| Basic Information | |
|---|---|
| Family ID | F056017 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 138 |
| Average Sequence Length | 37 residues |
| Representative Sequence | MSAAGPPQGANCAPAFGGSAAAELANEAASVGVHQ |
| Number of Associated Samples | 83 |
| Number of Associated Scaffolds | 138 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 57.89 % |
| % of genes near scaffold ends (potentially truncated) | 44.93 % |
| % of genes from short scaffolds (< 2000 bps) | 56.52 % |
| Associated GOLD sequencing projects | 80 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (78.261 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (33.333 % of family members) |
| Environment Ontology (ENVO) | Unclassified (47.101 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (50.725 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.33% β-sheet: 0.00% Coil/Unstructured: 66.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 138 Family Scaffolds |
|---|---|---|
| PF00005 | ABC_tran | 8.70 |
| PF00528 | BPD_transp_1 | 7.25 |
| PF02653 | BPD_transp_2 | 4.35 |
| PF00873 | ACR_tran | 2.90 |
| PF00361 | Proton_antipo_M | 2.17 |
| PF08402 | TOBE_2 | 1.45 |
| PF00797 | Acetyltransf_2 | 1.45 |
| PF00248 | Aldo_ket_red | 1.45 |
| PF00346 | Complex1_49kDa | 1.45 |
| PF00483 | NTP_transferase | 1.45 |
| PF02777 | Sod_Fe_C | 1.45 |
| PF02737 | 3HCDH_N | 1.45 |
| PF06267 | DUF1028 | 1.45 |
| PF04055 | Radical_SAM | 1.45 |
| PF08281 | Sigma70_r4_2 | 1.45 |
| PF00171 | Aldedh | 1.45 |
| PF02321 | OEP | 1.45 |
| PF13458 | Peripla_BP_6 | 1.45 |
| PF01494 | FAD_binding_3 | 1.45 |
| PF03401 | TctC | 1.45 |
| PF12911 | OppC_N | 0.72 |
| PF02934 | GatB_N | 0.72 |
| PF03447 | NAD_binding_3 | 0.72 |
| PF13401 | AAA_22 | 0.72 |
| PF13466 | STAS_2 | 0.72 |
| PF07992 | Pyr_redox_2 | 0.72 |
| PF00486 | Trans_reg_C | 0.72 |
| PF11743 | DUF3301 | 0.72 |
| PF02613 | Nitrate_red_del | 0.72 |
| PF01127 | Sdh_cyt | 0.72 |
| PF13432 | TPR_16 | 0.72 |
| PF08501 | Shikimate_dh_N | 0.72 |
| PF12697 | Abhydrolase_6 | 0.72 |
| PF01032 | FecCD | 0.72 |
| PF03840 | SecG | 0.72 |
| PF01257 | 2Fe-2S_thioredx | 0.72 |
| PF07793 | DUF1631 | 0.72 |
| PF07690 | MFS_1 | 0.72 |
| PF13442 | Cytochrome_CBB3 | 0.72 |
| PF00326 | Peptidase_S9 | 0.72 |
| PF00106 | adh_short | 0.72 |
| PF00294 | PfkB | 0.72 |
| PF00795 | CN_hydrolase | 0.72 |
| PF01975 | SurE | 0.72 |
| PF00892 | EamA | 0.72 |
| PF02104 | SURF1 | 0.72 |
| PF01966 | HD | 0.72 |
| PF07978 | NIPSNAP | 0.72 |
| PF01435 | Peptidase_M48 | 0.72 |
| PF02826 | 2-Hacid_dh_C | 0.72 |
| PF00202 | Aminotran_3 | 0.72 |
| PF09828 | Chrome_Resist | 0.72 |
| PF01047 | MarR | 0.72 |
| PF01717 | Meth_synt_2 | 0.72 |
| PF04321 | RmlD_sub_bind | 0.72 |
| PF08241 | Methyltransf_11 | 0.72 |
| PF03972 | MmgE_PrpD | 0.72 |
| PF11306 | DUF3108 | 0.72 |
| PF03934 | T2SSK | 0.72 |
| PF01970 | TctA | 0.72 |
| PF03477 | ATP-cone | 0.72 |
| PF02668 | TauD | 0.72 |
| PF01266 | DAO | 0.72 |
| PF02233 | PNTB | 0.72 |
| PF04995 | CcmD | 0.72 |
| PF13298 | LigD_N | 0.72 |
| PF02775 | TPP_enzyme_C | 0.72 |
| PF00682 | HMGL-like | 0.72 |
| PF13561 | adh_short_C2 | 0.72 |
| PF08811 | DUF1800 | 0.72 |
| PF01926 | MMR_HSR1 | 0.72 |
| PF09948 | DUF2182 | 0.72 |
| PF03450 | CO_deh_flav_C | 0.72 |
| PF00056 | Ldh_1_N | 0.72 |
| PF06857 | ACP | 0.72 |
| PF00327 | Ribosomal_L30 | 0.72 |
| PF12769 | PNTB_4TM | 0.72 |
| PF00472 | RF-1 | 0.72 |
| PF08445 | FR47 | 0.72 |
| PF05035 | DGOK | 0.72 |
| PF16490 | Oxidoreduct_C | 0.72 |
| PF00378 | ECH_1 | 0.72 |
| PF02142 | MGS | 0.72 |
| PF05834 | Lycopene_cycl | 0.72 |
| PF09837 | DUF2064 | 0.72 |
| PF00288 | GHMP_kinases_N | 0.72 |
| COG ID | Name | Functional Category | % Frequency in 138 Family Scaffolds |
|---|---|---|---|
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 2.90 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 2.90 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 1.45 |
| COG2084 | 3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase | Lipid transport and metabolism [I] | 1.45 |
| COG1748 | Saccharopine dehydrogenase, NADP-dependent | Amino acid transport and metabolism [E] | 1.45 |
| COG2162 | Arylamine N-acetyltransferase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.45 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 1.45 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 1.45 |
| COG3261 | Ni,Fe-hydrogenase III large subunit | Energy production and conversion [C] | 1.45 |
| COG1086 | NDP-sugar epimerase, includes UDP-GlcNAc-inverting 4,6-dehydratase FlaA1 and capsular polysaccharide biosynthesis protein EpsC | Cell wall/membrane/envelope biogenesis [M] | 1.45 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 1.45 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 1.45 |
