| Basic Information | |
|---|---|
| Family ID | F055998 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 138 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MSSALSEGPGGPGPGAAAGTVFRSELNPVDFLYRAAYLYPDK |
| Number of Associated Samples | 120 |
| Number of Associated Scaffolds | 138 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 2.17 % |
| % of genes from short scaffolds (< 2000 bps) | 1.45 % |
| Associated GOLD sequencing projects | 116 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (98.551 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (31.884 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.333 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.652 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 15.71% β-sheet: 0.00% Coil/Unstructured: 84.29% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 138 Family Scaffolds |
|---|---|---|
| PF02913 | FAD-oxidase_C | 48.55 |
| PF13672 | PP2C_2 | 4.35 |
| PF13376 | OmdA | 2.90 |
| PF04116 | FA_hydroxylase | 2.17 |
| PF00501 | AMP-binding | 1.45 |
| PF14019 | DUF4235 | 1.45 |
| PF00005 | ABC_tran | 1.45 |
| PF13193 | AMP-binding_C | 0.72 |
| PF13601 | HTH_34 | 0.72 |
| PF12697 | Abhydrolase_6 | 0.72 |
| PF12840 | HTH_20 | 0.72 |
| PF13560 | HTH_31 | 0.72 |
| PF04909 | Amidohydro_2 | 0.72 |
| PF00296 | Bac_luciferase | 0.72 |
| PF05988 | DUF899 | 0.72 |
| PF00528 | BPD_transp_1 | 0.72 |
| PF00355 | Rieske | 0.72 |
| PF01565 | FAD_binding_4 | 0.72 |
| PF00872 | Transposase_mut | 0.72 |
| PF03737 | RraA-like | 0.72 |
| PF02720 | DUF222 | 0.72 |
| PF06277 | EutA | 0.72 |
| PF04075 | F420H2_quin_red | 0.72 |
| PF00196 | GerE | 0.72 |
| COG ID | Name | Functional Category | % Frequency in 138 Family Scaffolds |
|---|---|---|---|
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 48.55 |
| COG3000 | Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamily | Lipid transport and metabolism [I] | 2.17 |
| COG0684 | RNA degradosome component RraA (regulator of RNase E activity) | Translation, ribosomal structure and biogenesis [J] | 0.72 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.72 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.72 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.72 |
| COG4819 | Ethanolamine utilization protein EutA, possible chaperonin | Amino acid transport and metabolism [E] | 0.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 98.55 % |
| All Organisms | root | All Organisms | 1.45 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005537|Ga0070730_10901953 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 554 | Open in IMG/M |
