| Basic Information | |
|---|---|
| Family ID | F055980 |
| Family Type | Metagenome |
| Number of Sequences | 138 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MTETLAQAEAVLEVISPDGARKYVRVTQTPFLIGRGAETGNHLQL |
| Number of Associated Samples | 125 |
| Number of Associated Scaffolds | 138 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 97.83 % |
| % of genes near scaffold ends (potentially truncated) | 97.83 % |
| % of genes from short scaffolds (< 2000 bps) | 91.30 % |
| Associated GOLD sequencing projects | 121 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.275 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (26.087 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.638 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.899 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 21.92% Coil/Unstructured: 78.08% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 138 Family Scaffolds |
|---|---|---|
| PF01063 | Aminotran_4 | 21.74 |
| PF00999 | Na_H_Exchanger | 19.57 |
| PF01551 | Peptidase_M23 | 5.07 |
| PF05231 | MASE1 | 0.72 |
| PF00291 | PALP | 0.72 |
| PF05635 | 23S_rRNA_IVP | 0.72 |
| PF01409 | tRNA-synt_2d | 0.72 |
| PF03747 | ADP_ribosyl_GH | 0.72 |
| PF01979 | Amidohydro_1 | 0.72 |
| PF07702 | UTRA | 0.72 |
| PF07228 | SpoIIE | 0.72 |
| PF13407 | Peripla_BP_4 | 0.72 |
| COG ID | Name | Functional Category | % Frequency in 138 Family Scaffolds |
|---|---|---|---|
| COG0115 | Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyase | Amino acid transport and metabolism [E] | 43.48 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 19.57 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 19.57 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 19.57 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 19.57 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 19.57 |
| COG0016 | Phenylalanyl-tRNA synthetase alpha subunit | Translation, ribosomal structure and biogenesis [J] | 0.72 |
| COG0642 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.72 |
| COG1397 | ADP-ribosylglycohydrolase | Posttranslational modification, protein turnover, chaperones [O] | 0.72 |
| COG2024 | O-phosphoseryl-tRNA(Cys) synthetase | Translation, ribosomal structure and biogenesis [J] | 0.72 |
| COG3447 | Integral membrane sensor domain MASE1 | Signal transduction mechanisms [T] | 0.72 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.28 % |
| Unclassified | root | N/A | 0.72 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_104384089 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
| 3300000559|F14TC_114114160 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10026568 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1574 | Open in IMG/M |
| 3300004080|Ga0062385_10526564 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 734 | Open in IMG/M |
| 3300004080|Ga0062385_10873897 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
| 3300004479|Ga0062595_101791574 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 583 | Open in IMG/M |
| 3300004479|Ga0062595_102493414 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300005332|Ga0066388_100579182 | All Organisms → cellular organisms → Bacteria | 1748 | Open in IMG/M |
| 3300005435|Ga0070714_100825739 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 898 | Open in IMG/M |
| 3300005555|Ga0066692_10539930 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 739 | Open in IMG/M |
| 3300005764|Ga0066903_102215333 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1060 | Open in IMG/M |
| 3300005764|Ga0066903_107710411 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300005843|Ga0068860_101826445 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
| 3300005921|Ga0070766_10813623 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 637 | Open in IMG/M |
| 3300005937|Ga0081455_10325402 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1093 | Open in IMG/M |
| 3300006102|Ga0075015_101033358 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300006173|Ga0070716_100935399 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 681 | Open in IMG/M |