| COG0702 | Uncharacterized conserved protein YbjT, contains NAD(P)-binding and DUF2867 domains | General function prediction only [R] | 1.45 |
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 1.45 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 1.45 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 1.45 |
| COG0649 | NADH:ubiquinone oxidoreductase 49 kD subunit (chain D) | Energy production and conversion [C] | 1.45 |
| COG0605 | Superoxide dismutase | Inorganic ion transport and metabolism [P] | 1.45 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 1.45 |
| COG3342 | Uncharacterized conserved protein, Ntn-hydrolase superfamily | General function prediction only [R] | 1.45 |
| COG0451 | Nucleoside-diphosphate-sugar epimerase | Cell wall/membrane/envelope biogenesis [M] | 1.45 |
| COG0287 | Prephenate dehydrogenase | Amino acid transport and metabolism [E] | 1.45 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 1.45 |
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 1.45 |
| COG2009 | Succinate dehydrogenase/fumarate reductase, cytochrome b subunit | Energy production and conversion [C] | 0.72 |
| COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 0.72 |
| COG5267 | Uncharacterized conserved protein, DUF1800 family | Function unknown [S] | 0.72 |
| COG3734 | 2-keto-3-deoxy-galactonokinase | Carbohydrate transport and metabolism [G] | 0.72 |
| COG2142 | Succinate dehydrogenase, hydrophobic anchor subunit | Energy production and conversion [C] | 0.72 |
| COG3346 | Cytochrome oxidase assembly protein ShyY1 | Posttranslational modification, protein turnover, chaperones [O] | 0.72 |
| COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.72 |
| COG2180 | Nitrate reductase assembly protein NarJ, required for insertion of molybdenum cofactor | Posttranslational modification, protein turnover, chaperones [O] | 0.72 |
| COG2511 | Archaeal Glu-tRNAGln amidotransferase subunit E, contains GAD domain | Translation, ribosomal structure and biogenesis [J] | 0.72 |
| COG3114 | Heme exporter protein D | Intracellular trafficking, secretion, and vesicular transport [U] | 0.72 |
| COG3156 | Type II secretory pathway, component PulK | Intracellular trafficking, secretion, and vesicular transport [U] | 0.72 |
| COG3333 | TctA family transporter | General function prediction only [R] | 0.72 |
| COG1089 | GDP-D-mannose dehydratase | Cell wall/membrane/envelope biogenesis [M] | 0.72 |
| COG0039 | Malate/lactate dehydrogenase | Energy production and conversion [C] | 0.72 |
| COG0064 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunit | Translation, ribosomal structure and biogenesis [J] | 0.72 |
| COG0169 | Shikimate 5-dehydrogenase | Amino acid transport and metabolism [E] | 0.72 |
| COG0216 | Protein chain release factor RF1 | Translation, ribosomal structure and biogenesis [J] | 0.72 |
| COG0496 | Broad specificity polyphosphatase and 5'/3'-nucleotidase SurE | Replication, recombination and repair [L] | 0.72 |
| COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 0.72 |
| COG1087 | UDP-glucose 4-epimerase | Cell wall/membrane/envelope biogenesis [M] | 0.72 |
| COG1088 | dTDP-D-glucose 4,6-dehydratase | Cell wall/membrane/envelope biogenesis [M] | 0.72 |
| COG1905 | NADH:ubiquinone oxidoreductase 24 kD subunit (chain E) | Energy production and conversion [C] | 0.72 |
| COG1090 | NAD dependent epimerase/dehydratase family enzyme | General function prediction only [R] | 0.72 |
| COG1091 | dTDP-4-dehydrorhamnose reductase | Cell wall/membrane/envelope biogenesis [M] | 0.72 |
| COG1186 | Protein chain release factor PrfB | Translation, ribosomal structure and biogenesis [J] | 0.72 |
| COG1282 | NAD/NADP transhydrogenase beta subunit | Energy production and conversion [C] | 0.72 |
| COG1314 | Protein translocase subunit SecG | Intracellular trafficking, secretion, and vesicular transport [U] | 0.72 |
| COG1486 | Alpha-galactosidase/6-phospho-beta-glucosidase, family 4 of glycosyl hydrolase | Carbohydrate transport and metabolism [G] | 0.72 |
| COG1784 | TctA family transporter | General function prediction only [R] | 0.72 |
| COG1841 | Ribosomal protein L30/L7E | Translation, ribosomal structure and biogenesis [J] | 0.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 80.43 % |
| Unclassified | root | N/A | 19.57 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005543|Ga0070672_100022076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 4667 | Open in IMG/M |
| 3300005543|Ga0070672_100045565 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3393 | Open in IMG/M |
| 3300005560|Ga0066670_10019407 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3129 | Open in IMG/M |
| 3300005561|Ga0066699_10034286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2978 | Open in IMG/M |
