| Basic Information | |
|---|---|
| Family ID | F055983 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 138 |
| Average Sequence Length | 45 residues |
| Representative Sequence | STWRLDSDGLLLTGRGGSWRFSESDATTWERIPASSDPLVLMRQ |
| Number of Associated Samples | 126 |
| Number of Associated Scaffolds | 138 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.72 % |
| % of genes near scaffold ends (potentially truncated) | 97.83 % |
| % of genes from short scaffolds (< 2000 bps) | 93.48 % |
| Associated GOLD sequencing projects | 117 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.377 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (11.594 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.464 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.029 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 30.56% Coil/Unstructured: 69.44% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 138 Family Scaffolds |
|---|---|---|
| PF03972 | MmgE_PrpD | 18.12 |
| PF08450 | SGL | 10.14 |
| PF12697 | Abhydrolase_6 | 10.14 |
| PF01875 | Memo | 7.25 |
| PF02617 | ClpS | 2.90 |
| PF02771 | Acyl-CoA_dh_N | 2.17 |
| PF04909 | Amidohydro_2 | 2.17 |
| PF01042 | Ribonuc_L-PSP | 1.45 |
| PF14015 | DUF4231 | 0.72 |
| PF04828 | GFA | 0.72 |
| PF08448 | PAS_4 | 0.72 |
| PF01909 | NTP_transf_2 | 0.72 |
| PF02826 | 2-Hacid_dh_C | 0.72 |
| PF04191 | PEMT | 0.72 |
| PF07978 | NIPSNAP | 0.72 |
| PF10605 | 3HBOH | 0.72 |
| PF01575 | MaoC_dehydratas | 0.72 |
| PF06983 | 3-dmu-9_3-mt | 0.72 |
| PF01546 | Peptidase_M20 | 0.72 |
| PF13592 | HTH_33 | 0.72 |
| PF13426 | PAS_9 | 0.72 |
| PF00496 | SBP_bac_5 | 0.72 |
| PF02627 | CMD | 0.72 |
| PF00989 | PAS | 0.72 |
| PF03401 | TctC | 0.72 |
| COG ID | Name | Functional Category | % Frequency in 138 Family Scaffolds |
|---|---|---|---|
| COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 18.12 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 10.14 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 10.14 |
| COG1355 | Predicted class III extradiol dioxygenase, MEMO1 family | General function prediction only [R] | 7.25 |
| COG2127 | ATP-dependent Clp protease adapter protein ClpS | Posttranslational modification, protein turnover, chaperones [O] | 2.90 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 2.17 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 1.45 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.72 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.72 |
| COG2764 | Zn-dependent glyoxalase, PhnB family | Energy production and conversion [C] | 0.72 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.72 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.72 |
| COG3865 | Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase | General function prediction only [R] | 0.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.38 % |
| Unclassified | root | N/A | 3.62 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000597|AF_2010_repII_A1DRAFT_10160468 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 538 | Open in IMG/M |
| 3300000955|JGI1027J12803_109283542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium nodulans | 1856 | Open in IMG/M |
| 3300001661|JGI12053J15887_10076572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1847 | Open in IMG/M |
| 3300001976|JGI24752J21851_1027495 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 747 | Open in IMG/M |
| 3300003911|JGI25405J52794_10017632 | All Organisms → cellular organisms → Bacteria | 1420 | Open in IMG/M |
| 3300004157|Ga0062590_101354711 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 705 | Open in IMG/M |
| 3300005294|Ga0065705_11050715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 534 | Open in IMG/M |
| 3300005332|Ga0066388_101938959 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1053 | Open in IMG/M |
| 3300005332|Ga0066388_103756278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 775 | Open in IMG/M |
| 3300005332|Ga0066388_106324194 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 597 | Open in IMG/M |
| 3300005366|Ga0070659_101939732 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 528 | Open in IMG/M |
| 3300005440|Ga0070705_101736163 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 528 | Open in IMG/M |