| 3300006173|Ga0070716_101051739 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 646 | Open in IMG/M |
| 3300006175|Ga0070712_101262371 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
| 3300007265|Ga0099794_10160118 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1145 | Open in IMG/M |
| 3300009176|Ga0105242_11409332 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 724 | Open in IMG/M |
| 3300009520|Ga0116214_1132024 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 925 | Open in IMG/M |
| 3300009524|Ga0116225_1450516 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300010048|Ga0126373_11637882 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 708 | Open in IMG/M |
| 3300010341|Ga0074045_10053254 | All Organisms → cellular organisms → Bacteria | 2921 | Open in IMG/M |
| 3300010359|Ga0126376_13130369 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300010361|Ga0126378_10637032 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1180 | Open in IMG/M |
| 3300010366|Ga0126379_13099297 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300011271|Ga0137393_10499569 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1044 | Open in IMG/M |
| 3300012209|Ga0137379_11776807 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300012354|Ga0137366_10449882 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 934 | Open in IMG/M |
| 3300012356|Ga0137371_11073269 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300012582|Ga0137358_10647595 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 707 | Open in IMG/M |
| 3300012917|Ga0137395_10077734 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2158 | Open in IMG/M |
| 3300012929|Ga0137404_10107312 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2262 | Open in IMG/M |
| 3300012929|Ga0137404_10159454 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 1883 | Open in IMG/M |
| 3300012930|Ga0137407_10283648 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1510 | Open in IMG/M |
| 3300012948|Ga0126375_10676678 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 800 | Open in IMG/M |
| 3300012964|Ga0153916_12586789 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300013306|Ga0163162_12641399 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
| 3300014200|Ga0181526_10074810 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2157 | Open in IMG/M |
| 3300015053|Ga0137405_1387298 | All Organisms → cellular organisms → Bacteria | 8007 | Open in IMG/M |
| 3300015241|Ga0137418_10198218 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1737 | Open in IMG/M |
| 3300015374|Ga0132255_103969793 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
| 3300016294|Ga0182041_10751450 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 868 | Open in IMG/M |
| 3300016341|Ga0182035_11968756 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300016371|Ga0182034_10645467 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 896 | Open in IMG/M |
| 3300016387|Ga0182040_11532871 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
| 3300016445|Ga0182038_10178186 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1652 | Open in IMG/M |
| 3300016445|Ga0182038_11798621 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
| 3300017822|Ga0187802_10115855 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1013 | Open in IMG/M |
| 3300017929|Ga0187849_1355048 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300017932|Ga0187814_10425899 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300017943|Ga0187819_10418851 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 769 | Open in IMG/M |
| 3300017947|Ga0187785_10700851 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300017955|Ga0187817_10723695 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 635 | Open in IMG/M |
| 3300017970|Ga0187783_11072504 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
| 3300017972|Ga0187781_11104463 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