| 3300017955|Ga0187817_10080128 | All Organisms → cellular organisms → Bacteria | 2040 | Open in IMG/M |
| 3300032042|Ga0318545_10333148 | Not Available | 546 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 31.88% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 10.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.52% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.35% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.35% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.90% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.90% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.17% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.17% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.45% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.45% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.45% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.45% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.45% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.45% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.45% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.45% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.45% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.45% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.72% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.72% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.72% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.72% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.72% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.72% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.72% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300005165 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006575 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006603 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010152 | Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010877 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012517 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.6.yng.070610 | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300024254 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027692 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028714 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ26739_1002783731 | 3300002245 | Forest Soil | MNAELPGAPGHGNVPGKVFRTELNPVDFLERAAYIY |
| Ga0062384_1004917092 | 3300004082 | Bog Forest Soil | MSGALSATPGGPGPEAIAGQVFRSELNPVGFLERAAYIYPEKVAIVDGDRRL |
| Ga0066869_100495911 | 3300005165 | Soil | MSSALSEGPGGPGPEAAAGTVFRSELNPVDFLYRAAYLYPDKVAV |
| Ga0066684_106243752 | 3300005179 | Soil | MTGVSPAVPGVPAGEAAPGTVFRSELNPVDFLHRAAYLYPDKV |
| Ga0068868_1018466361 | 3300005338 | Miscanthus Rhizosphere | MSSALSEGPGQPGPGAAAGTVFRSELNPVDFLYRAAYLYPDKVAVAAGKRRYT |
| Ga0070692_108584711 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MSGAIPAAPGAGAVPGKVFRTELNPVDFLHRAAYMYPEKVAVV |
| Ga0068867_1004696491 | 3300005459 | Miscanthus Rhizosphere | MSSALSEGPGRPGPGAAAGTVFRSELNPVDFLYRAAYLYPD |
| Ga0070706_1014630462 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MSGALSGDPGVPGPGAAAGAVFRSELNPVDFLHRAAYIYPDNVAVVHGKRR |
| Ga0070730_109019531 | 3300005537 | Surface Soil | MSGSSAAAAGTGVVPGQVFRSELNPVDFLQRAAYIYPDK |
| Ga0066694_104119382 | 3300005574 | Soil | MTGVSPAVPGVPAGEAAPGKVFRSELNPVDFLHRAAYLYPDK |
| Ga0068857_1015863522 | 3300005577 | Corn Rhizosphere | MSGAIPAALGAEAVPGKVFRSELNPVDFLHRAAYMYPEKVAVVH |
| Ga0075017_1008624282 | 3300006059 | Watersheds | MSDVLSATPGVPGPGAVPGKVFRSELNPVDFLRRAAYM |
| Ga0070716_1002760392 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MSSAVSEGPGGPGPGAAAGTVFRSELNPVDFLYRAAYLYPDKV |
| Ga0070712_1015960301 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MGDVFSAATGAPGAVPGQVFRSELNPVDFLHRAAYIYPD |
| Ga0074053_120002671 | 3300006575 | Soil | MSSALSEGPGGPGPGAAAGTVFRSELNPVDFLYRAAYLY |
| Ga0074064_118139571 | 3300006603 | Soil | MSGAPPGHPGGPGPGAAAGTVFRSELNPVDFLYRAAYLYPDKVAVAAGKRRY |
| Ga0074062_129156811 | 3300006606 | Soil | MSGAPPEHPGGPGPGAEAGTVFRSELNPVDFLYRAA |
| Ga0075425_1026236502 | 3300006854 | Populus Rhizosphere | MSSALSEGPGRPGPGAAAGTVFRSELNPVDFLYRAAYLYPDK |
| Ga0075424_1013339541 | 3300006904 | Populus Rhizosphere | MSSALSEGPGGPGPGAAAGTVFRSELNPVDFLYRAAYLYPDK |
| Ga0079219_111416681 | 3300006954 | Agricultural Soil | MSEAASEHPGGPGPGAAAGTVFRSELNPVDFLYRAAYLYPDKVAVV |
| Ga0079219_114906781 | 3300006954 | Agricultural Soil | MSGVLSESPGAPGPGAAAGTVFRSELNPVDFLRRAAYIYPEK |
| Ga0099794_107589082 | 3300007265 | Vadose Zone Soil | MSGALSGNPGGPGPGAAAGTVFRSELNPVDFLHRAAYIG* |
| Ga0105245_117702951 | 3300009098 | Miscanthus Rhizosphere | MMSSALSEGPGRPGPGAAAGTVFRSELNPVDFLYRAAYLYPDKVAVAA |
| Ga0116214_14329911 | 3300009520 | Peatlands Soil | MMSGALSATPDAPGPGAVAGKVFRSELNPVGFLDRAAYI |
| Ga0116222_12755422 | 3300009521 | Peatlands Soil | MMSGVLSAAPGVPGPEAVAGKVFRSELNPVDFLDRAAY |
| Ga0116216_108052641 | 3300009698 | Peatlands Soil | MMSGALSAPPGVPGPGVVAGKVFRSELNPVGFLDRAAYIYPGKVAVVDGDR |
| Ga0116217_106504592 | 3300009700 | Peatlands Soil | MSGMFSATPGAPGPEAVPGKVFRSELNPVDFLRRAAYMYPAKVAVVDG |
| Ga0126380_122945891 | 3300010043 | Tropical Forest Soil | MGDVLSAATGAPGAVSGSVFRSELNPVDFLHRAAYIYPDKTAVVSG |