| 3300005561|Ga0066699_10772724 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300005576|Ga0066708_10096187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1752 | Open in IMG/M |
| 3300005587|Ga0066654_10869211 | Not Available | 516 | Open in IMG/M |
| 3300005598|Ga0066706_10564308 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium 13_1_20CM_4_70_13 | 904 | Open in IMG/M |
| 3300005617|Ga0068859_100027879 | Not Available | 5663 | Open in IMG/M |
| 3300005617|Ga0068859_100043962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4489 | Open in IMG/M |
| 3300005618|Ga0068864_100334687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1425 | Open in IMG/M |
| 3300005840|Ga0068870_10011872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4054 | Open in IMG/M |
| 3300005841|Ga0068863_100100485 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2749 | Open in IMG/M |
| 3300005843|Ga0068860_100043996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4257 | Open in IMG/M |
| 3300006032|Ga0066696_10651870 | Not Available | 680 | Open in IMG/M |
| 3300006046|Ga0066652_101793457 | Not Available | 555 | Open in IMG/M |
| 3300006057|Ga0075026_100880214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 549 | Open in IMG/M |
| 3300006172|Ga0075018_10654129 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300006173|Ga0070716_101349982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Ralstonia → Ralstonia solanacearum | 578 | Open in IMG/M |
| 3300006175|Ga0070712_100457393 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1064 | Open in IMG/M |
| 3300006797|Ga0066659_10784040 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 787 | Open in IMG/M |
| 3300009012|Ga0066710_100043824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 5438 | Open in IMG/M |
| 3300009012|Ga0066710_100106312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3774 | Open in IMG/M |
| 3300009038|Ga0099829_10994462 | Not Available | 696 | Open in IMG/M |
| 3300009075|Ga0105090_10019243 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4185 | Open in IMG/M |
| 3300009090|Ga0099827_10262514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1454 | Open in IMG/M |
| 3300009090|Ga0099827_11179282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 666 | Open in IMG/M |
| 3300009090|Ga0099827_11790575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 535 | Open in IMG/M |
| 3300009137|Ga0066709_100001202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 16536 | Open in IMG/M |
| 3300009137|Ga0066709_100007401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 9484 | Open in IMG/M |
| 3300009137|Ga0066709_100176531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Azoarcus → unclassified Azoarcus → Azoarcus sp. | 2774 | Open in IMG/M |
| 3300009137|Ga0066709_100181974 | All Organisms → cellular organisms → Bacteria | 2737 | Open in IMG/M |
| 3300009137|Ga0066709_100215046 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2539 | Open in IMG/M |
| 3300009137|Ga0066709_100388733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1931 | Open in IMG/M |
| 3300009553|Ga0105249_10046572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3947 | Open in IMG/M |
| 3300010880|Ga0126350_10898414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1061 | Open in IMG/M |
| 3300011432|Ga0137428_1147002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia | 691 | Open in IMG/M |
| 3300011444|Ga0137463_1096867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1110 | Open in IMG/M |
| 3300011445|Ga0137427_10479310 | Not Available | 511 | Open in IMG/M |
| 3300012198|Ga0137364_10112917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1928 | Open in IMG/M |
| 3300012201|Ga0137365_10067323 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2701 | Open in IMG/M |
| 3300012201|Ga0137365_10069774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2651 | Open in IMG/M |
| 3300012201|Ga0137365_10775957 | Not Available | 700 | Open in IMG/M |
| 3300012202|Ga0137363_10608840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 922 | Open in IMG/M |
| 3300012206|Ga0137380_10370709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 1275 | Open in IMG/M |
| 3300012206|Ga0137380_10450465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1138 | Open in IMG/M |
| 3300012206|Ga0137380_10675233 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 898 | Open in IMG/M |
| 3300012207|Ga0137381_10171220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1875 | Open in IMG/M |
| 3300012207|Ga0137381_10256988 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Flammeovirgaceae → Flexithrix → Flexithrix dorotheae | 1519 | Open in IMG/M |