| 3300017974|Ga0187777_11103541 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
| 3300018024|Ga0187881_10151624 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
| 3300018062|Ga0187784_11263291 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300018085|Ga0187772_10140172 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1591 | Open in IMG/M |
| 3300018086|Ga0187769_10188390 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1523 | Open in IMG/M |
| 3300018088|Ga0187771_10468073 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1065 | Open in IMG/M |
| 3300018090|Ga0187770_11336156 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
| 3300018090|Ga0187770_11477120 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
| 3300018090|Ga0187770_11688975 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300018482|Ga0066669_10762395 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300019788|Ga0182028_1150818 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300019789|Ga0137408_1335063 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2527 | Open in IMG/M |
| 3300020580|Ga0210403_11033943 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 641 | Open in IMG/M |
| 3300020583|Ga0210401_11498365 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
| 3300021170|Ga0210400_10660820 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 860 | Open in IMG/M |
| 3300021170|Ga0210400_11141443 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
| 3300021171|Ga0210405_10688467 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 790 | Open in IMG/M |
| 3300021181|Ga0210388_11506323 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
| 3300021401|Ga0210393_10315201 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1271 | Open in IMG/M |
| 3300021401|Ga0210393_10585476 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300021404|Ga0210389_10535348 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 921 | Open in IMG/M |
| 3300021407|Ga0210383_10834211 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 788 | Open in IMG/M |
| 3300021420|Ga0210394_11293944 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
| 3300021474|Ga0210390_10645487 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 885 | Open in IMG/M |
| 3300021479|Ga0210410_10001544 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 21471 | Open in IMG/M |
| 3300021560|Ga0126371_11049796 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 955 | Open in IMG/M |
| 3300025173|Ga0209824_10213517 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 678 | Open in IMG/M |
| 3300025454|Ga0208039_1057042 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 711 | Open in IMG/M |
| 3300025501|Ga0208563_1047820 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 929 | Open in IMG/M |
| 3300025906|Ga0207699_10331075 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1071 | Open in IMG/M |
| 3300025910|Ga0207684_10063853 | All Organisms → cellular organisms → Bacteria | 3126 | Open in IMG/M |
| 3300026374|Ga0257146_1010762 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1489 | Open in IMG/M |
| 3300026538|Ga0209056_10089730 | All Organisms → cellular organisms → Bacteria | 2551 | Open in IMG/M |
| 3300026810|Ga0207801_110464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
| 3300026824|Ga0207723_113159 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
| 3300026849|Ga0207804_105077 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1281 | Open in IMG/M |
| 3300026868|Ga0207818_1013491 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 736 | Open in IMG/M |
| 3300026879|Ga0207763_1014053 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 814 | Open in IMG/M |
| 3300026909|Ga0207858_1007365 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1115 | Open in IMG/M |
| 3300027070|Ga0208365_1040715 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 619 | Open in IMG/M |
| 3300027326|Ga0209731_1014580 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1055 | Open in IMG/M |
