Basic Information | |
---|---|
Family ID | F056029 |
Family Type | Metagenome |
Number of Sequences | 138 |
Average Sequence Length | 48 residues |
Representative Sequence | MSVMMSWARSTLANVEHALGRSDHWFDRMLVGVLVLLAFAVVFLFVAT |
Number of Associated Samples | 109 |
Number of Associated Scaffolds | 138 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 86.23 % |
% of genes near scaffold ends (potentially truncated) | 21.74 % |
% of genes from short scaffolds (< 2000 bps) | 93.48 % |
Associated GOLD sequencing projects | 100 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.44 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (53.623 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (12.319 % of family members) |
Environment Ontology (ENVO) | Unclassified (21.014 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.754 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.95% β-sheet: 0.00% Coil/Unstructured: 46.05% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 138 Family Scaffolds |
---|---|---|
PF05221 | AdoHcyase | 56.52 |
PF00670 | AdoHcyase_NAD | 14.49 |
PF02482 | Ribosomal_S30AE | 3.62 |
PF16321 | Ribosom_S30AE_C | 1.45 |
PF00156 | Pribosyltran | 1.45 |
PF02687 | FtsX | 0.72 |
PF09852 | DUF2079 | 0.72 |
PF03966 | Trm112p | 0.72 |
PF12833 | HTH_18 | 0.72 |
COG ID | Name | Functional Category | % Frequency in 138 Family Scaffolds |
---|---|---|---|
COG0499 | S-adenosylhomocysteine hydrolase | Coenzyme transport and metabolism [H] | 71.01 |
COG1544 | Ribosome-associated translation inhibitor RaiA | Translation, ribosomal structure and biogenesis [J] | 3.62 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 56.52 % |
Unclassified | root | N/A | 43.48 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000956|JGI10216J12902_114014443 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300002568|C688J35102_118474561 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300002568|C688J35102_119026744 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
3300002568|C688J35102_120906645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2196 | Open in IMG/M |
3300003988|Ga0055475_10121277 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
3300003989|Ga0055473_10092841 | Not Available | 925 | Open in IMG/M |
3300003993|Ga0055468_10253757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 554 | Open in IMG/M |
3300004021|Ga0055449_10197528 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
3300004081|Ga0063454_100030778 | All Organisms → cellular organisms → Bacteria | 1878 | Open in IMG/M |
3300004114|Ga0062593_101961699 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
3300005179|Ga0066684_10986192 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300005183|Ga0068993_10293984 | Not Available | 585 | Open in IMG/M |
3300005329|Ga0070683_101466833 | Not Available | 656 | Open in IMG/M |
3300005332|Ga0066388_100558583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1773 | Open in IMG/M |
3300005332|Ga0066388_100639054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1681 | Open in IMG/M |
3300005332|Ga0066388_101774466 | Not Available | 1096 | Open in IMG/M |
3300005332|Ga0066388_102897945 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
3300005332|Ga0066388_103564272 | Not Available | 795 | Open in IMG/M |
3300005332|Ga0066388_107511135 | Not Available | 547 | Open in IMG/M |
3300005334|Ga0068869_100924979 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
3300005364|Ga0070673_101680243 | Not Available | 601 | Open in IMG/M |
3300005365|Ga0070688_101379302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 571 | Open in IMG/M |
3300005434|Ga0070709_11075175 | Not Available | 642 | Open in IMG/M |
3300005458|Ga0070681_11925904 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 519 | Open in IMG/M |
3300005459|Ga0068867_101775267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Pimelobacter → Pimelobacter simplex | 580 | Open in IMG/M |