| 3300012207|Ga0137381_10433602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1147 | Open in IMG/M |
| 3300012207|Ga0137381_10577946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 979 | Open in IMG/M |
| 3300012207|Ga0137381_10621766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 941 | Open in IMG/M |
| 3300012208|Ga0137376_11414579 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300012209|Ga0137379_10029661 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5265 | Open in IMG/M |
| 3300012209|Ga0137379_10137767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2344 | Open in IMG/M |
| 3300012209|Ga0137379_11068035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 713 | Open in IMG/M |
| 3300012210|Ga0137378_10023752 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5398 | Open in IMG/M |
| 3300012210|Ga0137378_10024431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 5327 | Open in IMG/M |
| 3300012210|Ga0137378_10047673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3848 | Open in IMG/M |
| 3300012210|Ga0137378_10287903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1528 | Open in IMG/M |
| 3300012210|Ga0137378_10703567 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 921 | Open in IMG/M |
| 3300012349|Ga0137387_10065801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2457 | Open in IMG/M |
| 3300012349|Ga0137387_10096588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2053 | Open in IMG/M |
| 3300012350|Ga0137372_10022024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 5947 | Open in IMG/M |
| 3300012350|Ga0137372_10302244 | Not Available | 1240 | Open in IMG/M |
| 3300012351|Ga0137386_10367162 | Not Available | 1036 | Open in IMG/M |
| 3300012351|Ga0137386_10369952 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Palaeoptera → Ephemeroptera → Furcatergalia → Scapphodonta → Ephemeridae → Ephemera → Ephemera danica | 1032 | Open in IMG/M |
| 3300012354|Ga0137366_10506924 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300012354|Ga0137366_10562053 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 820 | Open in IMG/M |
| 3300012356|Ga0137371_10142492 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1878 | Open in IMG/M |
| 3300012356|Ga0137371_10873022 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 684 | Open in IMG/M |
| 3300012357|Ga0137384_10187119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1733 | Open in IMG/M |
| 3300012357|Ga0137384_10314894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1300 | Open in IMG/M |
| 3300012357|Ga0137384_11383271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 552 | Open in IMG/M |
| 3300012358|Ga0137368_10089468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2425 | Open in IMG/M |
| 3300012359|Ga0137385_10060396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae | 3378 | Open in IMG/M |
| 3300012359|Ga0137385_10716802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 835 | Open in IMG/M |
| 3300012359|Ga0137385_11401698 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300012361|Ga0137360_10943261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 744 | Open in IMG/M |
| 3300012684|Ga0136614_10090220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2324 | Open in IMG/M |
| 3300012917|Ga0137395_10060739 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2410 | Open in IMG/M |
| 3300012929|Ga0137404_10763896 | Not Available | 877 | Open in IMG/M |
| 3300012971|Ga0126369_10104428 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2573 | Open in IMG/M |
| 3300012977|Ga0134087_10744632 | Not Available | 524 | Open in IMG/M |
| 3300014326|Ga0157380_13059667 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 533 | Open in IMG/M |
| 3300015371|Ga0132258_10013021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 17584 | Open in IMG/M |
| 3300015371|Ga0132258_10080482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 7595 | Open in IMG/M |
| 3300015371|Ga0132258_10172966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5209 | Open in IMG/M |
| 3300015371|Ga0132258_10180610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Prosthecomicrobium → Prosthecomicrobium hirschii | 5099 | Open in IMG/M |
| 3300015371|Ga0132258_10184341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 5049 | Open in IMG/M |
| 3300015371|Ga0132258_10467607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 3147 | Open in IMG/M |
| 3300017930|Ga0187825_10012642 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2827 | Open in IMG/M |
| 3300018071|Ga0184618_10020680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2152 | Open in IMG/M |
| 3300018071|Ga0184618_10056015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1447 | Open in IMG/M |