| Ga0126373_112749361 | 3300010048 | Tropical Forest Soil | MGDVLSAATGTPGAVSGKVFRSELNPVEFLHRAAYIYPDKTA |
| Ga0126318_102366681 | 3300010152 | Soil | MSGALSQSPGVPGPGAAAGAVFRSELNPVDFLRRAAYIYPEKVAVVDGGR |
| Ga0126370_100745773 | 3300010358 | Tropical Forest Soil | MGDVLSAATSTPGAVSGKVFRSELNPVEFLHRAAYIYPDK |
| Ga0126372_121390582 | 3300010360 | Tropical Forest Soil | MGDVLSVAAGAPGAVSGSVFRSELNPVDFLHRAAYIY |
| Ga0136449_1002230885 | 3300010379 | Peatlands Soil | MMSGALSATPDAPGPGAVAGKVFRSELNPVDFLDRAAYIYPEKVAVVD |
| Ga0136449_1015064491 | 3300010379 | Peatlands Soil | MMSGALSAPPGVPGPGVVAGKVFRSELNPVGFLDRAAYIYPGKVAVVDGDRRLRYRE |
| Ga0136449_1020312961 | 3300010379 | Peatlands Soil | MSDVLSATPGVPGPEAVPGKVFRSELNPVDFLRRAAYM |
| Ga0136449_1028902371 | 3300010379 | Peatlands Soil | MMSGVLSATPGVPGPEAVAGKVFRSELNPVDFLDRA |
| Ga0136449_1030381552 | 3300010379 | Peatlands Soil | MSGALAEVPGPGAVPGRVFRSELNPVDFLHRAAYIYPDKIAVVDGGRRY |
| Ga0134124_105495812 | 3300010397 | Terrestrial Soil | MMSSALSEGPGRPGPGAAAGTVFRSELNPVDFLYRAAY |
| Ga0134121_115391801 | 3300010401 | Terrestrial Soil | MSSALSEGPGRPGPGAAAGTVFRSELNPVDFLYRAAYLYPDKV |
| Ga0126356_101066532 | 3300010877 | Boreal Forest Soil | MMSGALSEDPGRPGPGAAAGTVFRSELNPVDFLYRAAYLYPDKVAVAAG |
| Ga0137391_110322171 | 3300011270 | Vadose Zone Soil | MSEAPLGTPGVPGPGAGAGTVFRSELNPVDFLHRAAYMYP |
| Ga0137374_106843501 | 3300012204 | Vadose Zone Soil | MSGVFSAPPGVPAGGTVPGKVFRSELNPVDFLHRAAYLYPDKV |
| Ga0157354_10076521 | 3300012517 | Unplanted Soil | RRHAMSEAPSEHPGGPEPGAAAGTVFRSELNPVDFLYRAAYL* |
| Ga0134087_106620021 | 3300012977 | Grasslands Soil | MSGAPPEHPGGPRPGAAAGTVFRSELNPVDFLYRAAYL |
| Ga0157375_127301272 | 3300013308 | Miscanthus Rhizosphere | MSSALSEGPGRPGPGAAAGTVFRSELNPVDFLYRA |
| Ga0182041_101703441 | 3300016294 | Soil | MGDVLSAATGASGAVSGKVFRSELNPVDFLHRAAYIYPDKTAVV |
| Ga0182033_116012911 | 3300016319 | Soil | MGDVLSAATGASGAVSGKVFRSELNPVDFLHRAAYI |
| Ga0182033_120383632 | 3300016319 | Soil | MSEALSPNPGGHGAGAGAGTVFRSELNPVDFLHRAAYLYPDKVAVV |
| Ga0182035_119089212 | 3300016341 | Soil | MGDVFSAATGVPGRVFRSELNPVDFLYRAAYIYPDKTAVVSG |
| Ga0182040_119394891 | 3300016387 | Soil | MSGVLSEAPGVPGSGAVPGQVFRSELNPVDFLHRAAYIYPEQ |
| Ga0182037_106768293 | 3300016404 | Soil | VTSTYSEIPGVPGAAAASGKVFRSELNPVDFLHRAAYI |
| Ga0187802_101195342 | 3300017822 | Freshwater Sediment | MSALSGAPGTGTVPGQVFRSELNPVDFLHRAAYIYPD |
| Ga0187807_10176182 | 3300017926 | Freshwater Sediment | MSGALSESPGRPGPEAGAGTVFRPELNPVDFLYRAA |
| Ga0187807_13233212 | 3300017926 | Freshwater Sediment | MSGDFAAVPGVTADEAAPAKVFRSELNPVEFLHRAAYL |
| Ga0187817_100140082 | 3300017955 | Freshwater Sediment | MSGALSESPGRPGPEAGAGTVFRPELNPVGFLYRAA |