| 3300005455|Ga0070663_100055155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2843 | Open in IMG/M |
| 3300005471|Ga0070698_102011662 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 531 | Open in IMG/M |
| 3300005536|Ga0070697_100725086 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 878 | Open in IMG/M |
| 3300005560|Ga0066670_10111554 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1548 | Open in IMG/M |
| 3300005578|Ga0068854_100727367 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 859 | Open in IMG/M |
| 3300005713|Ga0066905_100672259 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300005764|Ga0066903_103088114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 901 | Open in IMG/M |
| 3300005764|Ga0066903_106264891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 621 | Open in IMG/M |
| 3300005764|Ga0066903_106694720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 599 | Open in IMG/M |
| 3300005841|Ga0068863_100270865 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1643 | Open in IMG/M |
| 3300005981|Ga0081538_10047236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2643 | Open in IMG/M |
| 3300006050|Ga0075028_100872052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 553 | Open in IMG/M |
| 3300006173|Ga0070716_100839170 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 714 | Open in IMG/M |
| 3300006175|Ga0070712_101512027 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 587 | Open in IMG/M |
| 3300006177|Ga0075362_10733565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 517 | Open in IMG/M |
| 3300006606|Ga0074062_12824542 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 732 | Open in IMG/M |
| 3300006806|Ga0079220_11733305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 547 | Open in IMG/M |
| 3300006844|Ga0075428_101793634 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 639 | Open in IMG/M |
| 3300006845|Ga0075421_102532080 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 534 | Open in IMG/M |
| 3300006846|Ga0075430_100285296 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1366 | Open in IMG/M |
| 3300006854|Ga0075425_101050202 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300006880|Ga0075429_100136624 | All Organisms → cellular organisms → Bacteria | 2145 | Open in IMG/M |
| 3300006880|Ga0075429_101860214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 522 | Open in IMG/M |
| 3300006903|Ga0075426_10511033 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300006904|Ga0075424_102371950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 557 | Open in IMG/M |
| 3300006969|Ga0075419_10126463 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1658 | Open in IMG/M |
| 3300007076|Ga0075435_100490522 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
| 3300009088|Ga0099830_11185483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 634 | Open in IMG/M |
| 3300009094|Ga0111539_10084989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 3720 | Open in IMG/M |
| 3300009098|Ga0105245_10411422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1354 | Open in IMG/M |
| 3300009100|Ga0075418_12579812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 555 | Open in IMG/M |
| 3300010043|Ga0126380_11966864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 534 | Open in IMG/M |
| 3300010046|Ga0126384_12288875 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300010047|Ga0126382_10627974 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 889 | Open in IMG/M |
| 3300010047|Ga0126382_11464149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 626 | Open in IMG/M |
| 3300010359|Ga0126376_11093872 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300010360|Ga0126372_10460148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1182 | Open in IMG/M |
| 3300010361|Ga0126378_13150741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 525 | Open in IMG/M |
| 3300010366|Ga0126379_11316591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 829 | Open in IMG/M |
| 3300010398|Ga0126383_10681701 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1105 | Open in IMG/M |