3300005764|Ga0066903_100381078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2305 | Open in IMG/M |
3300005764|Ga0066903_105291959 | Not Available | 682 | Open in IMG/M |
3300005764|Ga0066903_107642797 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
3300005841|Ga0068863_101171894 | Not Available | 774 | Open in IMG/M |
3300005844|Ga0068862_102584328 | Not Available | 519 | Open in IMG/M |
3300005993|Ga0080027_10279377 | Not Available | 662 | Open in IMG/M |
3300006046|Ga0066652_100552236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1079 | Open in IMG/M |
3300006047|Ga0075024_100094351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1305 | Open in IMG/M |
3300006057|Ga0075026_100395633 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
3300006059|Ga0075017_100110557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1923 | Open in IMG/M |
3300006059|Ga0075017_100636428 | Not Available | 817 | Open in IMG/M |
3300006172|Ga0075018_10195974 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
3300006354|Ga0075021_10090720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1807 | Open in IMG/M |
3300006354|Ga0075021_10392759 | Not Available | 869 | Open in IMG/M |
3300006846|Ga0075430_100116919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2222 | Open in IMG/M |
3300006846|Ga0075430_100589076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 917 | Open in IMG/M |
3300006846|Ga0075430_101075590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 662 | Open in IMG/M |
3300006852|Ga0075433_10990975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 732 | Open in IMG/M |
3300006853|Ga0075420_100282345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1441 | Open in IMG/M |
3300006853|Ga0075420_100561504 | Not Available | 985 | Open in IMG/M |
3300006904|Ga0075424_101573024 | Not Available | 697 | Open in IMG/M |
3300007769|Ga0102952_1217784 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
3300009012|Ga0066710_101866475 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
3300009038|Ga0099829_10580586 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Chlorellales → Chlorellaceae → Auxenochlorella → Auxenochlorella protothecoides | 932 | Open in IMG/M |
3300009098|Ga0105245_12649489 | Not Available | 554 | Open in IMG/M |
3300009137|Ga0066709_100564561 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 1615 | Open in IMG/M |
3300009137|Ga0066709_103918301 | Not Available | 541 | Open in IMG/M |
3300009176|Ga0105242_10899352 | Not Available | 885 | Open in IMG/M |
3300009789|Ga0126307_10083993 | All Organisms → cellular organisms → Bacteria | 2514 | Open in IMG/M |
3300009789|Ga0126307_10299521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Pimelobacter → Pimelobacter simplex | 1293 | Open in IMG/M |
3300009840|Ga0126313_10280545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1299 | Open in IMG/M |
3300009840|Ga0126313_11467305 | Not Available | 566 | Open in IMG/M |
3300010041|Ga0126312_10433155 | Not Available | 937 | Open in IMG/M |
3300010042|Ga0126314_10408311 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
3300010045|Ga0126311_10237796 | Not Available | 1346 | Open in IMG/M |
3300010047|Ga0126382_10189714 | All Organisms → cellular organisms → Bacteria | 1451 | Open in IMG/M |
3300010047|Ga0126382_12032818 | Not Available | 548 | Open in IMG/M |
3300010166|Ga0126306_10045393 | All Organisms → cellular organisms → Bacteria | 3025 | Open in IMG/M |
3300010166|Ga0126306_11336162 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
3300010359|Ga0126376_12196010 | Not Available | 597 | Open in IMG/M |
3300010360|Ga0126372_13056439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 519 | Open in IMG/M |
3300010362|Ga0126377_11148141 | Not Available | 846 | Open in IMG/M |
3300010376|Ga0126381_100007424 | All Organisms → cellular organisms → Bacteria | 12207 | Open in IMG/M |
3300010396|Ga0134126_10377888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium | 1649 | Open in IMG/M |
3300010398|Ga0126383_10656693 | Not Available | 1124 | Open in IMG/M |