| 3300018083|Ga0184628_10040638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2335 | Open in IMG/M |
| 3300018431|Ga0066655_10562986 | Not Available | 763 | Open in IMG/M |
| 3300018431|Ga0066655_10920320 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri | 599 | Open in IMG/M |
| 3300018431|Ga0066655_10927560 | Not Available | 597 | Open in IMG/M |
| 3300018431|Ga0066655_11329152 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium necroappetens | 517 | Open in IMG/M |
| 3300018482|Ga0066669_10031646 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3132 | Open in IMG/M |
| 3300018482|Ga0066669_10126332 | All Organisms → cellular organisms → Bacteria | 1833 | Open in IMG/M |
| 3300020004|Ga0193755_1171442 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 643 | Open in IMG/M |
| 3300020006|Ga0193735_1010038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 2982 | Open in IMG/M |
| 3300021478|Ga0210402_10017129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 6214 | Open in IMG/M |
| 3300021478|Ga0210402_11106762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 719 | Open in IMG/M |
| 3300022756|Ga0222622_11253142 | Not Available | 546 | Open in IMG/M |
| 3300025910|Ga0207684_10009323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 8673 | Open in IMG/M |
| 3300025922|Ga0207646_10127808 | All Organisms → cellular organisms → Bacteria | 2286 | Open in IMG/M |
| 3300025922|Ga0207646_10311629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1422 | Open in IMG/M |
| 3300025922|Ga0207646_10507326 | Not Available | 1086 | Open in IMG/M |
| 3300026088|Ga0207641_12269512 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 542 | Open in IMG/M |
| 3300026089|Ga0207648_10013019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 7760 | Open in IMG/M |
| 3300026320|Ga0209131_1016274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 4534 | Open in IMG/M |
| 3300026320|Ga0209131_1348998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 550 | Open in IMG/M |
| 3300026326|Ga0209801_1144775 | Not Available | 1005 | Open in IMG/M |
| 3300026334|Ga0209377_1175934 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 759 | Open in IMG/M |
| 3300026523|Ga0209808_1181199 | Not Available | 746 | Open in IMG/M |
| 3300026523|Ga0209808_1322876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 500 | Open in IMG/M |
| 3300026550|Ga0209474_10046618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 3125 | Open in IMG/M |
| 3300027775|Ga0209177_10284595 | Not Available | 624 | Open in IMG/M |
| 3300030339|Ga0311360_10482861 | Not Available | 994 | Open in IMG/M |
| 3300031521|Ga0311364_10638406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp. SK-11 | 1073 | Open in IMG/M |
| 3300031996|Ga0308176_12153869 | Not Available | 595 | Open in IMG/M |
| 3300032397|Ga0315287_10119602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3015 | Open in IMG/M |
| 3300032397|Ga0315287_12480269 | Not Available | 557 | Open in IMG/M |
| 3300033433|Ga0326726_10003389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 14627 | Open in IMG/M |
| 3300033433|Ga0326726_10011616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 7763 | Open in IMG/M |
| 3300033433|Ga0326726_10016808 | All Organisms → cellular organisms → Bacteria | 6367 | Open in IMG/M |
| 3300033433|Ga0326726_10080788 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2881 | Open in IMG/M |
| 3300034090|Ga0326723_0166920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 970 | Open in IMG/M |
| 3300034090|Ga0326723_0349050 | Not Available | 668 | Open in IMG/M |
| 3300034115|Ga0364945_0270502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b | 526 | Open in IMG/M |
| 3300034150|Ga0364933_098769 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 738 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 33.33% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 11.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.87% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.35% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 4.35% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 4.35% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.35% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.90% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.17% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.17% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.45% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.45% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.45% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.45% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.72% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.72% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.72% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.72% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.72% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.72% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.72% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.72% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.72% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009075 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011398 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT600_2 | Environmental | Open in IMG/M |