| 3300010398|Ga0126383_12469870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 604 | Open in IMG/M |
| 3300011003|Ga0138514_100037573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 941 | Open in IMG/M |
| 3300011270|Ga0137391_11204638 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300012189|Ga0137388_10788332 | Not Available | 881 | Open in IMG/M |
| 3300012205|Ga0137362_10364845 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1251 | Open in IMG/M |
| 3300012285|Ga0137370_10041536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2436 | Open in IMG/M |
| 3300012357|Ga0137384_10087488 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2592 | Open in IMG/M |
| 3300012357|Ga0137384_10704125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 820 | Open in IMG/M |
| 3300012357|Ga0137384_11396467 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300012363|Ga0137390_11177795 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 714 | Open in IMG/M |
| 3300012906|Ga0157295_10216836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 620 | Open in IMG/M |
| 3300012911|Ga0157301_10262549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 613 | Open in IMG/M |
| 3300012915|Ga0157302_10550206 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300012948|Ga0126375_12094772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 502 | Open in IMG/M |
| 3300012971|Ga0126369_13089349 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300012976|Ga0134076_10405768 | Not Available | 608 | Open in IMG/M |
| 3300012977|Ga0134087_10396132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 671 | Open in IMG/M |
| 3300012985|Ga0164308_12215891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 511 | Open in IMG/M |
| 3300012989|Ga0164305_10577249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 899 | Open in IMG/M |
| 3300014260|Ga0075307_1105389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 592 | Open in IMG/M |
| 3300014326|Ga0157380_11331025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 767 | Open in IMG/M |
| 3300015371|Ga0132258_13842547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1022 | Open in IMG/M |
| 3300015372|Ga0132256_103491737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 528 | Open in IMG/M |
| 3300015373|Ga0132257_100194744 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2398 | Open in IMG/M |
| 3300016341|Ga0182035_11516388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 603 | Open in IMG/M |
| 3300016387|Ga0182040_10433188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1038 | Open in IMG/M |
| 3300016404|Ga0182037_10510415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1009 | Open in IMG/M |
| 3300016445|Ga0182038_11256312 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300017974|Ga0187777_10494280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 854 | Open in IMG/M |
| 3300017997|Ga0184610_1071473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1061 | Open in IMG/M |
| 3300018031|Ga0184634_10475292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 561 | Open in IMG/M |
| 3300018055|Ga0184616_10229836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 700 | Open in IMG/M |
| 3300018429|Ga0190272_11984701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 615 | Open in IMG/M |
| 3300018433|Ga0066667_10874735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 771 | Open in IMG/M |
| 3300018465|Ga0190269_11147326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 605 | Open in IMG/M |
| 3300018469|Ga0190270_13084721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 527 | Open in IMG/M |
| 3300018481|Ga0190271_11994365 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300021560|Ga0126371_10861767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1051 | Open in IMG/M |
| 3300022756|Ga0222622_10737549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 717 | Open in IMG/M |
| 3300025906|Ga0207699_10058226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2310 | Open in IMG/M |
| 3300025927|Ga0207687_10745705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 833 | Open in IMG/M |
| 3300025928|Ga0207700_10148901 | All Organisms → cellular organisms → Bacteria | 1932 | Open in IMG/M |