3300010401|Ga0134121_11872545 | Not Available | 628 | Open in IMG/M |
3300011119|Ga0105246_11816485 | Not Available | 583 | Open in IMG/M |
3300012212|Ga0150985_105965729 | Not Available | 885 | Open in IMG/M |
3300012353|Ga0137367_10761175 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
3300012469|Ga0150984_105043395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1747 | Open in IMG/M |
3300012943|Ga0164241_11333804 | Not Available | 529 | Open in IMG/M |
3300012948|Ga0126375_11707689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis | 546 | Open in IMG/M |
3300012951|Ga0164300_11116347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 516 | Open in IMG/M |
3300012957|Ga0164303_10536823 | Not Available | 756 | Open in IMG/M |
3300012958|Ga0164299_10815506 | Not Available | 667 | Open in IMG/M |
3300012960|Ga0164301_11050829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 644 | Open in IMG/M |
3300012961|Ga0164302_11205719 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
3300012985|Ga0164308_10700752 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
3300012985|Ga0164308_12004351 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300012986|Ga0164304_11626284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 539 | Open in IMG/M |
3300013308|Ga0157375_11847620 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Chlorellales → Chlorellaceae → Auxenochlorella → Auxenochlorella protothecoides | 717 | Open in IMG/M |
3300013308|Ga0157375_12055892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 679 | Open in IMG/M |
3300014304|Ga0075340_1101297 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300014325|Ga0163163_13242243 | Not Available | 507 | Open in IMG/M |
3300014498|Ga0182019_10351878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Pimelobacter → Pimelobacter simplex | 994 | Open in IMG/M |
3300014968|Ga0157379_11745774 | Not Available | 610 | Open in IMG/M |
3300014969|Ga0157376_11679768 | Not Available | 670 | Open in IMG/M |
3300015373|Ga0132257_103882584 | Not Available | 544 | Open in IMG/M |
3300016371|Ga0182034_10965910 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
3300016404|Ga0182037_11520668 | Not Available | 594 | Open in IMG/M |
3300017930|Ga0187825_10202602 | All Organisms → cellular organisms → Eukaryota → Viridiplantae | 715 | Open in IMG/M |
3300017965|Ga0190266_10182673 | Not Available | 982 | Open in IMG/M |
3300017965|Ga0190266_10870599 | Not Available | 587 | Open in IMG/M |
3300017974|Ga0187777_10000681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26256 | 22402 | Open in IMG/M |
3300018422|Ga0190265_11780034 | Not Available | 725 | Open in IMG/M |
3300018469|Ga0190270_10782133 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
3300018469|Ga0190270_12387182 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300018476|Ga0190274_11783647 | Not Available | 710 | Open in IMG/M |
3300018476|Ga0190274_12906084 | Not Available | 575 | Open in IMG/M |
3300018481|Ga0190271_10835007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1046 | Open in IMG/M |
3300018482|Ga0066669_10790248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 840 | Open in IMG/M |
3300021560|Ga0126371_10613618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1236 | Open in IMG/M |
3300025817|Ga0210144_1032568 | Not Available | 1634 | Open in IMG/M |
3300025901|Ga0207688_10440175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 812 | Open in IMG/M |
3300025927|Ga0207687_10663597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 883 | Open in IMG/M |
3300025934|Ga0207686_11405955 | Not Available | 574 | Open in IMG/M |
3300025941|Ga0207711_10468563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1173 | Open in IMG/M |
3300025944|Ga0207661_10744937 | Not Available | 902 | Open in IMG/M |
3300025960|Ga0207651_10437440 | Not Available | 1120 | Open in IMG/M |
3300025961|Ga0207712_11807394 | Not Available | 548 | Open in IMG/M |