| 3300027562|Ga0209735_1052111 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300027575|Ga0209525_1069689 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 847 | Open in IMG/M |
| 3300027812|Ga0209656_10540757 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300027826|Ga0209060_10532669 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300027905|Ga0209415_10466918 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 987 | Open in IMG/M |
| 3300031122|Ga0170822_15679987 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1102 | Open in IMG/M |
| 3300031231|Ga0170824_128805910 | All Organisms → cellular organisms → Bacteria | 2140 | Open in IMG/M |
| 3300031573|Ga0310915_10527785 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 838 | Open in IMG/M |
| 3300031679|Ga0318561_10405877 | Not Available | 749 | Open in IMG/M |
| 3300031679|Ga0318561_10541851 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 641 | Open in IMG/M |
| 3300031681|Ga0318572_10882931 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300031718|Ga0307474_10918122 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 693 | Open in IMG/M |
| 3300031718|Ga0307474_11503143 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300031719|Ga0306917_11452773 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300031720|Ga0307469_11538148 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 638 | Open in IMG/M |
| 3300031724|Ga0318500_10279903 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 814 | Open in IMG/M |
| 3300031736|Ga0318501_10552230 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
| 3300031744|Ga0306918_10278717 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1283 | Open in IMG/M |
| 3300031777|Ga0318543_10242129 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 804 | Open in IMG/M |
| 3300031778|Ga0318498_10246743 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 805 | Open in IMG/M |
| 3300031821|Ga0318567_10043183 | All Organisms → cellular organisms → Bacteria | 2302 | Open in IMG/M |
| 3300031879|Ga0306919_10678252 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 794 | Open in IMG/M |
| 3300031894|Ga0318522_10178790 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 802 | Open in IMG/M |
| 3300031910|Ga0306923_10383197 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1602 | Open in IMG/M |
| 3300031945|Ga0310913_10367559 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1019 | Open in IMG/M |
| 3300031945|Ga0310913_11246482 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300031946|Ga0310910_10207261 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1522 | Open in IMG/M |
| 3300031981|Ga0318531_10481544 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
| 3300032001|Ga0306922_11287597 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 740 | Open in IMG/M |
| 3300032025|Ga0318507_10384683 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 611 | Open in IMG/M |
| 3300032044|Ga0318558_10043202 | All Organisms → cellular organisms → Bacteria | 1963 | Open in IMG/M |
| 3300032052|Ga0318506_10072614 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1432 | Open in IMG/M |
| 3300032054|Ga0318570_10225696 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300032067|Ga0318524_10362981 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 753 | Open in IMG/M |
| 3300032090|Ga0318518_10073155 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1673 | Open in IMG/M |
| 3300032094|Ga0318540_10214052 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 929 | Open in IMG/M |
| 3300032174|Ga0307470_10056785 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 2039 | Open in IMG/M |
| 3300033158|Ga0335077_11245605 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 726 | Open in IMG/M |