| 3300025929|Ga0207664_11334137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 637 | Open in IMG/M |
| 3300025932|Ga0207690_11330622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 600 | Open in IMG/M |
| 3300025935|Ga0207709_11451989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 568 | Open in IMG/M |
| 3300025939|Ga0207665_10356596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1105 | Open in IMG/M |
| 3300025961|Ga0207712_11263609 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300025981|Ga0207640_10500327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium | 1012 | Open in IMG/M |
| 3300026304|Ga0209240_1053383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1520 | Open in IMG/M |
| 3300026494|Ga0257159_1028289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 930 | Open in IMG/M |
| 3300026540|Ga0209376_1350133 | Not Available | 558 | Open in IMG/M |
| 3300027035|Ga0207776_1033948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 639 | Open in IMG/M |
| 3300027383|Ga0209213_1060045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 713 | Open in IMG/M |
| 3300027880|Ga0209481_10027021 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2576 | Open in IMG/M |
| 3300027894|Ga0209068_10733181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 580 | Open in IMG/M |
| 3300028536|Ga0137415_10922438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 683 | Open in IMG/M |
| 3300028714|Ga0307309_10011828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1582 | Open in IMG/M |
| 3300028715|Ga0307313_10062727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1102 | Open in IMG/M |
| 3300028768|Ga0307280_10040941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1421 | Open in IMG/M |
| 3300028787|Ga0307323_10188720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 744 | Open in IMG/M |
| 3300028787|Ga0307323_10207301 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300028799|Ga0307284_10222737 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300028809|Ga0247824_10932449 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300028828|Ga0307312_10288802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium | 1067 | Open in IMG/M |
| 3300031640|Ga0318555_10314639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 847 | Open in IMG/M |
| 3300031679|Ga0318561_10818888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 512 | Open in IMG/M |
| 3300031681|Ga0318572_10694943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 606 | Open in IMG/M |
| 3300031724|Ga0318500_10500920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 610 | Open in IMG/M |
| 3300031771|Ga0318546_10129243 | All Organisms → cellular organisms → Bacteria | 1686 | Open in IMG/M |
| 3300031777|Ga0318543_10243005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 802 | Open in IMG/M |
| 3300031779|Ga0318566_10605418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 533 | Open in IMG/M |
| 3300031793|Ga0318548_10277028 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300031796|Ga0318576_10064332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1618 | Open in IMG/M |
| 3300031797|Ga0318550_10535204 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300031890|Ga0306925_10480841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1324 | Open in IMG/M |
| 3300031890|Ga0306925_10757489 | Not Available | 1011 | Open in IMG/M |
| 3300031897|Ga0318520_10429630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 810 | Open in IMG/M |
| 3300031910|Ga0306923_10848776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1004 | Open in IMG/M |
| 3300031944|Ga0310884_10464463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 738 | Open in IMG/M |
| 3300031954|Ga0306926_12719264 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300031959|Ga0318530_10038233 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1758 | Open in IMG/M |
| 3300032044|Ga0318558_10129655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1202 | Open in IMG/M |
| 3300032055|Ga0318575_10426659 | Not Available | 673 | Open in IMG/M |
| 3300032055|Ga0318575_10489010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 625 | Open in IMG/M |