| 3300011432 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2 | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300011445 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012684 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06) | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
| 3300030339 | III_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| 3300034115 | Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17 | Environmental | Open in IMG/M |
| 3300034150 | Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0070672_1000220764 | 3300005543 | Miscanthus Rhizosphere | MSAAGPSQGAKGAPSGGSAAAELTNETASVGVVR* |
| Ga0070672_1000455652 | 3300005543 | Miscanthus Rhizosphere | MTMSAAGPSQGANCAPFGGSAAAELANEAASVGVQ* |
| Ga0066670_100194072 | 3300005560 | Soil | MSDMSAAGPSQGAHCSPSGGSAAAELINEAASVGVV* |
| Ga0066699_100342864 | 3300005561 | Soil | MSAAGPSQGANSSPSGGSAAAEWVNEAASVGAHI* |
| Ga0066699_107727242 | 3300005561 | Soil | MSAAGPPQGANCSPAFGGSAAAELVNEAASVGVHK* |
| Ga0066708_100961872 | 3300005576 | Soil | RDAGGKRMSAAEPYHYAGAPAFGGSAAAELATQLANEAASVGVVP* |
| Ga0066654_108692111 | 3300005587 | Soil | MSAAGPPQGANFAPTGGSAAAEFANEAASVGVHICAAG |
| Ga0066706_105643082 | 3300005598 | Soil | MSAAGPPQGANCAPAFGGSAAAEWVNEAASVGAHP |
| Ga0068859_1000278792 | 3300005617 | Switchgrass Rhizosphere | MSAAGPLQGAHGSPSGGSDAAEWANEAASVGALK* |
| Ga0068859_1000439621 | 3300005617 | Switchgrass Rhizosphere | QMSAAGPPQGANSAPSGGSAAAELDNEAASVEAHR* |
| Ga0068864_1003346872 | 3300005618 | Switchgrass Rhizosphere | MSAMSAAGPPQGANCSPSGGSEAAELDNAAASVGVQ* |
| Ga0068870_100118723 | 3300005840 | Miscanthus Rhizosphere | MSAAGPSQGANSSPSGGSVAAEFVYEAASVGALQ* |
| Ga0068863_1001004852 | 3300005841 | Switchgrass Rhizosphere | MSAAGPSQGANSSPSGGSVAAEFVYAAASAGALQ* |
| Ga0068860_1000439965 | 3300005843 | Switchgrass Rhizosphere | MSAAGPPQGANSAPSGGSAAAELDNEAASVEAHR* |
| Ga0066696_106518702 | 3300006032 | Soil | MSAAGPPQGANCAPAFGGSAAAELANELANEAASVGVHQ* |
| Ga0066652_1017934572 | 3300006046 | Soil | MSAAEPFHGAGAPSFGGSAAVDLANELANEAASVGVHS |
| Ga0075026_1008802142 | 3300006057 | Watersheds | MSTTLSAIMSAAGPPEGANRSPSGGSAAAEWVNEAAGVGAVI* |
| Ga0075018_106541291 | 3300006172 | Watersheds | ASKDTGGIRVMSADGPPQGANCSAPGGSAAAEWANEAASVGAHQ* |
| Ga0070716_1013499821 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | HMSAAGPPQGANSAPTEGSAAAALANPAASVGGP* |
| Ga0070712_1004573931 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MSGAGPSQAASCAPNGGSAAAERANEAASVGVLK* |
| Ga0066659_107840401 | 3300006797 | Soil | GRLRDAEVEFMSAAGPPQGANCSPAFGGSAAAELANEAASVGVQ* |
| Ga0066710_1000438242 | 3300009012 | Grasslands Soil | MSAAGPPQSANCAPAFGGSAAAEWVNEAASVGVVA |
| Ga0066710_1001063123 | 3300009012 | Grasslands Soil | MSAAGPPQGANCSPAFGGSAAAEWVNEAASVGVLT |
| Ga0099829_109944622 | 3300009038 | Vadose Zone Soil | MSAAEPFHGAGAPSGGSAAVELANELAHEAASVGVLP* |
| Ga0105090_100192434 | 3300009075 | Freshwater Sediment | MSAAGPSQGANRAPSGGSAAAEWVNEAASVGAHQ* |
| Ga0099827_102625142 | 3300009090 | Vadose Zone Soil | MSAAEPYHCAGAPALGGSAAAELANELANEAASVGAQQ* |
| Ga0099827_111792821 | 3300009090 | Vadose Zone Soil | MAMSAAEPYHCAGAPAFGGSAAGELVNEAASVGVLQ* |
| Ga0099827_117905752 | 3300009090 | Vadose Zone Soil | MSAAEPFHGAGAPVFRGSAAAEFVNEAASVGVHP* |
| Ga0066709_10000120213 | 3300009137 | Grasslands Soil | MSDAGPPQGANCAPAFGGSAAAEFANEAASVGAQ* |
| Ga0066709_1000074019 | 3300009137 | Grasslands Soil | MSAAGPPQGANFAPTGGSAAAEFANEAASLGVQS* |
| Ga0066709_1001765312 | 3300009137 | Grasslands Soil | MSAAEPYHCAGAPAFGGSAAAELANEAASVGVLP* |
| Ga0066709_1001819744 | 3300009137 | Grasslands Soil | MSAAEPFHGAGTPAFGGSAAAELINEAASVGAHQ* |
| Ga0066709_1002150464 | 3300009137 | Grasslands Soil | MSAAGPPQGANCSPALGGSAAAELANELSNEAASVGAHQ* |
| Ga0066709_1003887332 | 3300009137 | Grasslands Soil | MSAAEPFHGAGAPSFGGSAAVDLANELANEAASVGVHS* |
| Ga0105249_100465724 | 3300009553 | Switchgrass Rhizosphere | MSAAGPSQGANSSPSGGSVAAEFVYAAASAGALR* |
| Ga0126350_108984141 | 3300010880 | Boreal Forest Soil | MSAAGPPQGANCAPAFGGSAAAELANEAASVGVQS |
| Ga0137348_10768392 | 3300011398 | Soil | MSAAGPSQGANCSPAGGSEAASAASVGGTYRAAGPS |
| Ga0137428_11470022 | 3300011432 | Soil | MSAAGPPQGANCAPPGGSAAASLANEAASVGAHQIGIG |