| 3300033289|Ga0310914_10855096 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 809 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 26.09% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.97% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 7.97% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.52% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.35% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.62% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.90% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.90% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.90% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.17% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.17% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.17% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.45% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.45% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.72% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.72% |
| Wastewater | Environmental → Aquatic → Freshwater → Drinking Water → Unchlorinated → Wastewater | 0.72% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.72% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.72% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.72% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.72% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.72% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.72% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.72% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019788 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025173 | Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking water (SPAdes) | Environmental | Open in IMG/M |
| 3300025454 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025501 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026374 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-A | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026810 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 16 (SPAdes) | Environmental | Open in IMG/M |
| 3300026824 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 27 (SPAdes) | Environmental | Open in IMG/M |
| 3300026849 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 46 (SPAdes) | Environmental | Open in IMG/M |
| 3300026868 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 32 (SPAdes) | Environmental | Open in IMG/M |
| 3300026879 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 50 (SPAdes) | Environmental | Open in IMG/M |
| 3300026909 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 23 (SPAdes) | Environmental | Open in IMG/M |
| 3300027070 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 (SPAdes) | Environmental | Open in IMG/M |
| 3300027326 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1043840891 | 3300000364 | Soil | MAETLGTTEAVLEVISPDGARRYARVAQTPYMMGRGAETGN |
| F14TC_1141141601 | 3300000559 | Soil | MAEPLATNEAVLEVISPDGARRYARVVQTPYMIGRGAETGNHLQLNDRRIS |
| AF_2010_repII_A1DRAFT_100265682 | 3300000597 | Forest Soil | MTETLAQSEAVLEVISPDGARKYVRVTQTPFLLGRGAETGNHLQLTDRRI |
| Ga0062385_105265643 | 3300004080 | Bog Forest Soil | MTETIPQIEAVLEVISPDGARKYVRVTQMPFMIGRGAETGNHLQLTDRRISRNCA |
| Ga0062385_108738971 | 3300004080 | Bog Forest Soil | MTETLAQAEAVLEVISPDGARKYVRVTQTPFLIGRGAETGNHLQLTDRRI |
| Ga0062595_1017915741 | 3300004479 | Soil | MAETLATNEAVLEVISPDGARRYARVAQTPYMIGRGAETGNHLQLNDRRI |
| Ga0062595_1024934142 | 3300004479 | Soil | MAETLAATEAVLEVISPDGARRYARISATPYMIGRGAETGNHLQLNDRR |
| Ga0066388_1005791823 | 3300005332 | Tropical Forest Soil | MAETLAATEAVLEVISPDGARRYARVSQTPYLMGRGAETGNHLQ |
| Ga0070714_1008257392 | 3300005435 | Agricultural Soil | MTETLSQLEAVLEVISPDGARKYVRVTQTPFLIGRGAETGNHLQL |
| Ga0066692_105399302 | 3300005555 | Soil | MLEPQSAPETSLELIAPDGARRVVRVSTFPFLIGRGTDTGNHLQLSDR |
| Ga0066903_1022153332 | 3300005764 | Tropical Forest Soil | MSEALPISEAVLEVHSNDGKRYVRVTQTPFLIGRGAETGN |
| Ga0066903_1077104111 | 3300005764 | Tropical Forest Soil | MAETLASNEAVLEVISPDGARSYARVAQTPYMIGRGAETGNHLQLND |
| Ga0068860_1018264451 | 3300005843 | Switchgrass Rhizosphere | MAETLATNEAVLEVISPDGARRYARVAQTPYMIGRGAEIGNHLQLNDR |
| Ga0070766_108136232 | 3300005921 | Soil | MTETLAQAEAVLEVISPDGARKYVRVTQTPFLIGRGAETGNHLQLTDRR |
| Ga0081455_103254021 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MADTLATNEAVLEVISPDGARRYARVAQTPYMIGRGAEIGNHLQLNDR |