| 3300032179|Ga0310889_10736503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 517 | Open in IMG/M |
| 3300032261|Ga0306920_100823647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1361 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.59% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.42% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 9.42% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.25% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.52% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.80% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.80% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.17% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.17% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.17% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.45% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.45% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.45% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.45% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.45% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.45% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.72% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.72% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.72% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.72% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.72% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.72% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.72% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.72% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.72% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.72% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Host-Associated | Open in IMG/M |
| 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006177 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Host-Associated | Open in IMG/M |
| 3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014260 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D1_rd | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018055 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_coex | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026494 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-A | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300027035 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027383 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028714 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196 | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AF_2010_repII_A1DRAFT_101604681 | 3300000597 | Forest Soil | ASVTDIGLSTWRLDSDGLLLSGRGGSWRFSESDATTWERIPATSDPLVLMRQ* |
| JGI1027J12803_1092835424 | 3300000955 | Soil | VADVELSTWRLDRDGLLLTGRGGSWRFSESDATTWERIPASSDPLVLMRQ* |
| JGI12053J15887_100765721 | 3300001661 | Forest Soil | DRDELVLAGPGGAWRFAESDTTTWERIPPSTDPLLLMRQ* |
| JGI24752J21851_10274951 | 3300001976 | Corn, Switchgrass And Miscanthus Rhizosphere | ASVAGLGLSTWRLDPDGLLLSGSGGTWRFSESDPTTWERIPASTDPLVLMRQ* |
| JGI25405J52794_100176321 | 3300003911 | Tabebuia Heterophylla Rhizosphere | GLTTWRLDPDGLLLSGNGGRWRFSESDATSWERIPASTDPMVLMRQ* |
| Ga0062590_1013547112 | 3300004157 | Soil | GLGLSTWRLDPDGLLLSGSGGTWRFSESDPTTWERIPASTDPLVLMRE* |
| Ga0065705_110507152 | 3300005294 | Switchgrass Rhizosphere | TFNPSTWRLDRDQLILTGRNGSWRFSESDATVWERVPLTVDPMLLVRQ* |
| Ga0066388_1019389591 | 3300005332 | Tropical Forest Soil | PGCDPSVADVELSTWQLDSEGLLLTGRGGSWRFSESDATTWERIPASADPLVLMRQ* |
| Ga0066388_1037562781 | 3300005332 | Tropical Forest Soil | WRIEINELVLVGPGGSWRFAESNDTTWERIPPSADPMVLLRQ* |
| Ga0066388_1063241941 | 3300005332 | Tropical Forest Soil | PGCDPSVADVELSTWQLDSEGLLLTGRGGSWRFSESDATSWERIPASADPLVLMRQ* |
| Ga0070659_1019397322 | 3300005366 | Corn Rhizosphere | WRLDPDGLLLSGSGGTWRFSESDPTTWERIPASTDPLVLMRE* |
| Ga0070705_1017361631 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | GCDASVADVELSTWRLDRDGLLLTGRGGSWRFSESDATTWERIPASSDPLVLMRQ* |
| Ga0070663_1000551554 | 3300005455 | Corn Rhizosphere | SVAGLGLSTWRLDPDGLLLSGSGGTWRFSESDPTTWERIPASTDPLVLMRQ* |
| Ga0070698_1020116621 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | DVELSTWRLDRDGLLLTGRGGSWRFSESDATTWERIPASADPLVLMRQ* |