3300026196|Ga0209919_1104725 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
3300027846|Ga0209180_10462858 | Not Available | 713 | Open in IMG/M |
3300027894|Ga0209068_10146543 | Not Available | 1275 | Open in IMG/M |
3300027894|Ga0209068_10184598 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
3300027894|Ga0209068_10380361 | Not Available | 803 | Open in IMG/M |
3300027915|Ga0209069_10006983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26256 | 5613 | Open in IMG/M |
3300028379|Ga0268266_10937262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Pimelobacter → Pimelobacter simplex | 838 | Open in IMG/M |
3300028380|Ga0268265_11536567 | Not Available | 670 | Open in IMG/M |
3300028380|Ga0268265_12511015 | Not Available | 521 | Open in IMG/M |
3300028558|Ga0265326_10223445 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300031228|Ga0299914_10428858 | All Organisms → cellular organisms → Bacteria | 1150 | Open in IMG/M |
3300031232|Ga0302323_100313478 | Not Available | 1631 | Open in IMG/M |
3300031251|Ga0265327_10007775 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8181 | Open in IMG/M |
3300031251|Ga0265327_10347048 | Not Available | 649 | Open in IMG/M |
3300031251|Ga0265327_10374418 | Not Available | 620 | Open in IMG/M |
3300031781|Ga0318547_10795446 | Not Available | 589 | Open in IMG/M |
3300031792|Ga0318529_10463169 | Not Available | 590 | Open in IMG/M |
3300031846|Ga0318512_10729341 | Not Available | 509 | Open in IMG/M |
3300031893|Ga0318536_10371016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 724 | Open in IMG/M |
3300032018|Ga0315272_10496975 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
3300032261|Ga0306920_101156268 | Not Available | 1120 | Open in IMG/M |
3300032516|Ga0315273_10360311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1966 | Open in IMG/M |
3300032828|Ga0335080_10803749 | Not Available | 972 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.32% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 7.97% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.52% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 6.52% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.52% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.07% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 4.35% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.62% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.90% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.90% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.90% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.90% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 2.90% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.17% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.17% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.17% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.17% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.17% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.17% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.45% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.45% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.45% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.45% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.45% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.72% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.72% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.72% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.72% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.72% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.72% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.72% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.72% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.72% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.72% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.72% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.72% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.72% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.72% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.72% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.72% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.72% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300003988 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordB_D2 | Environmental | Open in IMG/M |