| Ga0187817_100801285 | 3300017955 | Freshwater Sediment | MSDVLSATPGVPGPEAVPGKVFRSELNPVDFLRRAAYMYPEKV |
| Ga0187779_101932012 | 3300017959 | Tropical Peatland | MVTSSYSEIPGVPGAEAASAQVFRSELNPVDFLSRAA |
| Ga0187780_109868892 | 3300017973 | Tropical Peatland | MSSALSEASGVPGTGAVAETVFRSELNPVDFLHRAAYI |
| Ga0187782_103273444 | 3300017975 | Tropical Peatland | MSGVLSQAPGGPGPQAVPGQVFRSELNPVDFLYRAAYIYP |
| Ga0187822_103201731 | 3300017994 | Freshwater Sediment | QAMSGALSESPGRPGPEAGAGTVFRPELNPVDFLYRAA |
| Ga0187887_108624472 | 3300018043 | Peatland | MSGVLSAAPGVPGPEAAAGKVYRSEQNPVDFLDRAAY |
| Ga0187766_112782811 | 3300018058 | Tropical Peatland | MISTYSARPDAAATETAVGKVFRSELNPVDFLHRAAYMYPDKIAVVDRERRYSYRQL |
| Ga0187773_104904951 | 3300018064 | Tropical Peatland | MSEALVGTAGGLAPGAGAGTVFRSELNPVDFLHRAAYMY |
| Ga0187771_111827161 | 3300018088 | Tropical Peatland | MSGVLSEAFGVPGPEAVPGKVFRSELNPVDFLHRSAYIYPDK |
| Ga0193730_11403261 | 3300020002 | Soil | MTSALSPNPGGPGAGAGAGTVFRSELNPVEFLNRAAYMYPD |
| Ga0206353_115400891 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | MSGAISAAPGAEAVPGKVFRSELNPVDFLHRAAYMYPE |
| Ga0210396_105400423 | 3300021180 | Soil | MSGATLETSGMPGPGAAAGKVFRTELNPVDFLYRAAYIYPEKIAVVDGERRY |
| Ga0210396_116744922 | 3300021180 | Soil | MSGATLETSGVPGPGAAAGKVFRTELNPVDFLYRAAYIYPEKIAVVDGERRY |
| Ga0210383_100205508 | 3300021407 | Soil | MSGALSEDPGRPRLGAAARTVFRSELNPVDFLYRAAYLYPDKVAATGWQA |
| Ga0210398_113929891 | 3300021477 | Soil | MSGVLSAAQGVPGPETATGKADKVFRSEQNPVDFLNRAA |
| Ga0210402_109799381 | 3300021478 | Soil | MSEALSPNPGGPGPDAGAGTVSRSELNPVDFLHRAAYV |
| Ga0210402_119539451 | 3300021478 | Soil | MSEALSPNPGGPGAGTGAGTAFRSELNPVDFLYRAAYL |
| Ga0247661_10624442 | 3300024254 | Soil | MSSALSEGPGRPGPGAAAGTVFRSELNPVDFLYRAAYVY |
| Ga0207692_109717962 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDAFSETPDGPGAGAGAGTVFRSELNPVDFLYRAAYLYPDKVAVA |
| Ga0207647_107324922 | 3300025904 | Corn Rhizosphere | MSGAIPAALGAEAVPGKVFRSELNPVDFLHRAAYMYPEKIAV |
| Ga0207663_102275673 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MGDMLPAATGVPGTVPGKVFRSELNPVDFLHRAAYIYPDKTAVVSAD |
| Ga0207681_107880731 | 3300025923 | Switchgrass Rhizosphere | MSDALSKGPGRPGSGAAAGTVFRSELNPVDFLYRAAYLY |
| Ga0207664_100543891 | 3300025929 | Agricultural Soil | MSEALAGTPGVPGPGTGAGTVFRSELNPVDFLNRAAYMYP |
| Ga0207664_106915362 | 3300025929 | Agricultural Soil | MSGAIPAALGAEAVPGKVFRSELNPVDFLHRAAYMYPE |
| Ga0207709_105715862 | 3300025935 | Miscanthus Rhizosphere | MSSALSEGPGRPGPGAAAGTVFRSELNPVDFLYRAAYLYPDNVAVAAGK |
| Ga0208199_10560341 | 3300027497 | Peatlands Soil | MSGVLSATPGVPGPEAVAGKVFRSELNPVDFLDRAA |