| Ga0075015_1010333581 | 3300006102 | Watersheds | MTETLVQNEAVLEVISPDGARKYVRITAVPFLIGRGAETGNHLQLTD |
| Ga0070716_1009353992 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MPDTLATNEAVLEVISPDGARRYARVAQTPYMIGRGAETGNHLQLNDRRISW |
| Ga0070716_1010517391 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MAETLATTEAVLEVISPDGARRYARVAQTPYMMGRGAETGNHLQL |
| Ga0070712_1012623712 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MSESLATTEAVLEVISPDGARRYARVSQTPYLIGRGAETGNHLQLNDRRIS |
| Ga0099794_101601181 | 3300007265 | Vadose Zone Soil | MTEPLVQSEAVLEVISPDGARKYVRVTQVPFLIGRGAETGNHLQLTDRRISRN |
| Ga0105242_114093321 | 3300009176 | Miscanthus Rhizosphere | MAETLATNEAVLEVISPDGARRYARVAQTPYMIGRGAETGNHLQLNDRRISR |
| Ga0116214_11320241 | 3300009520 | Peatlands Soil | MTEALAQSEAVLEVISPDGARKYVRVTQTPFLIGRGAE |
| Ga0116225_14505161 | 3300009524 | Peatlands Soil | MTEALAQSEAVLEVISPDGARKYVRVTQTPFLIGRGSETGNHLQLT |
| Ga0126373_116378821 | 3300010048 | Tropical Forest Soil | MTETLGQSEAVLEVISPDGARKYVRVTQLPFLIGRGAETGNH |
| Ga0074045_100532541 | 3300010341 | Bog Forest Soil | MTEALAQSEAVLEVISPDGARKYVRVTQTPFLIGRGSETGNH |
| Ga0126376_131303692 | 3300010359 | Tropical Forest Soil | MPDTLATNEAVLEVIFPDGARRYARVAQTPYMIGRGAETGNHLQLN |
| Ga0126378_106370322 | 3300010361 | Tropical Forest Soil | MTETLAQAEAVLEVISPDGARKYVRVSQTPFLIGRGSETG |
| Ga0126379_130992971 | 3300010366 | Tropical Forest Soil | MADTLATNEAVLEVISPDGARRYARVSQTPYMIGRGAETGNHLQLN |
| Ga0137393_104995692 | 3300011271 | Vadose Zone Soil | MAETLATTEAVLEVISPDGARRYARVSQTPYLIGRGAETGNHLQLNDRRIS |
| Ga0137379_117768071 | 3300012209 | Vadose Zone Soil | MAETLATTEAVLEVISPDGARRYARVSQTPYMMGRGAETGNHLQLNDRRI |
| Ga0137366_104498822 | 3300012354 | Vadose Zone Soil | MAETLGTTEAVLEVISPDGARRYARVAQTPYMMGRGAETGNHLQLN |
| Ga0137371_110732691 | 3300012356 | Vadose Zone Soil | MPEALPIAEAVLEVISNDGAKRYVRVTQTPFLMGRGAETGNH |
| Ga0137358_106475951 | 3300012582 | Vadose Zone Soil | MAETLATTEAVLEVISPDGARRYARVSQTPYMMGRGAETGNHLQLND |
| Ga0137395_100777341 | 3300012917 | Vadose Zone Soil | MTEPLVQSEAVLEVISPDGARKYVRVTAVPFLIGRGAETGNHLQLTDRRISRN |
| Ga0137404_101073123 | 3300012929 | Vadose Zone Soil | MTEPLVQSEAVLEVISPDGARKYVRVTAVPFLIGRGAETGNHLQLTDRRI |
| Ga0137404_101594543 | 3300012929 | Vadose Zone Soil | MVETLGTTEAVLEVISPDGARRYARVAQTPYMMGRGAETG |
| Ga0137407_102836481 | 3300012930 | Vadose Zone Soil | MTEQLVQSEAVLEVISPDSARKYVRVPQVPFLMGRGAETGNHLQLT |
| Ga0126375_106766781 | 3300012948 | Tropical Forest Soil | MAETLATNEAVLEVISPDGARRYARVAQTPYMIGRGAETGN |
| Ga0153916_125867891 | 3300012964 | Freshwater Wetlands | MHDVPPANETVLEVISPDRSRQFVRVTETPFLIGRGGEIGNHLQLTDRRISRL |
| Ga0163162_126413991 | 3300013306 | Switchgrass Rhizosphere | MADTIATNEAVLEVISPDGARRYARVVQTPYMIGRGAETGNHLQLNDRRIS |
| Ga0181526_100748103 | 3300014200 | Bog | MTEALAQSEAVLEVISPDGARKYVRVTQTPFLIGRGSETGNHL |
| Ga0137405_13872987 | 3300015053 | Vadose Zone Soil | MPEALPIAEAVLEVLSTDGGKRYVRVRNAFLIGRGAETAIIFN* |
| Ga0137418_101982181 | 3300015241 | Vadose Zone Soil | MTEQLVQSEAVLEVISPDGARKYVRVNQVPFLMGHAAET |
| Ga0132255_1039697931 | 3300015374 | Arabidopsis Rhizosphere | MADTLATNEAVLEVISPDGARRYARVALTPYMIGRGAETGN |
| Ga0182041_107514502 | 3300016294 | Soil | MAETLAANEAVLEVISPDGARRYARVGQTPYMIGRGAETGNHLQLNDRRIS |
| Ga0182035_119687561 | 3300016341 | Soil | MTETLAQSEAVLEVISPDGARKYVRVTQTPFLLGRGAETGNHLQLTDR |
| Ga0182034_106454672 | 3300016371 | Soil | MTESLSQAEAVLEVISPDGARKYVRVTQTPFLIGRGAETGNHLQLTDR |
| Ga0182040_115328712 | 3300016387 | Soil | MTESLSQAEAVLEVISPDGARKYVRVTQTPFLIGRGAE |
| Ga0182038_101781862 | 3300016445 | Soil | MTEALSQSEAVLEVISPDGSRKYVRVTQTPFLMGRGSETGNHLQLTDRRISRNCAA |
| Ga0182038_117986212 | 3300016445 | Soil | MTETLTQSEAVLEVISPDGARKYVRVTQLPFLIGRGAETGNHLQLTDRR |
| Ga0187802_101158551 | 3300017822 | Freshwater Sediment | MAEGLAQSEAVLEVISPDGARKYVRVSQTPFLIGRGAETGNHLQLTD |
| Ga0187849_13550482 | 3300017929 | Peatland | MTEALAQSEAVLEVISRDGARKYVRVTQAPFLIGRGAET |
| Ga0187814_104258992 | 3300017932 | Freshwater Sediment | MAEGLAQSEAVLEVISPDGARKYVRVSQTPFLIGRGAETGNHLQLTDRRISRN |
| Ga0187819_104188512 | 3300017943 | Freshwater Sediment | MAEGLAQSEAVLEVISPDGARKYVRVSQTPFLIGRGAETGNHLQL |