| Ga0070697_1007250862 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | STWRLDSDGLLLTGRGGSWRFSESDATTWERIPASSDPLVLMRQ* |
| Ga0066670_101115541 | 3300005560 | Soil | TWQLDSEGLLLTGRGGSWRFSESDATSWERIPASADPLVLMRQ* |
| Ga0068854_1007273672 | 3300005578 | Corn Rhizosphere | DPDGLLLSGSGGTWRFSESDPTTWERIPASTDPLVLMRE* |
| Ga0066905_1006722591 | 3300005713 | Tropical Forest Soil | DGLLLSGRGGSWRFSESDATTWERIPATSDPLVLMRQ* |
| Ga0066903_1030881142 | 3300005764 | Tropical Forest Soil | TWRIDSNELLLVGRGSTWRFSESDSTTWERIPPSSDPMVLMRQ* |
| Ga0066903_1062648911 | 3300005764 | Tropical Forest Soil | LLLTGRGGSWRFSESDATTWERIPATSDPLVLMRQ* |
| Ga0066903_1066947202 | 3300005764 | Tropical Forest Soil | DSDGLLLTGRGGSWRFSESDATTWERIPATSDPLVLMRQ* |
| Ga0068863_1002708653 | 3300005841 | Switchgrass Rhizosphere | LDPDGLLLSGSGGTWRFSESDPTTWERIPASTDPLVLMRQ* |
| Ga0081538_100472361 | 3300005981 | Tabebuia Heterophylla Rhizosphere | DGLLLSGNGGRWRFSESDATSWERIPASTDPMVLMRQ* |
| Ga0075028_1008720521 | 3300006050 | Watersheds | AAAINGLGLTAWRLEMNDLLLVGRGATWRFSESDATVWERIPPSTDPMLLMRQ* |
| Ga0070716_1008391701 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | DIGLSTWRLDSDGLLLSGRGGSWRFSESDATTWERIPATSDPLVLMRQ* |
| Ga0070712_1015120272 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | DSDGLLLTGRGGSWRFSESDATTWERIPASSDPMVLMRQ* |
| Ga0075362_107335652 | 3300006177 | Populus Endosphere | LGLSTWRLDPDGLLLSGSGGTWRFSESDPTTWERVPASTDPLVLMRQ* |
| Ga0074062_128245422 | 3300006606 | Soil | DIGLSTWRLDSDGLLLSGRSGSWRFSESDATTWERIPATSDPLVLMRQ* |
| Ga0079220_117333051 | 3300006806 | Agricultural Soil | GLLLTGRGGSWRFSESDATIWERIPASADPLVLMRQ* |
| Ga0075428_1017936341 | 3300006844 | Populus Rhizosphere | IAAFNPSTWRLDRDLLILTGRNGSWRFSESDATVWERVPLSTDPLLLVRQ* |
| Ga0075421_1025320801 | 3300006845 | Populus Rhizosphere | LLTGRGGSWRFSESDATTWERIPASSDPLVLMRQ* |
| Ga0075430_1002852961 | 3300006846 | Populus Rhizosphere | ASVADIELSTWRLDRDGLLLTGRGGSWRFSESDATTWERVPATADPLVLVRQ* |
| Ga0075425_1010502021 | 3300006854 | Populus Rhizosphere | VELSTWRLDSDGLLLTGRGGSWRFSESDATTWERIPASSDPLVLMRQ* |
| Ga0075429_1001366241 | 3300006880 | Populus Rhizosphere | ELVLTGRAGAWRFSESDATTWERIPPSTDPLVLMRQ* |
| Ga0075429_1018602141 | 3300006880 | Populus Rhizosphere | TWRLEDNELRLTGRTEAWRFSESDANTWERVPPSAEPMVLMRQ* |
| Ga0075426_105110331 | 3300006903 | Populus Rhizosphere | TWQLDSEGLLLRGRGGSWRFSESDATTWERIPASADPLVLMRQ* |
| Ga0075424_1023719501 | 3300006904 | Populus Rhizosphere | LSTWRLDSNELVLSGRNGAWRFSESDTTTWERIPPSTDPIVLMRQ* |
| Ga0075419_101264634 | 3300006969 | Populus Rhizosphere | VTWRLEGGELVLTGRAGAWRFSESDATTWERIPPSTDPLVLMRQ* |
| Ga0075435_1004905222 | 3300007076 | Populus Rhizosphere | GLSTWRLDGDGLLLSGRGGSWRFSESDATTWERIPATSDPLVLMRQ* |
| Ga0099830_111854832 | 3300009088 | Vadose Zone Soil | EGGELVLTGRAGAWRFSESDASTWERIPPSTDPLLLMRP* |
| Ga0111539_100849892 | 3300009094 | Populus Rhizosphere | VKQGCDPSVADVELSTWRLDSDGLLLTGRGGSWRFSESDATTWERIPASSDPLVLMRQ* |
| Ga0105245_104114223 | 3300009098 | Miscanthus Rhizosphere | STWRLADNELLLTGRGGTWRFSESDASIWERVPPSTDPMLLMRQ* |
| Ga0075418_125798121 | 3300009100 | Populus Rhizosphere | PDGLLLSGSGGTWRFSESDPTTWERIPASTDPLVLMRQ* |
| Ga0126380_119668642 | 3300010043 | Tropical Forest Soil | CDASVADIGLSTWRLDSDGLLLSGRGGSWRFSESDATTWERIPATSDPLVLMRQ* |
| Ga0126384_122888751 | 3300010046 | Tropical Forest Soil | SEGLLLTGRGGSWRFSESDATTWERIPASADPLVLMRQ* |
| Ga0126382_106279742 | 3300010047 | Tropical Forest Soil | SVADIGLSTWRLDGDGLLLSGRGGSWRFSESDATTWERIPATSDPLVLMRQ* |
| Ga0126382_114641492 | 3300010047 | Tropical Forest Soil | GVGLLTWRLERDELLLVGRSGSWRFSESDATSWERIPPSADPLVLMRQ* |
| Ga0126376_110938721 | 3300010359 | Tropical Forest Soil | TWRLDSDGLLLTGRGGSWRFSESDATTWERIPATSDPMVLMRQ* |
| Ga0126372_104601483 | 3300010360 | Tropical Forest Soil | GCDSSVAGIELSTWRLDPDGLLLTGRGGSWRFSESDATTWERIPASSDPLVLMRQ* |
| Ga0126378_131507411 | 3300010361 | Tropical Forest Soil | FDSSVAGIELSTWRLDPDGLLLTGRGGSWRFSESDATTWERIPASSDPLVLMRQ* |
| Ga0126379_113165912 | 3300010366 | Tropical Forest Soil | LLSGRGGSWRFSESDATTWERIPATSDPLVLMRQ* |
| Ga0126383_106817012 | 3300010398 | Tropical Forest Soil | CDPSVADVELSTWQLDSEGLLLTGRAGSWRFSESDATTWERIPASADPLVLMRQ* |
| Ga0126383_124698702 | 3300010398 | Tropical Forest Soil | RLDSDGLLLTGRGGSWRFSESDATTWERIPATSDPLVLMRQ* |