| Ga0208324_11873222 | 3300027604 | Peatlands Soil | MSEAPSGTPGVPGPGPGAGTVFRSELNPVDFLHRAAYMYPDKVAVVYG |
| Ga0209530_10929962 | 3300027692 | Forest Soil | MSGALSATPDVPGPEAVAGQVFRSELNPVGFLDRAAYI |
| Ga0207862_10834681 | 3300027703 | Tropical Forest Soil | MVTSTYSEIPGRSGVGEASGQVFRSELNPVDFLHRAAYIYPDKAAVVDGERR |
| Ga0209039_103286831 | 3300027825 | Bog Forest Soil | MSDVLSATPGVPGPEAVPGKVFRSELNPVDFLRRAAYMY |
| Ga0209415_106207632 | 3300027905 | Peatlands Soil | MSGVLSAAPGVPGPEAVAGKVFRSELNPVDFLDRAAYIYPEKVAVVDGDRRLR |
| Ga0209698_104202321 | 3300027911 | Watersheds | MSVFSAIPGAAGTGAVPEKVFRSELNPVDFLYRAAYVY |
| Ga0307309_102030811 | 3300028714 | Soil | MSGAPPEYPGGPGPGAAAGTVFRSELNPVDFLYRAA |
| Ga0307280_100184952 | 3300028768 | Soil | MSGAPPEYPGGPGPGAAAGTVFRSELNPVDFLYRAAYLYPD |
| Ga0307312_101541231 | 3300028828 | Soil | MSGAPPEYPGGPGPGAAAGTVFRSELNPVDFLYRAAYLYPDKVGVAAGKRR |
| Ga0311370_102078041 | 3300030503 | Palsa | MSGVLSAAPGGPGPETAAGKADKVFRSEQNPVDFL |
| Ga0265760_102815571 | 3300031090 | Soil | MSGVASAAAGGPGPGVAAGKVFRSELNPVDFLVRAAFVYPEKVAV |
| Ga0318516_102857672 | 3300031543 | Soil | MSGVLSAAPEPSAAGAVPGKVFRSELNPVDFLDRAAYIYPDKTA |
| Ga0318516_103777031 | 3300031543 | Soil | MNDALSPNPGGPGAGAVAGTVFRSELNPVDFLHRASYMYPD |
| Ga0318516_108674762 | 3300031543 | Soil | MSEALLRPAGEPGPGAEAGTVFRSELNPVDFLHRAAYMYPDKVA |
| Ga0318538_100763521 | 3300031546 | Soil | MGDVLSAATDASEAVSAKVFRSELNPVDFLHRAAYIYPD |
| Ga0318515_100122675 | 3300031572 | Soil | MGDVLSAATGASGAVSGKVFRSELNPVDFLHRAAYIYPDKTAVVSG |
| Ga0310915_105470792 | 3300031573 | Soil | MSEALSPDPGRPGPGAGAGTVFRSELNPVDFLHRAAY |
| Ga0310686_1122524711 | 3300031708 | Soil | MSGDFAAVPGVTADGAAPAKVFRSELNPVEFLHRAAYLYPVKVAVVDGGRRYRYRDLAERSWR |
| Ga0318496_102281301 | 3300031713 | Soil | MGDVLSAATGASGAVSGKVFRSELNPVDFLHRAAYIYPDKTAVVSGHR |
| Ga0318496_103904351 | 3300031713 | Soil | MSGVLSEAPGAPGSGTVPGQVSRSELNPVDFLHRAAYIYPEQVAVVD |
| Ga0318493_106538081 | 3300031723 | Soil | MGDVFSAAAGVPGQVYRSELNPVDFLHRAAYIYPDR |
| Ga0318500_103073881 | 3300031724 | Soil | MGDVLSAATDASEAVSAKVFRSELNPVDFLHRAAYI |
| Ga0318501_105350872 | 3300031736 | Soil | MGDVLSAATDASGAVPGKVFRSELNPVDFLHRAAYI |
| Ga0318501_106161751 | 3300031736 | Soil | MSGVLSEAPGVPGSEAVPGKVFRSELNPVDFLHRAAYIY |
| Ga0318502_103571111 | 3300031747 | Soil | MGDVLSAATGASGAVSGKVFRSELNPVDFLHRAAYIYPDKTA |
| Ga0318494_108487682 | 3300031751 | Soil | MGDVFSAAAGVPGQVYRSELNPVDFLHRAAYIYPDRTAV |
| Ga0318535_101350441 | 3300031764 | Soil | MGDVLSAATDASEAVSAKVFRSELNPVDFLHRAAYIYPDKTAVV |
| Ga0318509_107043071 | 3300031768 | Soil | MSEALSPNPGGHGADAGAGTVFRSELNPVDFLHRAAYLYPDKV |