3300003989 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordA_D2 | Environmental | Open in IMG/M |
3300003993 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 | Environmental | Open in IMG/M |
3300004021 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWB_D1 | Environmental | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005183 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 | Environmental | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300007769 | Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_D1_MG | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012943 | Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014304 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D1 | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025817 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026196 | Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_D2_MG (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Host-Associated | Open in IMG/M |
3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Host-Associated | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
3300032018 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_middle | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI10216J12902_1140144431 | 3300000956 | Soil | MSVMMSWARSTLASVEHSLARSDRNFDRLLVGVLALLAVAIVLLFVAA* |
C688J35102_1184745611 | 3300002568 | Soil | MSVLMSWARSTLANVEHSLGRSDHLFDRMLIGVLVLLALAIVVLFAAS* |
C688J35102_1190267442 | 3300002568 | Soil | MSVMMSWARSTLANVEHALGRSDHWFDRLLVGVLLLLAFAVVFLFVAS* |
C688J35102_1209066451 | 3300002568 | Soil | MSVFFSWARSTVAGLDRALGHTDEWFDRILVGVLVLLVVAVA |
Ga0055475_101212772 | 3300003988 | Natural And Restored Wetlands | MDLFMSWARSTVANAERALGRSDEWFDRILVGILVLLAVAVVFLFAQ* |
Ga0055473_100928412 | 3300003989 | Natural And Restored Wetlands | MSVLMSWARSTLANVEQSLGRSDRWFDRMLAGVLVLLAFAVAFLFFAT* |
Ga0055468_102537572 | 3300003993 | Natural And Restored Wetlands | MDTFLSWARSTVANVDRSLSRGDRYFDRILVGVLIALAIAIALLFTQAG* |
Ga0055449_101975281 | 3300004021 | Natural And Restored Wetlands | KRTAPMDLFMSWARSTVANAERALGRSDEWFDRILVGILVLLAVAVVFLFAQ* |
Ga0063454_1000307783 | 3300004081 | Soil | MSVFFSWARSTVAGLDRALGHTDEWFDRILVGVLVLLVVAVAFLFTQ* |
Ga0062593_1019616992 | 3300004114 | Soil | MSVMMSWARSTLANVEHALGRSDHWFDRMLVGVLVLLAFAVVFLFVAT* |
Ga0066684_109861921 | 3300005179 | Soil | MSVFMSWARSTIANVERALGRSDNWFDRILIGVLALLAVAVVFLFTQ* |
Ga0068993_102939842 | 3300005183 | Natural And Restored Wetlands | SHMHVFMSWARSTAAQVERSLDRSDNYFDRILIGVVALLAVAVVFLFTAS* |
Ga0070683_1014668331 | 3300005329 | Corn Rhizosphere | MSVLMSWARSTLATVEHSLGRSDHWFDRMLVGVLVLLAFAIVFLFVAS* |
Ga0066388_1005585833 | 3300005332 | Tropical Forest Soil | MDVMLSWARSTVASFEHKLGRSERYFDRILVGVMVALALAIAILFTQAG* |
Ga0066388_1006390543 | 3300005332 | Tropical Forest Soil | MSVFLSWARSTVANLDRALGRSDQWFDRILVGVLILLVIAVAFLFSQ* |
Ga0066388_1017744662 | 3300005332 | Tropical Forest Soil | MHVFMSWARSTATNIERLLGRSDDYFDRILIGVVGLLALAVLFLFATN* |
Ga0066388_1028979452 | 3300005332 | Tropical Forest Soil | MDVLMSWARSTVANVESRLGRSDRYFDRILVGVMVALALAIVILFTQAG* |
Ga0066388_1035642722 | 3300005332 | Tropical Forest Soil | VDIDEEKDAPMDVMMSWARSTVANIEHRLGRSEDHFDKILVGVLALLALAIVLLFTQ* |
Ga0066388_1075111352 | 3300005332 | Tropical Forest Soil | MHVFMSWARSTVSNVERTLGRSENYFDRILIGVLVLLAIAICFLFSAA* |
Ga0068869_1009249792 | 3300005334 | Miscanthus Rhizosphere | MSVMMSWARSTLANVEHSLGRSDRTFDRLLVGVLVLLAFAIAFLFFVAM* |
Ga0070673_1016802431 | 3300005364 | Switchgrass Rhizosphere | MSVLMSWARSTLANVEHSLGGSDRVFDRMLAGVVLLLAFAIVLLFVAT* |
Ga0070688_1013793021 | 3300005365 | Switchgrass Rhizosphere | MSVMMSWARSTLANVEHALGRSDRMFDRMLVGVLVLLAFAVVFLFVAT* |