| Ga0187785_107008512 | 3300017947 | Tropical Peatland | MTEPIAQSEAVLEVISPDGARKYVRVTQVPFLMGRGAETGNHLQLTDRRISRNCA |
| Ga0187817_107236952 | 3300017955 | Freshwater Sediment | MTEALGQSEAVLEVISPDGGRKYVRLTQVPFLIGR |
| Ga0187783_110725041 | 3300017970 | Tropical Peatland | MTETLAQAEAVLEVISPDGARKYVRVTQTPFLIGRGAETGNHLQLTDR |
| Ga0187781_111044632 | 3300017972 | Tropical Peatland | MTEPLAQTEAVLEVISPDGARKYVRVTQTPFLMGRGAETGNH |
| Ga0187777_111035412 | 3300017974 | Tropical Peatland | MSDTLALSEAVLEVISPDGARKYVRVSQTPFLIGRGAETGNHLQLTDRRISR |
| Ga0187881_101516241 | 3300018024 | Peatland | MTEALAQSEAVLEVISRDGARKYVRVTQAPFLIGRGAETGNHL |
| Ga0187784_112632912 | 3300018062 | Tropical Peatland | MPDTLAQAEAVLEVISPDGARKYVRIAQTPFLIGRGAETGNHLQ |
| Ga0187772_101401721 | 3300018085 | Tropical Peatland | MSDTLAQAEAVLEVISPDGARKYVRVTATPFLIGRGAETGNHLQ |
| Ga0187769_101883901 | 3300018086 | Tropical Peatland | MTETLAQGEAVLEVISPDGARKYVRITQTPFLIGRGAETGNHLQLTD |
| Ga0187771_104680732 | 3300018088 | Tropical Peatland | MTEALAQSEAVLEVISPDGARKYVRVTQTPFLIGRGAETGNHLQLTDRRIS |
| Ga0187770_113361561 | 3300018090 | Tropical Peatland | MTEALAQSEAVLEVISPDGARKYVRVTQTPFLIGRGAETGNHLQLT |
| Ga0187770_114771201 | 3300018090 | Tropical Peatland | MTETLAQSEAVLEVISPDGARKYVRVTQTPFLIGRGA |
| Ga0187770_116889752 | 3300018090 | Tropical Peatland | MTEALAQSEAVLEVISPDGARKYVRVTQTPFLIGRGAETATTC |
| Ga0066669_107623951 | 3300018482 | Grasslands Soil | MPEALPIAEAVLEVISNDGAKRYVRVTQTPFLMGR |
| Ga0182028_11508182 | 3300019788 | Fen | MTETLAQSEAVLEVISPDGARKYVRVTQTPFLIGRGAE |
| Ga0137408_13350634 | 3300019789 | Vadose Zone Soil | MPEALPIAEAVLEVISNDGAKRYVRVTQTPFLMGRGAETGNHFAIE |
| Ga0210403_110339431 | 3300020580 | Soil | MTEQLVQSEAVLEVISPDGARKYVRVTQVPFLIGRGAETG |
| Ga0210401_114983651 | 3300020583 | Soil | MTETLAQAEAVLEVISPDGARKYVRVTQTPFLIGRG |
| Ga0210400_106608202 | 3300021170 | Soil | MTETLVQSEAVLEVISPDGARKYVRVTQVPFLIGRGAETGNHLQLTDRRIS |
| Ga0210400_111414432 | 3300021170 | Soil | MTEQLVQSEAVLEVISPDGARKYVRVTQVPFLIGRG |
| Ga0210405_106884672 | 3300021171 | Soil | MTEQLVQSEAVLEVISPDGARKYVRVTQVPFLIGRGAETGNHLQLTDRRIS |
| Ga0210388_115063231 | 3300021181 | Soil | MTEPLVQSEAVLEVISPDGARKYVRVTQVPFLMGRG |
| Ga0210393_103152011 | 3300021401 | Soil | MTETLSQLEAVLEVISPDGARKYVRVTQTPFLIGRGAETGNHLQLTD |
| Ga0210393_105854762 | 3300021401 | Soil | MTETLAQAEAVLEVISPDGARKYVRVTQTPFLIGRGAETGNHLQL |
| Ga0210389_105353481 | 3300021404 | Soil | MTETLSQLEAVLEVISPDGARKYVRVTQTPFLIGRAAETG |
| Ga0210383_108342111 | 3300021407 | Soil | MTEALAQSEAVLEVISPDGARKYVRVTQTPFLIGRGAETGNHLQLTD |
| Ga0210394_112939441 | 3300021420 | Soil | MTEPLVQSEAVLEVISPDGARKYVRVTQVPFLMGRGAET |
| Ga0210390_106454871 | 3300021474 | Soil | MTEALAQSEAVLEVISPDGARKYVRVTQTPFLIGRGA |
| Ga0210410_1000154418 | 3300021479 | Soil | MTEQLVQSEAVLEVISPDGARKYVRVTQVPFLIGRGAE |
| Ga0126371_110497962 | 3300021560 | Tropical Forest Soil | MSEAISTSEAVLEVISNDGSKRYVRVTQTPFLIGRGAET |
| Ga0209824_102135171 | 3300025173 | Wastewater | MTDTQLIPDAALEVIGPDGSRRTVRVTQSPLLIGRGAETGNHLQLSD |
| Ga0208039_10570422 | 3300025454 | Peatland | MTEALAQSEAVLEVISPDGARKYVRVTQTPFLIGR |
| Ga0208563_10478201 | 3300025501 | Peatland | MTEALAQSEVVLEVISPDGARKYVRVTQTPFLIGR |
| Ga0207699_103310751 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEALATTEAVLEVISPDGARRYARVSQTPYMMGRG |
| Ga0207684_100638531 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MAETLGTTEAVLEVISPDGARRYARVAQTPYMMGRGAET |
| Ga0257146_10107621 | 3300026374 | Soil | MTEQLVQSEAVLEVISPDGVRKYVRVTQVPFLMGRGAETGNHLQLTD |
| Ga0209056_100897301 | 3300026538 | Soil | MAETLGTTEAVLEVISPDGARRYARVAQTPYMMGRGAETGNH |
| Ga0207801_1104641 | 3300026810 | Tropical Forest Soil | MTETLAQSEAVLEVISPDGARKYVRVTQTPFLLGRGAETGN |
| Ga0207723_1131591 | 3300026824 | Tropical Forest Soil | MTETLAQSEAVLEVISPDGARKYVRVTQTPFLLGRGAETG |
| Ga0207804_1050772 | 3300026849 | Tropical Forest Soil | MTEALSQAEAVLEVISPDGARKYVRVTQTPFLIGRGAETGNHLQLTDR |
| Ga0207818_10134911 | 3300026868 | Tropical Forest Soil | MTETLAQSEAVLEVISPDGARKYVRVTQTPFLLGR |