| Ga0137463_10968672 | 3300011444 | Soil | MSTAGLPQGANCSPSGGSAAAELAAELATELANKAASVGAQ* |
| Ga0137427_104793101 | 3300011445 | Soil | MDIAMSAAGPSQGANYSPSGGSAAAELANEAATVG |
| Ga0137364_101129171 | 3300012198 | Vadose Zone Soil | MSAAGPSQGANYSPPGGSAAATAASVGVYLDPPALGFGTL |
| Ga0137365_100673236 | 3300012201 | Vadose Zone Soil | MSAAEPSHGAGAPAFEGSAAAELANEAASVGVHQ* |
| Ga0137365_100697745 | 3300012201 | Vadose Zone Soil | MSAAEPFHGAGAPAFGGSAAAELANEAASVGVNDSD* |
| Ga0137365_107759572 | 3300012201 | Vadose Zone Soil | GMSAAGPPQGANCAPAFGGSAAAELAKEAASVRVHMSVGARA* |
| Ga0137363_106088401 | 3300012202 | Vadose Zone Soil | MSAAEPFHGVGAPAFGGGAAAELATQLANEAASVGVVP* |
| Ga0137380_103707092 | 3300012206 | Vadose Zone Soil | MSAAEPFHGAGAPALAGSAAAELVNEAASVGVHL* |
| Ga0137380_104504652 | 3300012206 | Vadose Zone Soil | MSAAERPHGAGAPYRGSAAAELVNELAKEAASVGVQQ* |
| Ga0137380_106752332 | 3300012206 | Vadose Zone Soil | MARSSLMSATEPFHGAGAPAFGGSAAAELANEAASVGV |
| Ga0137381_101712202 | 3300012207 | Vadose Zone Soil | MSAAEPFHGADAPAFGASAAAELATQLATQLANEAASVGVVP* |
| Ga0137381_102569882 | 3300012207 | Vadose Zone Soil | VLGDPPTVMSAAGPPQGANGAPAFGGSAAAELSNEAASVGVQ* |
| Ga0137381_104336022 | 3300012207 | Vadose Zone Soil | MSAAEPFHGAGAPAFGGSAAAELVNEAANVGVHQ* |
| Ga0137381_105779463 | 3300012207 | Vadose Zone Soil | MSAPGPPQGVNCAPAFGGSAAAEFNEAASGGGYFHER |
| Ga0137381_106217661 | 3300012207 | Vadose Zone Soil | MSAAEPFHGAGAPAFGGSAAPQLANELANEAASVRVVP* |
| Ga0137376_114145791 | 3300012208 | Vadose Zone Soil | MSAAGPSQGANYSPFGGRGQSVAAELANEAASVGVR* |
| Ga0137379_100296615 | 3300012209 | Vadose Zone Soil | MSATEPFHGAGAPAFGGSAAAELANEAASVGVLP* |
| Ga0137379_101377672 | 3300012209 | Vadose Zone Soil | MSAAEPLHGAGTPAFGGSAAAELDNEAASVGVHQ* |
| Ga0137379_110680352 | 3300012209 | Vadose Zone Soil | MSAAEPFHGAGAPAFGGSAAAQLANELANEAASVGVH |
| Ga0137378_100237522 | 3300012210 | Vadose Zone Soil | MSAADPFYGAGTPAFGGSAAAELTTQLTNEAASVGVLQ* |
| Ga0137378_100244313 | 3300012210 | Vadose Zone Soil | MSAAESLHGAGTPAFGGSAAAELANELATEAASVGGHQ* |
| Ga0137378_100476732 | 3300012210 | Vadose Zone Soil | MSAAGPPQGANCAPAFGGSAAAELANEAASVGVHQ* |
| Ga0137378_102879031 | 3300012210 | Vadose Zone Soil | MSGNMSAAGLSQGANCAPAFGGSAAAELVNEAASVGVHQ* |
| Ga0137378_107035672 | 3300012210 | Vadose Zone Soil | VEAEADMNTAGPPQGVNCAPAFGGSAAAELANELANEAASVGVLP* |
| Ga0137387_100658014 | 3300012349 | Vadose Zone Soil | MSAAEPFHGAGAPAFGGSAAAELVSEAASVGALQ* |
| Ga0137387_100965882 | 3300012349 | Vadose Zone Soil | MSAAEPFHGAGAPAVGGSATAELSTQLANEAASVGVVP* |
| Ga0137372_100220247 | 3300012350 | Vadose Zone Soil | MSAAEPSRGAGAPAFGGSAAAQLANELANEAASVGVH* |
| Ga0137372_103022441 | 3300012350 | Vadose Zone Soil | MSAAGPPQGANCTPFGGSAAAELANEAASVGEHICAA |
| Ga0137386_103671623 | 3300012351 | Vadose Zone Soil | MSAAEPFHGAGAPAFGGSAAAELVSEAASVGVHQ* |
| Ga0137386_103699521 | 3300012351 | Vadose Zone Soil | MSAAGPPQGANCAPLGGSAAAEVANELANEAASVG |
| Ga0137366_105069242 | 3300012354 | Vadose Zone Soil | MSAAEPFHGAGAPAFGGSAAAELANEAASVGVNDRD* |
| Ga0137366_105620532 | 3300012354 | Vadose Zone Soil | MARSNLMSATEPPQGANCAPAFGGSAAAELANEAASVGV |
| Ga0137371_101424922 | 3300012356 | Vadose Zone Soil | MSAAERFHGAGAPAFGGSAAAELSNEAASVGVVA* |
| Ga0137371_108730221 | 3300012356 | Vadose Zone Soil | MSAAEPPQGANCAPAFGGSAAAELANEAASVGVHICAA |
| Ga0137384_101871193 | 3300012357 | Vadose Zone Soil | MSAAGPPQGANGAPAFGGSAAAEFANEAASVGVHP |
| Ga0137384_103148943 | 3300012357 | Vadose Zone Soil | MSATERFHGAGAPAFGGSAAAELANEATSVGVLP* |
| Ga0137384_113832712 | 3300012357 | Vadose Zone Soil | RAAGPPQGASCAPSGGSAAAKLANEWVNEAASVGVHH* |
| Ga0137368_100894683 | 3300012358 | Vadose Zone Soil | MSAAGPPQGANCAPSGGSAEAELANKASVGVHQDALL |
| Ga0137385_100603962 | 3300012359 | Vadose Zone Soil | MSAAERFHGAGAPAFGGSAAAELSNEAASVGVVP* |
| Ga0137385_107168021 | 3300012359 | Vadose Zone Soil | IHENFFLFVEAEADMNAAGPPQGVNCAPAFGGSAAAEFNEAASVGVLP* |
| Ga0137385_114016981 | 3300012359 | Vadose Zone Soil | YIRRIMSAAGPPQGANCAPAFGGSVAAEWVNEAASVGVV* |
| Ga0137360_109432612 | 3300012361 | Vadose Zone Soil | MSAAEPFHGAGARAFGGSTAAELVNEAASVGVLT* |
| Ga0136614_100902203 | 3300012684 | Polar Desert Sand | MSDAEPSQGANYSHSGGSAAAAELANEAASVGGP* |
| Ga0137395_100607394 | 3300012917 | Vadose Zone Soil | MSAAEPYDGAGAPAFGGSAAAELTNEAASVGGLP* |
| Ga0137404_107638961 | 3300012929 | Vadose Zone Soil | MSAGGPPQGANCAPFGGSAAAELANEAASVGVHHRAEEI |
| Ga0126369_101044284 | 3300012971 | Tropical Forest Soil | MSAAGPSQGANCAPAFGGSAAAELINEAASVGVL* |
| Ga0134087_107446322 | 3300012977 | Grasslands Soil | MSAAGPPQGANCSPALGGSAAAELANELSNEAASVG |
| Ga0157380_130596672 | 3300014326 | Switchgrass Rhizosphere | VMSAAGPSQGANCSPSGGSAAAELANEAASVGAVQ* |
| Ga0132258_100130211 | 3300015371 | Arabidopsis Rhizosphere | MSAAGPSQGANWSPSGGSEAAELDNEAASVGVHP* |
| Ga0132258_100804824 | 3300015371 | Arabidopsis Rhizosphere | MSAAWPSQGANCFPLGGSAAAELANEAASVGAHR* |