Ga0070709_110751752 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MSVFLSWARSTVANLDRALGRSDEWFDRILVGVLVLLVIAVAFLFSQ* |
Ga0070681_119259042 | 3300005458 | Corn Rhizosphere | MSVMMSWARSTLANVEHSLSPSGRNLDRVLVGVLLLLAFAIAFLF |
Ga0068867_1017752672 | 3300005459 | Miscanthus Rhizosphere | STLANVEHKLGHTDAAFDRILVVAIGLLAVAVVFLFVAAAQ* |
Ga0066903_1003810782 | 3300005764 | Tropical Forest Soil | MHVFMSWARSTATNIERLLGRSEDYFDRILIGVLGLLALAVLFLFATS* |
Ga0066903_1052919591 | 3300005764 | Tropical Forest Soil | MSVLMSWARSTLASVEHKLGHTDAWFDRILVVVMGLLAVAIIFLFFAAAQ* |
Ga0066903_1076427972 | 3300005764 | Tropical Forest Soil | MDVMLSWARSTVANFEHKLGRSDRYFDRLLVGVMVALALAIAILFTQAG* |
Ga0068863_1011718941 | 3300005841 | Switchgrass Rhizosphere | MSVLMSWARSTLASVDHRLGRSDQWYDRILVGVMILLAVAIVFLFTAAG* |
Ga0068862_1025843282 | 3300005844 | Switchgrass Rhizosphere | MSVLMSWARSTLANVEHNLGKSNRWFDRMLVGVLVLLVIGVVFIFTSAT* |
Ga0080027_102793772 | 3300005993 | Prmafrost Soil | MSLFMSWARSTFANVEHALGRSEDWFDRILVGVLLLLGVAVVFLFTQ* |
Ga0066652_1005522362 | 3300006046 | Soil | MHVFMSWARSTVTQVERSLGRSEEYFDRILIGVVALLALAIVFLFATG* |
Ga0075024_1000943512 | 3300006047 | Watersheds | MSVLMSWARSTVANLEHTLGRTDAWYDGILVGVLALLAVAVVFLFVQ* |
Ga0075026_1003956331 | 3300006057 | Watersheds | MSVLMSWARSTVASLEHTLGRTDAWYDRILVGVLVLLAVAVTFLFIQ* |
Ga0075017_1001105572 | 3300006059 | Watersheds | MSVLMSWARSTVAGLEHALGRTERWFDRILIVVLLLLAVAVAFLFTQ* |
Ga0075017_1006364282 | 3300006059 | Watersheds | MSVLMSWARSTIAGLEHALGRTERWFDRILIVVLLLLAIAVAFLFTQ* |
Ga0075018_101959742 | 3300006172 | Watersheds | MSVMMSWARSTLANVEHSLGRSDRWYDRMLVGVLVLLAFAIVFIFVAT* |
Ga0075021_100907202 | 3300006354 | Watersheds | MDVLMSWARSTLANFERALSRSDQYFERILVGVLIALAIAIAVLFTQAA* |
Ga0075021_103927592 | 3300006354 | Watersheds | MDVLMSWARSTVANFEHSLGRSERYFDRILIGVLIALAVAITVLFTQAA* |
Ga0075430_1001169194 | 3300006846 | Populus Rhizosphere | MDVFMSWARSTLANIERALDRSEHHFEHILIGVLVVLALAIVLLFTQGG* |
Ga0075430_1005890762 | 3300006846 | Populus Rhizosphere | MDVFMSWARSTVANIERALDRSEHHFEHILVGVLVVLALAIALLFTQGT* |
Ga0075430_1010755902 | 3300006846 | Populus Rhizosphere | MDVFMSWARSTLANIERALDRSEHHFEHILIGVLVILALAIALLFTQGG* |
Ga0075433_109909751 | 3300006852 | Populus Rhizosphere | MSVFVSWARSTVASVDQALRRTDQWFDRILVGVLILLVVAVAFLFSQ* |
Ga0075420_1002823452 | 3300006853 | Populus Rhizosphere | MDVFMSWARSTLANIERALDRSEHHFEHILLGVLVVLALAIVLLFTQGG* |
Ga0075420_1005615041 | 3300006853 | Populus Rhizosphere | MDVFMSWARSTLANIERALDRSEHHFEHILIGVLVILALAI |
Ga0075424_1015730241 | 3300006904 | Populus Rhizosphere | MSVFLSWARSTVASVDQALRRTDQWFDRILVGVLILLVVAVAFLFSQ* |
Ga0102952_12177842 | 3300007769 | Soil | MSVLMSWARSTLANVENAFDRSDRWFDRMLVGTLVLLAVAIVLLFVAT* |
Ga0066710_1018664752 | 3300009012 | Grasslands Soil | MHVFMSWARSTATNIERVLGRSEDYFDRILIGVMALLAIAVMYLFTTS |
Ga0099829_105805861 | 3300009038 | Vadose Zone Soil | MMSWARSTVANIEHKLGRGEDYFDRILVGVLLLLALAIAVLFTR* |
Ga0105245_126494892 | 3300009098 | Miscanthus Rhizosphere | MSVMMSWARSTLANVEHSLGRSDRNFDRLLVGVVVLLAVAIALLFFAA* |
Ga0066709_1005645612 | 3300009137 | Grasslands Soil | MSVFMSWARSTVANVEHALGRSDSWFDRILIGVLVLLAVAVVILFAQ* |
Ga0066709_1039183012 | 3300009137 | Grasslands Soil | MHVFMSWARSTATNIERVLGRSEDYFDRILIGVMALLA |
Ga0105242_108993522 | 3300009176 | Miscanthus Rhizosphere | MSVFMSWARSTVANVEHALGRTDNWFDRILIGVLVLLALAVVFLFAQ* |
Ga0126307_100839934 | 3300009789 | Serpentine Soil | VTIEEGKPLMSVLMSWARATLANVEHSLGGTDRVFDRMLAGVVLLLAFAIVLLFVAT* |
Ga0126307_102995212 | 3300009789 | Serpentine Soil | WARSTLATVEYFLGRSDHWFDRMLVGVLVLLAFAVVFLFVVT* |
Ga0126313_102805451 | 3300009840 | Serpentine Soil | MSVLMSWARSTLATVEYFLGRSDHWFDRMLVGVLVLLA |
Ga0126313_114673051 | 3300009840 | Serpentine Soil | MSVLMSWARSTLANVEHSLGGTDRVFDRMLAGVLVLLAFAIVLLFVAT* |
Ga0126312_104331552 | 3300010041 | Serpentine Soil | MSVLMSWARATLANVEHSLGGTDRVFDRMLAGVVLLLAFAIVLLFVAT* |
Ga0126314_104083112 | 3300010042 | Serpentine Soil | MSVLMSWARSTLATVEYFLGRSDHWFDRMLVGVLVLLAFAVVFLFVVT* |
Ga0126311_102377962 | 3300010045 | Serpentine Soil | VTIEEGKPLMSVLMSSARSTLANVEHSLGGTDRVFDRMLAGVVLLLAFAIVLLFVAT* |