| Ga0138514_1000375731 | 3300011003 | Soil | IEDNELVVAGRSSAWRFSESDATTWERIPPSTDPLLMMRQ* |
| Ga0137391_112046381 | 3300011270 | Vadose Zone Soil | LLFSGRTGTWRFAESDATTWERIPPSTDPLLMMRQ* |
| Ga0137388_107883321 | 3300012189 | Vadose Zone Soil | TWRLQDNELLFSGRTGTWRFAESDATTWGRIPPSTDPLLMMRQ* |
| Ga0137362_103648451 | 3300012205 | Vadose Zone Soil | ASVADIGLSTWRLDGDGLLLSGRGGSWRFSESDATTWERIPATSDPLVLMRQ* |
| Ga0137370_100415364 | 3300012285 | Vadose Zone Soil | TWRLDSDGLLLTGRGGSWRFSESDATTWERVPASSDPLVLMRQE* |
| Ga0137384_100874884 | 3300012357 | Vadose Zone Soil | WRLDGDGLLLSGRGGSWRFSESDATTWERIPATSDPLVLMRQ* |
| Ga0137384_107041252 | 3300012357 | Vadose Zone Soil | DSDGLLLSGRGGSWRFSESDATTWERIPATSDPLVLMRQ* |
| Ga0137384_113964671 | 3300012357 | Vadose Zone Soil | LVLAGRSGAWRFAESDSTTWERIPPSTDPLRLMRQ* |
| Ga0137390_111777952 | 3300012363 | Vadose Zone Soil | RLDNNELLFSGRTGTWRFAESDATTWERIPPSTDPLLMMRQ* |
| Ga0157295_102168362 | 3300012906 | Soil | AGLGLSTWRLDPDGLLLSGSGGTWRFSESDPTTWERIPASTDPLVLMRE* |
| Ga0157301_102625491 | 3300012911 | Soil | AGLGLSTWRLDPDGLLLSGSGGTWRFSESDPTTWERIPASTDPLVLRRE* |
| Ga0157302_105502061 | 3300012915 | Soil | LLLTGRGGTWRFSESDVSTWERVPPSTDPMLLMRQ* |
| Ga0126375_120947722 | 3300012948 | Tropical Forest Soil | IATWGPSTWRLDRDQIILTGRSGSWRFSESDATVWERVPLSVDPLLLVRQ* |
| Ga0126369_130893491 | 3300012971 | Tropical Forest Soil | LGFTTWRLDADGLQLSGNGGRWRFSESDATSWERIPASTDPMVLMRQ* |
| Ga0134076_104057681 | 3300012976 | Grasslands Soil | WRLDSDGLLLTGRGGSWRFSESDATTWERVPASSDPLVLMRQE* |
| Ga0134087_103961322 | 3300012977 | Grasslands Soil | DTSVADIELSTWRLDSDGLLLTGRGGSWRFSESDATTWERVPASSDPLVLMRQE* |
| Ga0164308_122158912 | 3300012985 | Soil | SVADIGLSTWRLDSDGLLLSGRGGSWRFSESDATTWERIPATSDPLVLMRQ* |
| Ga0164305_105772491 | 3300012989 | Soil | VADIGLSTWRLDSDGLLLSGRSVSWRFSESDATTWERIPATSDPLVLMRQ* |
| Ga0075307_11053891 | 3300014260 | Natural And Restored Wetlands | RIVVKPGCTAEIVGLALATWRLEVNDLLLIGRGGTWRFSESDATVWERIPPSTDPMVLMRQ* |
| Ga0157380_113310251 | 3300014326 | Switchgrass Rhizosphere | STWRLDPDGLLLSGSGGTWRFSESDPTTWERIPASTDPLVLMRQ* |
| Ga0132258_138425472 | 3300015371 | Arabidopsis Rhizosphere | CDTSIAGLGLATWRLDSNELLLVGRGATWRFSESDATTWERIPPSADPMVLMRQ* |
| Ga0132256_1034917372 | 3300015372 | Arabidopsis Rhizosphere | VLVGRGGTWRFSESDTTTWERIPPSADPMVLMRQ* |
| Ga0132257_1001947441 | 3300015373 | Arabidopsis Rhizosphere | SEGLLLRGRGGSWRFSESDATTWERIPASADPLVLMRQ* |
| Ga0182035_115163882 | 3300016341 | Soil | CDASVADIGLSTWRLDSDGLLLTGRGGSWRFSESDATTWERIPATSDPLVLMRQ |
| Ga0182040_104331881 | 3300016387 | Soil | DASVADIGLSTWRLDGDGLLLSGRGGSWRFSESDATTWERIPATSDPLVLMRQ |
| Ga0182037_105104151 | 3300016404 | Soil | GLLLSGRGGSWRFSESDATTWERIPATSDPLVLMRQ |
| Ga0182038_112563123 | 3300016445 | Soil | LLLSGRSGTWRFAASDSATWERIPPSTDPLLMMRQ |
| Ga0187777_104942801 | 3300017974 | Tropical Peatland | WRLQNEELLLSGSTETWRFVESDASTWERVPPSTDPLVLMRQ |
| Ga0184610_10714731 | 3300017997 | Groundwater Sediment | WRLDPDGLLLSGSGGTWRFSESDPSTWERIPASTDPVVLMRQ |
| Ga0184634_104752922 | 3300018031 | Groundwater Sediment | VAGLGLSTWRLDPDGLMLSGSGGTWRFSESDPTTWERIPASTDPVVLMRQ |
| Ga0184616_102298362 | 3300018055 | Groundwater Sediment | CDASVAGLGLSTWRLDPDGLMLSGSGGTWRFSESDPTTWERIPASTDPVVLMRQ |
| Ga0190272_119847012 | 3300018429 | Soil | RLDRDGLVLSGRGVTWRFSESDATTWERIPPSADPMVLMRQ |
| Ga0066667_108747352 | 3300018433 | Grasslands Soil | LLLTGRGGSWRFSESDATTWERVPATSDPLVLMRQ |
| Ga0190269_111473261 | 3300018465 | Soil | TWRLDPDGLLLSGSGGTWRFSERDPTTWERIPASTDPLVLMRQ |
| Ga0190270_130847212 | 3300018469 | Soil | AGLGLSTWRLDPDGLLLSGSGGTWRFSESDPTTWERIPASTDPLVLMRQ |
| Ga0190271_119943652 | 3300018481 | Soil | LEVNDLLLVGRGGTWRFSEADATVWERIPPSTDPMLLMRQ |
| Ga0126371_108617672 | 3300021560 | Tropical Forest Soil | ADIGLSTWRLDSDGLLLTGRGGSWRFSESDATTWERIPATSDPLVLMRQ |
| Ga0222622_107375491 | 3300022756 | Groundwater Sediment | PDGLLLSGSGGTWRFSESDPTTWERIPASTDPVVLMRQ |
| Ga0207699_100582264 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VKQGCDSSVADVELSTWRLDSDGLLLTGRGGSWRFSESDATTWERIPASSDPLVLMRQ |
| Ga0207687_107457051 | 3300025927 | Miscanthus Rhizosphere | GLSTWRLDPDGLLLSGSGGTWRFSESDPTTWERIPASTDPLVLMRE |
| Ga0207700_101489011 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | AGGESYKITVKQGCDPSVADVELSTWRLDSDGLLLTGRGGSWRFSESDATTWERIPASSDPLVLMRQ |