| Ga0207763_10140531 | 3300026879 | Tropical Forest Soil | MTEALSQAEAVLEVISPDGARKYVRVTQTPFLIGRGAETGNHLQLTDRRI |
| Ga0207858_10073651 | 3300026909 | Tropical Forest Soil | MTETLAQSEAVLEVISPDGARKYVRVTQTPFLLGRG |
| Ga0208365_10407151 | 3300027070 | Forest Soil | MTEPLVQSEAVLEVISPDGARKYVRVTQVPFMIGRGAETGNHLQLTDRR |
| Ga0209731_10145802 | 3300027326 | Forest Soil | MTETLAQSEAVLEVISPDGARKYVRVTQTPFLLGRGAETGNHL |
| Ga0209735_10521112 | 3300027562 | Forest Soil | MVETLATTEAVLEVISPDGARRYARISATPYMIGRGAEDEVCADA |
| Ga0209525_10696891 | 3300027575 | Forest Soil | MTEPLVQSEAVLEVISPDGARKYVRVTQVPFLMGRGAETGNHLQLTDRRI |
| Ga0209656_105407572 | 3300027812 | Bog Forest Soil | MTEALSPIEAVLEVISPDGARKYVRISQLPFLIGRGSETGN |
| Ga0209060_105326692 | 3300027826 | Surface Soil | MTGKTGITDTLAQSEAVLEVISPDGARKYVRVTQTPFLIGRG |
| Ga0209415_104669182 | 3300027905 | Peatlands Soil | MTEALAQSEAVLEVISPDGARKYVRVTQTPFLIGRGSETGNHLPLTD |
| Ga0170822_156799872 | 3300031122 | Forest Soil | MTETLSQLEAVLEVISPDGARKYVRVTQTPFLIGRGAE |
| Ga0170824_1288059103 | 3300031231 | Forest Soil | MTEPLVQSEAVLEVISPDGARKYVRVTQVPFLIGRGAETG |
| Ga0310915_105277852 | 3300031573 | Soil | MTETLAQTEAVLEVISPDGARKYVRVTQTPFLLGRGAETGNHLQLTDRRIS |
| Ga0318561_104058771 | 3300031679 | Soil | MTEALSQSEAVLEVISPDGSRKYVRVTQTPFLMGRCS |
| Ga0318561_105418511 | 3300031679 | Soil | MTETLAQSEAVLEVISPDGARKYVRVTQTPFLLGRGAETGNHLQLTD |
| Ga0318572_108829311 | 3300031681 | Soil | MAETLAANEAVLEVISPDGARRYARVGQTPYMIGRGAETGNHLQLN |
| Ga0307474_109181222 | 3300031718 | Hardwood Forest Soil | MTEALAQSEAVLEVISPDGARKYVRVTQTPFLIGRGAETGNH |
| Ga0307474_115031432 | 3300031718 | Hardwood Forest Soil | MTMESGSIGATLEVVSPGAAKQVVKITQLPFLIGRGAEAGNHLLLDDRRIS |
| Ga0306917_114527731 | 3300031719 | Soil | MTEALSQSEAVLEVISPDGSRKYVRVTQTPFLMGRGSETGNHLQLTD |
| Ga0307469_115381482 | 3300031720 | Hardwood Forest Soil | MAEALATTEAVLEVISPDGARRYARVSQTPYMMGRGAETGNHLQ |
| Ga0318500_102799032 | 3300031724 | Soil | MTETLAQTEAVLEVISPDGARKYVRVTQTPFLLGRGA |
| Ga0318501_105522301 | 3300031736 | Soil | MTETLTQSEAVLEVISPDGARKYVRVTQLPFLIGRGAETGNHLQLTDRRISR |
| Ga0306918_102787172 | 3300031744 | Soil | MTEPLAQAEAVLEVISPDGARKYVRVTQTPFLIGR |
| Ga0318543_102421291 | 3300031777 | Soil | MAETLAANEAVLEVISPDGARRYARVGQTPYMIGRGAETGNHLQ |
| Ga0318498_102467432 | 3300031778 | Soil | MTETLAQSEAVLEVISPDGARKYVRVTQTPFLLGRGAETGNHLQLTDRRISRNCGAI |
| Ga0318567_100431833 | 3300031821 | Soil | MTETLAQSEAVLEVISPDGARKYVRVTQTPFLLGRGAETGNHLQLTDRR |
| Ga0306919_106782522 | 3300031879 | Soil | MTETLAQSEAVLEVISPDGARKYVRVTQTPFLLGRGAETGNHLQ |
| Ga0318522_101787902 | 3300031894 | Soil | MTETLAQSEAVLEVISPDGARKYVRVTQTPFLLGRGAETGNHLQLTDRRISRNCGA |
| Ga0306923_103831971 | 3300031910 | Soil | MTETLTQSEAVLEVISPDGARKYVRVTQLPFLIGRGAETGNHLQLTDR |
| Ga0310913_103675592 | 3300031945 | Soil | MTETLAQSEAVLEVISPDGARKYVRVTQTPFLLGRGAE |
| Ga0310913_112464822 | 3300031945 | Soil | MTEALAQSEAVLEVISPDGARKYVRVSQTPFLIGRGAETGNH |
| Ga0310910_102072612 | 3300031946 | Soil | MTETLAQTEAVLEVISPDGARKYVRVTQTPFLLGR |
| Ga0318531_104815442 | 3300031981 | Soil | MTETLGQSEAVLEVISPDGARKYVRVTQLPFLIGRGAETGNHLQ |
| Ga0306922_112875971 | 3300032001 | Soil | MTETLGQTEAVLEVISPDGARKYVRVTQVPFLIGRG |
| Ga0318507_103846832 | 3300032025 | Soil | MTETLAQSEAVLEVISPDGARKYVRVTQTPFLLGRGAETGNHLQLTDRRISRNCGAIVLE |
| Ga0318558_100432023 | 3300032044 | Soil | MTETLAQSEAVLEVISPDGARKYVRVTQTPFLLGRGAETGNHLQL |
| Ga0318506_100726141 | 3300032052 | Soil | MTETLAQSEAVLEVISPDGARKYVRVTQTPFLLGRGAET |
| Ga0318570_102256962 | 3300032054 | Soil | VAETVLPSEDAVLEVVSPDGARRYVRVTQSPFLIGRGAETGNHLQ |
| Ga0318524_103629811 | 3300032067 | Soil | MTETLAQSEAVLEVISPDGARKYVRVTQTPFLLGRGAETGNHLQLTDRRISRNCGAIVL |
| Ga0318518_100731552 | 3300032090 | Soil | MTETLAQSEAVLEVISPDGARKYVRVTQTPFLLGRGAETGNHLQLTDRRISRNCGAIV |
| Ga0318540_102140521 | 3300032094 | Soil | MAETLAANEAVLEVISPDGARRYARVGQTPYMIGRGAETG |
| Ga0307470_100567851 | 3300032174 | Hardwood Forest Soil | MAESLATTEAVLEVISPDGARRYARVSQTPYMMGRGAETG |
| Ga0335077_112456051 | 3300033158 | Soil | MSDTLALSEAVLEVISPDGARKYVRVTQTPFLIGRGAETG |
| Ga0310914_108550962 | 3300033289 | Soil | MAETLAANEAVLEVISPDGARRYARVGQTPYMIGRGAETGNHLQLNDR |
| ⦗Top⦘ |