| Ga0318566_100453362 | 3300031779 | Soil | MNDALSPNPGGPGAGAVAGTVFRSELNPVDFLHRASY |
| Ga0318547_101069004 | 3300031781 | Soil | MSGVLSAAPEPSAAGAVPGKVFRSELNPVDFLDRAAYIY |
| Ga0318497_102951852 | 3300031805 | Soil | MGDVLSAATGASGAVSGKVFRSELNPVDFLHRAAYIYPDKTAV |
| Ga0318499_103744452 | 3300031832 | Soil | MSEALSPNPGGPGAGAGAGTAFRSELNPVDFLYRAAYLYPDK |
| Ga0306925_122384772 | 3300031890 | Soil | MTDVLSAAPEPPGAGAVPGKVFRSELNPVDFLERAA |
| Ga0318536_105215401 | 3300031893 | Soil | MSGVLSAAPEPSAAGAVPGKVFRSELNPVDFLDRAAYIYPDK |
| Ga0318522_101148692 | 3300031894 | Soil | MGDVLSAATGASGAVSGKVFRSELNPVDFLHRAAY |
| Ga0318551_100849451 | 3300031896 | Soil | MGDVLSAATGASGAVSGKVFRSELNPVDFLHRAAYIYPDKTAVVS |
| Ga0318520_104843012 | 3300031897 | Soil | MSGVLSEAPGVPGSEAVPGKVFRSELNPVDFLHRAAYIYPDQV |
| Ga0310916_105113962 | 3300031942 | Soil | VTSTYSEIPGVPGAAAASGKVFRSELNPVDFLHRAAYIYPDKIA |
| Ga0310910_114646302 | 3300031946 | Soil | MGDVLSAATGASGAVSGKVFRSELNPVDFLHRAAYIYPDK |
| Ga0318530_102997951 | 3300031959 | Soil | MSGVLSAAPEPSAAGAVPGKVFRSELNPVDFLDRAAYI |
| Ga0318563_105922652 | 3300032009 | Soil | MSEALSPNPGGHGAGAGTGTVFRSELNPVDFLHRAAYLYPDKVAVVH |
| Ga0318569_101664482 | 3300032010 | Soil | MSEALSPDPGRPGPGAGAGTVFRSELNPVDFLHRAAYMYPDNVAVVHGKRRY |
| Ga0318569_104210181 | 3300032010 | Soil | MSVFSATPGTAGTGVVPAKVFRSEMNPVDFLHRAAYVYPDKVAVVDS |
| Ga0318507_102138252 | 3300032025 | Soil | MNDALSPNPGGPGAGAVAGTVFRSELNPVDFLHRASYMYPDKVAVA |
| Ga0310911_101749751 | 3300032035 | Soil | MSEALSPDPGRPGPGAGAGTVFRSELNPVDILHRAAYMYPDN |
| Ga0318559_104045332 | 3300032039 | Soil | MNDALSPNPGGPGAGAVAGTVFRSELNPVDFLHRASYM |
| Ga0318545_103331482 | 3300032042 | Soil | VSTVSASPDTADAEPVPGKVFRSELNPVDFLHRAAYMYPDK |
| Ga0306924_120355051 | 3300032076 | Soil | MSVFSATPSAGGTGVVPDKVFRSELNPVDFLYRAAYVYPDKAAVV |
| Ga0306924_120891061 | 3300032076 | Soil | MSGVLSEAPGVPGSEAVPGKVFRSELNPVDFLHRAAYIYPD |
| Ga0318525_103052691 | 3300032089 | Soil | MGDVLSAATGASGAVSGKVFRSELNPVDFLHRAAYIYPD |
| Ga0318577_101685351 | 3300032091 | Soil | MSEALSPDPGRPGPGAGAGTVFRSELNPVDFLHRAAYMYPDNVAVVHGTRRYSY |
| Ga0311301_102340751 | 3300032160 | Peatlands Soil | MSGALSATPDAPGPGAVAGKVFRSELNPVDFLDRAAYIYPEKVAVVD |
| Ga0311301_112147061 | 3300032160 | Peatlands Soil | MSGALSAPPGVPGPGVVAGKVFRSELNPVGFLDRAAYIYPGKVAVVDGDRRLRYREL |
| Ga0335069_118979652 | 3300032893 | Soil | MSGVLSESPGVPGPGAAAGTVFRSELNPVDFLHRAAYIYPEKVAVVDGGRRYT |
| Ga0335083_104854152 | 3300032954 | Soil | MSEALSPNPGRPGPDAGAGTVSRSELNPVDFLHRAAYMYPDKV |
| Ga0335076_114864761 | 3300032955 | Soil | MSSALSEGPGRPGPGAAAGTVFRSELNPVDFLYRAAYLYPDKVA |
| Ga0318519_104906252 | 3300033290 | Soil | MSEALLRTAGEPGPGGGAGTVFRSELNPVDFLYRAAYM |
| ⦗Top⦘ |