| Ga0207664_113341371 | 3300025929 | Agricultural Soil | LLLSGSGGSWRFSESDATSWERIPASTDPLVLMRQ |
| Ga0207690_113306221 | 3300025932 | Corn Rhizosphere | TWRLDRDQLILTGRNGSWRFSESDATVWERVPLTVDPMLLVRQ |
| Ga0207709_114519892 | 3300025935 | Miscanthus Rhizosphere | LSTWRLDPDGLLLSGSGGTWRFSESDPTTWERIPASTDPLVLMRE |
| Ga0207665_103565961 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VADIGLSTWRLDSDGLLLSGRGGSWRFSESDATTWERIPATSDPLVLMRQ |
| Ga0207712_112636091 | 3300025961 | Switchgrass Rhizosphere | SVADVELSTWRLDSDGLLLTGRGGSWRFSESDATTWERIPASSDPLVLMRQ |
| Ga0207640_105003274 | 3300025981 | Corn Rhizosphere | DASVAGLGLSTWRLDPDGLLLSGSGGTWRFSESDPTTWERIPASTDPLVLMRQ |
| Ga0209240_10533832 | 3300026304 | Grasslands Soil | LLLSGRSGSWRFSESDATTWERIPATSDPLVLMRQ |
| Ga0257159_10282891 | 3300026494 | Soil | DPSVADVELSTWRLDRDGLLLTGRGGSWRFSESDATTWERIPASADPLVLMRQ |
| Ga0209376_13501332 | 3300026540 | Soil | WRLDSDGLLLTGRGGSWRFSESDATTWERVPASSDPLVLMRQE |
| Ga0207776_10339481 | 3300027035 | Tropical Forest Soil | LLLSGSTETWRFVESDASTWERVPPSTDPLVLMRQ |
| Ga0209213_10600452 | 3300027383 | Forest Soil | AIAGLGLATWRLDSNELVLVGRGGTWRFSESDPKTWERIPPSADPMVLMRQ |
| Ga0209481_100270211 | 3300027880 | Populus Rhizosphere | VTWRLEGGELVLTGRAGAWRFSESDATTWERIPPSTDPLVLMRQ |
| Ga0209068_107331811 | 3300027894 | Watersheds | WRLEANELMLIGRAGTWRFSESDASTWERIPPSTDPMLLMK |
| Ga0137415_109224382 | 3300028536 | Vadose Zone Soil | DGLLLSGRGGSWRFSESDATTWERIPATSDPLVLMRQ |
| Ga0307309_100118281 | 3300028714 | Soil | CDASVAGLGLSTWRLDPDGLLLSGSGGTWRFSESDPTTWERIPASTDPLVLMRQ |
| Ga0307313_100627272 | 3300028715 | Soil | GLSTWRLDPDGLMLSGSGGTWRFSESDPTTWERIPASTDPVVLMRQ |
| Ga0307280_100409411 | 3300028768 | Soil | RLDPDGLLLSGSGGTWRFSESDPTTWERIPASTDPLVLMRQ |
| Ga0307323_101887201 | 3300028787 | Soil | GLGLSTWRLDPDGLLLSGSGGTWRFSESDPTTWERIPASTDPVVLMRQ |
| Ga0307323_102073011 | 3300028787 | Soil | RLDSDGLLLTGRGGSWRFSESDATTWERIPASSDPLVLMRQ |
| Ga0307284_102227371 | 3300028799 | Soil | ESYKITVKQGCDPSVADVELSTWRLDSDGLLLTGRGGSWRFSESDATTWERIPASSDPLVLMRQ |
| Ga0247824_109324492 | 3300028809 | Soil | STWRLDRDQLILIGRGGSWRFSESDATVWERFPLSVDPMLLVRQ |
| Ga0307312_102888021 | 3300028828 | Soil | PGCDASLAGLGLSTWRLDPDGLLLSGSGGTWRFSESDPTTWERIPASTDPLVLMRQ |
| Ga0318555_103146392 | 3300031640 | Soil | LLLFGRNETWRFVESDATTWERVPPSTDPLLLMRQ |
| Ga0318561_108188881 | 3300031679 | Soil | RLDSDGLLLSGRGGSWRFSESDATTWERIPATSDPLVLMRQ |
| Ga0318572_106949432 | 3300031681 | Soil | ASVADIGLSTWRLDSDGLLLSGRGGSWRFSESDATTWERIPATSDPLVLMRQ |
| Ga0318500_105009201 | 3300031724 | Soil | GLSTWRLDSDGLLLSGRGGSWRFSESDATTWERIPATSDPLVLMRQ |
| Ga0318546_101292433 | 3300031771 | Soil | TWRLDNDELLLAGRMTWRFTESDTTTWERISPSTDPMLLMRQ |
| Ga0318543_102430051 | 3300031777 | Soil | STWRLDSDGLLLSGPGGSWRFSESDATTWERIPATSDPLVLMRQ |
| Ga0318566_106054182 | 3300031779 | Soil | PGCDASVADAELSTWRLDQDGLLLTGRGGSWRFSESDATTWERIPASSDPLVLMRQ |
| Ga0318548_102770282 | 3300031793 | Soil | WRLDSDGLLLTGRGGSWRFSESDATTWERIPATSDPLVLMRQ |
| Ga0318576_100643323 | 3300031796 | Soil | CDASVADAELSTWRLDQDGLLLTGRGGSWRFSESDATTWERIPASSDPLVLMRQ |
| Ga0318550_105352041 | 3300031797 | Soil | ALATWRLDSDELLLSGSTTWRFAESDTTTWERIPPSTDPMLLMRQ |
| Ga0306925_104808412 | 3300031890 | Soil | SDGLLLTGRGGSWRFSESDATTWERIPATSDPLVLMRQ |
| Ga0306925_107574891 | 3300031890 | Soil | STWRLQENELLLSGGAGTWRFAESDATTWERIPPSTDPLLMMRQ |
| Ga0318520_104296302 | 3300031897 | Soil | LSTWRLDRDELLLAGRSGAWRFGESDSTTWERLPPSTDPLVLMRQ |
| Ga0306923_108487761 | 3300031910 | Soil | CDASVADIGLSTWRLDSDGLLLSGRGGSWRFSESDATTWERIPATSDPLVLMRQ |
| Ga0310884_104644631 | 3300031944 | Soil | ASVAGLGLSTWRLDPDGLLLSGSGGTWRFSESDPTTWERIPASTDPLVLMRQ |
| Ga0306926_127192641 | 3300031954 | Soil | LQENELLLSGRAGTWRFAESDATTWERIPPSTDPLLMMKQ |
| Ga0318530_100382333 | 3300031959 | Soil | DGLLLTGRSGSWRFSESDATTWERIPATSDPLVLMRQ |
| Ga0318558_101296553 | 3300032044 | Soil | ASVADAELSTWRLDQDGLLLTGRGGSWRFSESDATTWERIPASSDPLVLMRQ |
| Ga0318575_104266592 | 3300032055 | Soil | QENELLLSGGAGTWRFAESDATTWERIPPSTDPLLMMRQ |
| Ga0318575_104890101 | 3300032055 | Soil | LSTWRLDSDGLLLSGRGGSWRFSESDATTWERIPATSDPLVLMRQ |
| Ga0310889_107365031 | 3300032179 | Soil | SVAGLGLSTWRLDPDGLLLSGSGGTWRFSESDPTTWERIPASTDPLVLMRQ |
| Ga0306920_1008236471 | 3300032261 | Soil | SDGLLLSGPGGSWRFSESDATTWERIPATSDPLVLMRQ |
| ⦗Top⦘ |