797 | Soil | SAYFRLTSFVTIGGAQFNLYSLLFRDNTGAVRPIQRSFTPD |
Ga0318523_102909932 | 3300031798 | Soil | FGQSSQYFRLTSFITIGSAEFNLYSLLYRDTTGAVRPIQRSFTPD |
Ga0307473_100225804 | 3300031820 | Hardwood Forest Soil | QGKLGQTSAYFRLTSFITIGGAEFNLYSLLYRDTTGTVRPIQRSFTPD |
Ga0318564_100928451 | 3300031831 | Soil | QTSTYFRLTSFVTIGGAQFNLYSLLFRDNTGAVRPIQRSFTPD |
Ga0318499_102109312 | 3300031832 | Soil | GQNSAYFRLTSFVTIGGAQFNLYSLLFRDNTGAVRPIQRSFTPD |
Ga0318511_102671791 | 3300031845 | Soil | TSTYFRLTSFVTIGGAQFNLYSLLFRDNTGAVRPIQRSFTPD |
Ga0318512_100513833 | 3300031846 | Soil | PSPLTKFKQTSAYFRLSSFITIGSAEFNLYSLLYRDTTGAVRPIQRSFTPD |
Ga0318495_103267672 | 3300031860 | Soil | SQYFRLTSFITIGSTEFNLYSLMYRDGTGVVRPIQRSFTPD |
Ga0306925_105245622 | 3300031890 | Soil | RETSKYFRLTSFITIGSAQFNLYSLLYQDATGAVRPIQRSFSAD |
Ga0306923_105752322 | 3300031910 | Soil | YFRLSSFITIGSAEFNLYSLLYRDTTGAVRPIQRSFTPD |
Ga0306921_104477662 | 3300031912 | Soil | QVQGKLGQNSAYFRLTSFVTIGGAQFNLYSLLFRDNTGAVRPIQRSFTPD |
Ga0306921_110767442 | 3300031912 | Soil | KFGQSSAYFRLSSFITIGSAEFNLYSLLYRDTTGAVRPIQRSFTPD |
Ga0310916_101247704 | 3300031942 | Soil | TYFRLTSFVTIGGAQFNLYSLLFRDNTGAVRPIQRSFTPD |
Ga0306926_101516385 | 3300031954 | Soil | FGQNSVYFRLTSFITIGSAEFNLYSLLFRDNTGAVRPIQRSFAPD |
Ga0306926_116733972 | 3300031954 | Soil | FRLTSFITVGSAEFNLYSLLYRDATGAVRPIQRSFTSD |
Ga0318530_103811541 | 3300031959 | Soil | GSTASPISNFGQNSVYFRLTSFITIGSAEFNLYSLLFRDNTGAVRPIQRSFAPD |
Ga0307479_101126684 | 3300031962 | Hardwood Forest Soil | FRLTSVITIGSTEFTLYSLLYQDRGSDAKVRPILRSFTPD |
Ga0307479_104638452 | 3300031962 | Hardwood Forest Soil | KVQMTSSYFRLTSLVTIGSTEFNLYSLLLQDPTGQVRPILRSYTPD |
Ga0318549_102305111 | 3300032041 | Soil | RLSSFITIGSAEFNLYSLLYRDTTGAVRPIQRSFTPD |
Ga0318549_104865911 | 3300032041 | Soil | FGQTSVYFRLTSFITVGSAEFNLYSLLYRDATGAVRPIQRSFAPD |
Ga0318556_101372392 | 3300032043 | Soil | STYFRLTSFVTIGGAQFNLYSLLFRDNTGAVRPIQRSFTPD |
Ga0318570_100973972 | 3300032054 | Soil | WAQTQGKFGQTSAYFRLTSFITVGSAEFNLYSLLYRDATGAVRPIQRSFTSD |
Ga0318510_102836812 | 3300032064 | Soil | TQNKFGQTSAYFRLTSFITVGSAEFNLYSLLYRDATGAVRPIQRSFTSD |
Ga0318513_100089421 | 3300032065 | Soil | STASPISNFGQNSVYFRLTSFITIGSAEFNLYSLLFRDNTGAVRPIQRSFAPD |
Ga0307471_1026154011 | 3300032180 | Hardwood Forest Soil | IADPKLLAQVRPKIAQVSSYFRLTSFITIGSAEFNLYSLLYQDPNGGGAVRPILRSFTPD |
Ga0348332_141631822 | 3300032515 | Plant Litter | SSYFRLTSFVTIGATEFNLYSLLYMDATGSVRPLLRSYTPD |
Ga0318519_106091342 | 3300033290 | Soil | FRLTSYIAIGSAQFNLYSLLYRDATGAVRPIQRSFTPD |
⦗Top⦘ |