| Ga0132258_101729664 | 3300015371 | Arabidopsis Rhizosphere | MSGEGPRRGANYAPFGGSAAAELANEAASVGVDP* |
| Ga0132258_101806103 | 3300015371 | Arabidopsis Rhizosphere | MSAAGPSQGANCSPSGGSAAAELANEAASVGAVK* |
| Ga0132258_101843412 | 3300015371 | Arabidopsis Rhizosphere | MSAAGPSQGANYAPSGGSAAAELINEAASVGVQL* |
| Ga0132258_104676073 | 3300015371 | Arabidopsis Rhizosphere | MSAAGPSQGANSAPSGGSAAAEFDNEAASVGANR* |
| Ga0187825_100126421 | 3300017930 | Freshwater Sediment | MSAAGPPQGAHCAPAFGGSVAAELADEAASVGVLE |
| Ga0184618_100206806 | 3300018071 | Groundwater Sediment | KNMRTSMNTMSAAGPSQGANCSPYGGSEAAKAASVGGPK |
| Ga0184618_100560154 | 3300018071 | Groundwater Sediment | MSAAGPSQGANSTPSGGSAAAELTNEAASVGTHQSA |
| Ga0184628_100406382 | 3300018083 | Groundwater Sediment | MGVMSAAGPSQGENCPHSGSSAAAELDNEAAGMGVV |
| Ga0066655_105629862 | 3300018431 | Grasslands Soil | AGMSAAGPPQGANGAHAVGGSAAAELINEAASVGVV |
| Ga0066655_109203202 | 3300018431 | Grasslands Soil | MSAAGPPRGANWSPDFGGSAAAELANEAASVRVHE |
| Ga0066655_109275602 | 3300018431 | Grasslands Soil | MSAAGPSQGANCAPAFGGSAAAELTNEAGSVGVLP |
| Ga0066655_113291521 | 3300018431 | Grasslands Soil | MRLSAAGPSQGARAPSGGSAAAELATELANEAASV |
| Ga0066669_100316462 | 3300018482 | Grasslands Soil | MSADGPSRGANCVPSGGSEAAELVNEAASVGAVHHARMQP |
| Ga0066669_101263323 | 3300018482 | Grasslands Soil | MTAMSAAGPPQGANCSPAFEGSAAAEWVNEAASVGVV |
| Ga0193713_11938192 | 3300019882 | Soil | MSTAGPPQGANSAPFGGSAAASAASVGVVNRTAGPPQAAGLRA |
| Ga0193755_11714421 | 3300020004 | Soil | MVSAAGPPQGANNSPSGRSAAAELDNEAASVGVPSE |
| Ga0193735_10100384 | 3300020006 | Soil | MSAAGPSQGVNYSPFGGRGQSVAAELANEAASVGDQP |
| Ga0210402_100171292 | 3300021478 | Soil | MSAAGPPQGANRSPAFGGSAAAQLATEWANEAASVGAQQ |
| Ga0210402_111067622 | 3300021478 | Soil | MSAAGPPQGANCAPAFGGSAAAELANELANEAASVGAHQ |
| Ga0222622_112531421 | 3300022756 | Groundwater Sediment | MSAAGPPQGANSSPSGGSAAASAASVGAHFRVEDRHFED |
| Ga0207684_100093239 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MSMSAAEPSHGVGAPPFGGSAEAELANEAASVGVHQ |
| Ga0207646_101278082 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MSAAGPPQGANCALAFGGSAAAELVNEAASVGVHI |
| Ga0207646_103116292 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MSAAEPFHGAGAPAFGGSAAAELANELANEAASVGVQ |
| Ga0207646_105073261 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | RKAAGMSMSAAEPSHGVGAPAFGGSAEAELANEAASVGVHQ |
| Ga0207641_122695122 | 3300026088 | Switchgrass Rhizosphere | MSGAGPPQAANGAPSGGSAAAPAASVGAVPVPLLEVSG |
| Ga0207648_100130193 | 3300026089 | Miscanthus Rhizosphere | MTMSAAGPSQGANCAPFGGSAAAELANEAASVGVQ |
| Ga0209131_10162744 | 3300026320 | Grasslands Soil | MSAAGPSQGANYAPAFGGSAAAELTNEAASMGVHQ |
| Ga0209131_13489981 | 3300026320 | Grasslands Soil | LHAMSAAEPFHGAGAPSGGSAAPELVNETASVGVL |
| Ga0209801_11447751 | 3300026326 | Soil | GELMSAAEPYHCAGAPAFGGSAAAQLANELANEAASVEVLP |
| Ga0209377_11759341 | 3300026334 | Soil | VEAEAHMNAAGPPHGVNCAPAFGGSAAAEFNEAASVGVLP |
| Ga0209808_11811991 | 3300026523 | Soil | YGMSAAGPPQGANCSPAFGGSAAAELANELANEAASVGVHQ |
| Ga0209808_13228762 | 3300026523 | Soil | GGKRMSAAEPYHCAGAPAFGGSAAAELATQLANEAASVGVVP |
| Ga0209156_101098391 | 3300026547 | Soil | MSAAGPPQGANSAPAFGGSAAAEWVNEAASVGVHICAAGPPQG |
| Ga0209474_100466181 | 3300026550 | Soil | MSGAGPSQAANCAPAFGGSAAAELSTQLANEAASVGAHQ |
| Ga0209177_102845952 | 3300027775 | Agricultural Soil | DMRAAGPPQGAHGAPAGGSAAAELANEAASVGALS |
| Ga0209048_1000232817 | 3300027902 | Freshwater Lake Sediment | MNAAEPSQGAHRAPSGGSAAASFSLAASVGVQLSAAE |
| Ga0311360_104828612 | 3300030339 | Bog | MSDVNMSAAGLSQGANRAPSGGSAAAKAASVGVQL |
| Ga0311364_106384061 | 3300031521 | Fen | MSAAGPSQGANSSPSGGSAAAKLCLGASVGAHHLLHILH |
| Ga0308176_121538691 | 3300031996 | Soil | GPMSDAGPSQAANCAPSGGSEAAESANEAASVGVR |
| Ga0315287_101196024 | 3300032397 | Sediment | MSAAGPSQGANGAPPGGSAAAELANEAASVGAHQRA |
| Ga0315287_116058621 | 3300032397 | Sediment | MSAAGPPQGANGAPTGGKTAAPAASVGAVRSAPVLQ |
| Ga0315287_124802692 | 3300032397 | Sediment | MTGPVSAAGPSQGANYAPSGGSAAAKAASVGAHISEP |
| Ga0326726_1000338911 | 3300033433 | Peat Soil | MSAAEPFHGAGAPDSGGSAAAQFAKLVANEAASVGVQ |
| Ga0326726_100116161 | 3300033433 | Peat Soil | MSAAEPFHGAGAPSGGSAAAELANELANEAASVGVL |
| Ga0326726_100168082 | 3300033433 | Peat Soil | MSAAEPLQGAGAPAFGGSAAAQLANELATQLANEAASVGVVP |
| Ga0326726_100807884 | 3300033433 | Peat Soil | MSAAEPYHCAGAPAFGGSAAAELANELAKEAASVGVHP |
| Ga0326723_0166920_862_969 | 3300034090 | Peat Soil | AVSAAGSPQGANRAPSGGSAAAELANEAASVGVHQ |
| Ga0326723_0349050_561_668 | 3300034090 | Peat Soil | MSAAEPYHCAGAPAFGGSAAAELANELANEAASVGV |
| Ga0364945_0270502_1_108 | 3300034115 | Sediment | MTTPKFRAAGPPQGANSAPSGGSAAAESTNEAASVG |
| Ga0364933_098769_1_108 | 3300034150 | Sediment | MSNTIRAAGPPQGANCAPSGGSAAARAASVGVVTPS |
| ⦗Top⦘ |