Ga0126382_101897142 | 3300010047 | Tropical Forest Soil | MNVLMSWARSTVANVESRLGRSDRYFDRILVGVMVALALAIVILFTQAG* |
Ga0126382_120328182 | 3300010047 | Tropical Forest Soil | DVLMSWARSTVANVEHRLGRSERYFDRILVGVMVALALAIAILFTQAG* |
Ga0126306_100453934 | 3300010166 | Serpentine Soil | MSVMMSWARSTLANVEHCLGRSDRTFDRLLVGVVVLLAFAIVFLFFVAM* |
Ga0126306_113361622 | 3300010166 | Serpentine Soil | MSMMMSWARSTMASVEHSLSRSDRNFDRLLVGVLVLLALAILFLFFVAM* |
Ga0126376_121960102 | 3300010359 | Tropical Forest Soil | MDVLMSWARSTVANVEHKLGRSERYFDRALVGVMIALALAIAILFTQAG* |
Ga0126372_130564392 | 3300010360 | Tropical Forest Soil | MTPMSVFLSWARSTVANLDRALGRSDQWFDRILVGVLILLVIAVAFLFSQ* |
Ga0126377_111481412 | 3300010362 | Tropical Forest Soil | MDVLMSWARTTVANVEHKLGRSERYFDRLLVGVMVALALAIAILFTQAG* |
Ga0126381_1000074244 | 3300010376 | Tropical Forest Soil | MDEEKDAPMDVMMSWARSTVANLEHRLGRSEDHFDKILVGVLALLAVAIVLLFTQ* |
Ga0134126_103778881 | 3300010396 | Terrestrial Soil | MSVFLSWARSTVANLDRALGRSDEWFDRILVGVLVLL |
Ga0126383_106566931 | 3300010398 | Tropical Forest Soil | MHVFMSWARSTATNIERLLGRSEDYFDRILIGVLGLLALAVLFIFTTS* |
Ga0134121_118725451 | 3300010401 | Terrestrial Soil | MSVLMSWARSTLANLEHKLGHTDAVFDRILVVAMGLLAVAIVFLFVAAAQ* |
Ga0105246_118164852 | 3300011119 | Miscanthus Rhizosphere | TLANVEHSLGGSDRVFDRMLAGVVLLLAFAIVLLFVAT* |
Ga0150985_1059657292 | 3300012212 | Avena Fatua Rhizosphere | MSVMMSWARSTLANVEHSLGRSDRTFDRLLAGVLVLLAFAIAFLFFVAM* |
Ga0137367_107611752 | 3300012353 | Vadose Zone Soil | MSVFMSWARSTVANLEQALGHTEDWFDRILIGVLVLLAVAVVILFTQ* |
Ga0150984_1050433951 | 3300012469 | Avena Fatua Rhizosphere | IFNFLFSSTVAGLDRALGHTDEWFDRILVGVLVLLVVAVAFLFTQ* |
Ga0164241_113338042 | 3300012943 | Soil | MDLFLSWARSTVANVEHSLGRSERYFDRILVGVLVALAVAIAFLFTQAA* |
Ga0126375_117076892 | 3300012948 | Tropical Forest Soil | MDVLMSWARSTVANLEQRLGRSDRYFDRILVGVMVALALAIVILFTQAG* |
Ga0164300_111163472 | 3300012951 | Soil | MSVMMSWARSTLANVEHALGRSDHWFDRMLVGVLVLLAFAVVLLFVAT* |
Ga0164303_105368231 | 3300012957 | Soil | MSVFLSWARSTVANLERALGRSDEWFDRILVGVLVLLVIAVAFLFAQ* |
Ga0164299_108155062 | 3300012958 | Soil | MHVFMSWARSTVTHIERSLGRSENYFDRILIGVLALLVIAVLFLFTAS* |
Ga0164301_110508291 | 3300012960 | Soil | MSVLMSWARSTLANVEHSLGRSDHLFDRVLVGVLVLLAFAVVFLFVAAT* |
Ga0164302_112057191 | 3300012961 | Soil | MSMMMSWARSTLANVEHALGRSDHWFDRMLVGVLVLLAFAVVFLFVAT* |
Ga0164308_107007522 | 3300012985 | Soil | MSVMMSWARSTLANVEHALGRSDHWFDRLLVGVLVLLAFAIAFLFFVAM* |
Ga0164308_120043512 | 3300012985 | Soil | MSVLMSWDRSTLANVEHSLGRSDHLFDRMLVGVLVLLAFAVVFLFVAT* |
Ga0164304_116262842 | 3300012986 | Soil | MSVMMSWARSTLASVEHSLGRSDRTFDRLLVGVLVLLAFA |
Ga0157375_118476202 | 3300013308 | Miscanthus Rhizosphere | WARSTLANVEHALGRSDHWFDRLLVGVLVLLAFAVIFLFVAT* |
Ga0157375_120558922 | 3300013308 | Miscanthus Rhizosphere | MSVLMSWARSTLANVEHKLGHTDAWFDRILVVALALLAVAVVFLFVAAGT* |
Ga0075340_11012971 | 3300014304 | Natural And Restored Wetlands | MDVFMSWARSTVANVEHTLGRTERHFDRILVGVLVALAIAIAFLFTQAG* |
Ga0163163_132422432 | 3300014325 | Switchgrass Rhizosphere | RNRTIEEGSPLMSVLMSWARSTLANVEHSLGRSDHLFDRMLVGVLVLLAFAVVFLFVAAT |
Ga0182019_103518781 | 3300014498 | Fen | MSVLMSWARSTMAGVEHALGRTERWFDRILIVVLLLLAVAVAFLFTQ* |
Ga0157379_117457741 | 3300014968 | Switchgrass Rhizosphere | LMSVMMSWARSTLANVEHALGRSDHWFDRLLVGVLVLLAFAVIFLFVAT* |
Ga0157376_116797682 | 3300014969 | Miscanthus Rhizosphere | VFLSWARSTVANLDRALGRSDEWFDRILVGVLVLLVIAVAFLFSQ* |
Ga0132257_1038825841 | 3300015373 | Arabidopsis Rhizosphere | MHVFMSWARSTATNIERLLGRSEDYFDRILIGVLGLLAV |
Ga0182034_109659102 | 3300016371 | Soil | MHVFMSWARSTATNIERLLGRSEDYFDRILIGVLGLLALAVLFLFATS |
Ga0182037_115206682 | 3300016404 | Soil | PTMHVFMSWARSTATNIERLLGRSEDYFDRILIGVLGLLALAVLFLFATS |
Ga0187825_102026021 | 3300017930 | Freshwater Sediment | VHVMMSWARSTVARVEHTLGRNQNTFDRILIGVLALLAIAVAVLFTQ |
Ga0190266_101826732 | 3300017965 | Soil | VANVEHSLGRSEQYFDRILVGVLVALAVAIAFLFTQAA |
Ga0190266_108705992 | 3300017965 | Soil | MDVFMSWARSTVANVEHSLGRSERYFDRILVGVLVALAVAIAFLFTQAA |
Ga0187777_1000068110 | 3300017974 | Tropical Peatland | MHVFMSWARSTVTNIERTLGRSEDYFDRILVGVLILLAVAVAYLFLAS |
Ga0190265_117800341 | 3300018422 | Soil | MDTFLSWARSTVANVEHTLGRSDRYFDRILVGVLVGLVVAIAFLFLQGL |
Ga0190270_107821332 | 3300018469 | Soil | MSVFMSWARSTLANVERALGHTDGWFDRILIGVLVLLAVAVVFLFTQ |
Ga0190270_123871822 | 3300018469 | Soil | MSVLMSWARSTLANVEHSLGRSERWFDRMLIGVLVLLAVAIVLLFVQ |
Ga0190274_117836471 | 3300018476 | Soil | MDVFMSWARSTVANVEHSLGRSEQYFDRILVGVLVALAVAIAFLFTQAA |
Ga0190274_129060841 | 3300018476 | Soil | MDVFMSWARSTAANVEHSLGRSERYFDRILVGVLVGLAIAIAFLFTQAA |
Ga0190271_108350072 | 3300018481 | Soil | MDTFMSWARSTVANVEHSLGRSDRYFDRILVGVLVALAVAVAFLFLQGL |
Ga0066669_107902482 | 3300018482 | Grasslands Soil | MHVFMSWARSTVTQVERSLGRSEEYFDRMLIGVVALLALAIVFLFATG |
Ga0126371_106136182 | 3300021560 | Tropical Forest Soil | MDEEKDAPMDVMMSWARSTVANLEHRLGRSEDHFDKILVGVLALLAVAIVLLFTQ |
Ga0210144_10325682 | 3300025817 | Natural And Restored Wetlands | MDLFMSWARSTVANAERALGRSDEWFDRILVGILVLLAVAVVFLFAQ |
Ga0207688_104401752 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MSVMMSWARSTLANVEHSLARSDRNFDRLLVGVVVLLVVAIALLFLAA |
Ga0207687_106635972 | 3300025927 | Miscanthus Rhizosphere | MSVMMSWARSTLANVEHSLGRSDRTFDRLLVGVLVLLAFAIAFLFFVAM |
Ga0207686_114059551 | 3300025934 | Miscanthus Rhizosphere | MSVFMSWARSTVANVEHALGRTDNWFDRILIGVLVLLALAVVFLFAQ |
Ga0207711_104685632 | 3300025941 | Switchgrass Rhizosphere | MSVMMSWARSTLASVEHSLGRSDRTFDRLLVGVLVLLAFAIAFLFFVAM |
Ga0207661_107449371 | 3300025944 | Corn Rhizosphere | MSVLMSWARSTLATVEHSLGRSDHWFDRMLVGVLVLLAFAVVFLFVAAT |
Ga0207651_104374402 | 3300025960 | Switchgrass Rhizosphere | MSVMMSWARSTLANVEHALGRSDHWFDRLLVGVLVLLAFAVIFLFVAT |
Ga0207712_118073942 | 3300025961 | Switchgrass Rhizosphere | PLMSVMMSWARSTLANVEHSLGRSDRTFDRLLVGVLVLLAFAIAFLFFVAM |
Ga0209919_11047252 | 3300026196 | Soil | MSVLMSWARSTLANVENAFDRSDRWFDRMLVGTLVLLAVAIVLLFVAT |
Ga0209180_104628582 | 3300027846 | Vadose Zone Soil | MSWARSTVANIEHKLGRGEDYFDRILVGVLLLLALAIAVLFTR |
Ga0209068_101465432 | 3300027894 | Watersheds | MSVLMSWARSTVASLEHTLGRTDAWYDRILVGVLVLLAVAVTFLFIQ |
Ga0209068_101845982 | 3300027894 | Watersheds | MDVLMSWARSTLANFERALSRSDQYFERILVGVLIALAIAIAVLFTQAA |
Ga0209068_103803611 | 3300027894 | Watersheds | MDVLMSWARSTVANFEHSLGRSERYFDRILIGVLIALAVAITVLFTQAA |
Ga0209069_100069838 | 3300027915 | Watersheds | MSVLMSWARSTVANLEHTLGRTDAWYDGILVGVLALLAVAVVFLFVQ |
Ga0268266_109372622 | 3300028379 | Switchgrass Rhizosphere | KEPRMSVMMSWARSTLANVEHSLARSDRNFDRLLVGVVVLLVVAIALLFLAA |
Ga0268265_115365671 | 3300028380 | Switchgrass Rhizosphere | VMMSWARSTLANVEHSLGRSDRTFDRLLVGVLVLLAFAIAFLFFVAM |
Ga0268265_125110151 | 3300028380 | Switchgrass Rhizosphere | MSVLMSWARSTLANVEHNLGKSNRWFDRMLVGVLVLLVIGVVFIFTSAT |
Ga0265326_102234451 | 3300028558 | Rhizosphere | MSVLMSWARSTLANLEQALARSDRSFDRILVGVLVLLAIAIACLFFAT |
Ga0299914_104288582 | 3300031228 | Soil | MDTFMSWARSTVANVEHTLGRSDRYFDRILVGVLVALVVAVALLFLQGL |
Ga0302323_1003134782 | 3300031232 | Fen | MSVLMSWARSTVAGLEHALGRTERWFDRILVVVLLLLAVAVAFLFTQ |
Ga0265327_100077754 | 3300031251 | Rhizosphere | MSVLMSWARSTLANVEHSLGRSDHLFDRMLAGVLVLLAFAIVLLFVAT |
Ga0265327_103470481 | 3300031251 | Rhizosphere | MSVLMSWARSTMAGVEHALGRTERWFDRILIVVLLLLAVAVAFLFTQ |
Ga0265327_103744181 | 3300031251 | Rhizosphere | MSVLMSWARSTLANVEHGLGRSDRWFDRMLVGVLVLLAFAIVLIFLAV |
Ga0318547_107954462 | 3300031781 | Soil | MQLFMSWARSTVANVERTLTRSERQFDRILVGVLILLAIAIAVVFTQAA |
Ga0318529_104631692 | 3300031792 | Soil | MSVFLSWARSTVANLDRALGRSDQWFDRILVGVLILLVIAVAFLFSQ |
Ga0318512_107293411 | 3300031846 | Soil | MHVFMSWARSTATNIERLLGRSEDYFDRILIGVLGLLALAVLF |
Ga0318536_103710162 | 3300031893 | Soil | MSVLMSWARSMLANVEDALGRSDHWFDRMLVGVLVLLGVAIVVLFVAT |
Ga0315272_104969751 | 3300032018 | Sediment | MSLFMSWARSTVASFEHALGRTEDWFDRILVGVLILLAFAVVFLFTQ |
Ga0306920_1011562682 | 3300032261 | Soil | RCAGRRKAPTMHVFMSWARSTATNIERLLGRSEDYFDRILIGVLGLLALAVLFLFATS |
Ga0315273_103603113 | 3300032516 | Sediment | PERTAPMSLFMSWARSTVASFEHALGRTEDWFDRILVGVLILLAFAVVFLFTQ |
Ga0335080_108037492 | 3300032828 | Soil | MSVFFSWARSTVANLDRALGRSDQWFDRILVGVLVLLVIAVAFLFSQ |
⦗Top⦘ |